„Die Rolle des Agrartourismus für die Beschäftigungssituation in der

Сomentários

Transcrição

„Die Rolle des Agrartourismus für die Beschäftigungssituation in der
„Die Rolle des Agrartourismus für die Beschäftigungssituation in der
Region Kaschin, Russland“
„The role of agri-tourism for the employment situation in the region
Kashin, Russia”
Masterarbeit
eingereicht von
Liubov Kulaeva
für das Studium
Agrar- und Ernährungswirtschaft
H731457
an der Universität für Bodenkultur, Wien
am
Institut für Nachhaltige Wirtschaftsentwicklung
Betreuer:
Ao.Univ.Prof. Dipl.-Ing. Dr.nat.techn. Hans Karl Wytrzens
Matrikelnummer
0941667
Abgabetermin
Juni 2014
Eidesstattliche Erklärung
Eidesstattliche Erklärung
Ich erkläre, dass die vorliegende Diplomarbeit von mir selbst verfasst wurde und ich keine
anderen als die angeführten Behelfe verwendet bzw. mich auch sonst keiner unerlaubter
Hilfe bedient habe. Wörtlich oder sinngemäß übernommenes Gedankengut habe ich als
solches kenntlich gemacht.
Ich versichere, dass ich dieses Diplomarbeitsthema bisher weder im In- noch im Ausland
(einer Beurteilerin/einem Beurteiler zur Begutachtung) in irgendeiner Form als
Prüfungsarbeit vorgelegt habe.
ii
Kurzfassung
Kurzfassung
In dieser Masterarbeit werden Beschäftigungseffekte der letzten fünf Jahre des
aufkommenden ländlichen Tourismus in der Region Kaschin in Russland erforscht. Zu
Beginn der Arbeit werden Definitionen der Begriffe Agrartourismus, ländlicher
Tourismus, ländlicher Raum sowie des Begriffs Beschäftigungseffekte gegeben. Die
Exportbasistheorie und der Multiplikatoreffekt bilden eine Theoriebasis zur weiteren
Untersuchung. Das theoretische Modell analysiert die Einflussfaktoren auf die
Beschäftigungssituation einer Region im ländlichen Tourismus, und hier insbesondere im
Agrartourismus. Aufgrund des theoretischen Modells hat die Autorin Hypothesen
entworfen und diese in einer Multiple Case Study überprüft. Mit Hilfe narrativer
Interviews wurden Forschungsdaten für die Arbeit gesammelt. Als Analysemethode findet
wurde eine qualitative Datenanalyse durchgeführt. Zusätzlich wurden statistische Daten,
sowie Daten des Tourismusentwicklungsprogramms der Region herangezogen und zwei
Experteninterviews durchgeführt, um die Forschungsergebnisse zu vervollständigen. Die
Ergebnisse zeigen nur eine zögerliche Entwicklung des Agrartourismus in der Region
Kaschin. Wichtige Einflussfaktoren sind Erreichbarkeit und Wirtschaftslage. Die
Erreichbarkeit der Region ist durch Wetter- und Straßenbedingungen in den
Übergangszeiten erschwert. Gleichzeitig ist die Region Kaschin von den nächsten großen
Städten 160-210 km entfernt. Die Wirtschaftslage der Region erlaubt noch nicht die
Schaffung
einer
besseren
touristischen
Infrastruktur.
Touristen
bleiben
dem
Agrartourismussektor fern. In der Region Kaschin arbeitetet im Jahr 2013 rund 7000
Personen davon nur 160 Personen in Gastronomie und Beherbergung. Im Bereich
ländlicher Tourismus hat in der Region Kaschin nur ein Betrieb Herbergen. Ein weiterer
Betrieb veranstaltet Volksfeste und bietet überwiegend Exkursionen für Moskauer Gäste in
der Region Kaschin an. Das im Jahr 2013 gestartete Tourismusentwicklungsprogramm
unterstützt die regionale Initiative im Tourismus allgemein, hat aber zur Zeit des
Schreibens vorliegender Masterarbeit noch keine Resultate gezeigt. Die Arbeit
veranschaulicht die Hürden und Chancen des ländlichen Tourismus in der Region und
dient als Vorarbeit zur weiteren Forschung. Die vorliegende Arbeit verdeutlicht die
Bedeutung des Agrartourismus für die Entwicklung der Region Kaschin.
iii
Abstract
Abstract
The aim of this master thesis is to research employment effects of rural tourism in the
recent five years in the Kashin region, Russia. At the beginning of the thesis definitions of
the terms agritourism, rural tourism, rural area and also employment effects will be
introduced. Export base theory and multiplier effect is a theory base for the research at
hand. The developed theoretical model elaborates seven factors, which can affect the
employment situation in rural tourism and, particularly, in agricultural tourism.
Consequently, an ensemble of advanced hypotheses, based on the theoretical model, has
been developed and examined using multiple case study research. Research data for the
analyses has been collected through several narrative interviews. A qualitative data
analysis has been used as analysis method. Additionally statistic data, data of the tourism
development program and two expert interviews aiming at the research result’s
improvement were used. According to the results, only a hesitant development of
agricultural tourism in Kashin region can be reported. Major influencing factors are
accessibility and the economic situation. The accessibility of the study region, being
located about 160-210 km from the next big cities, is complicated by harsh weather and
road conditions. The current economic situation does not allow the creation of any better
infrastructure for tourism and the attraction of more tourists to the agritourism sector. In
2013 about seven thousand persons have been working in Kashin region, only 160 of
whom working in accommodation and gastronomy. With regard to rural tourism only one
enterprise does provide accommodation service in Kashin. Another firm organizes public
festivals and provides excursions in the mainly for guests from Moscow. In 2013 a tourism
development program started, supporting general regional initiatives in tourism, but for the
time of writing this thesis did not show any results. Findings of the conducted research
represent the current situation in the region in terms of rural tourism and serve as a basis
for future research, highlighting its importance for the region.
iv
Abkürzungsverzeichnis
Abkürzungsverzeichnis
BIP
Brutto Inlands Produkt
bzw.
beziehungsweise
ca.
circa
CSDB
zentrale statistische Datenbank
d.h
das heißt
km
Kilometer
km²
Quadratkilometer
m²
Quadratmeter
Mio.
Million
Mrd.
Milliard
OECD
Organization for Economic Cooperation and Development
ROSSTATISTIKA
Federal State Statistics Service
ROSTURISM
Federal Agency for Tourism
Tsd.
Tausend
TSA
Touristensatellitenkonto
u.a.
unter anderem
usw.
und so weiter
UniSIS
Unified Interdepartmental Statistical Information System
vgl.
vergleiche
VZÄ
Vollzeit Äquivalent
WIFO
Österreichisches Institut für Wirtschaftsforschung
WWF
World Wildlife Fund
WWOOF
World Wide Opportunities on Organic Farms
z.B.
zum Beispiel
%
Prozent
v
Inhaltsverzeichnis
Inhaltsverzeichnis
ABKÜRZUNGSVERZEICHNIS ...................................................................................... V
1.
EINLEITUNG.............................................................................................................. 1
2.
DEFINITIONEN ......................................................................................................... 3
2.1. Ländlicher Raum ...................................................................................................................................... 3
2.2. Unterschied Agrartourismus und ländlicher Tourismus ...................................................................... 6
2.3. Beschäftigung und Beschäftigungseffekte ............................................................................................ 14
3.
THEORETISCHES RAHMENKONZEPT ............................................................ 20
4. EFFEKTE DES AGRARTOURISMUS AUF DIE
BESCHÄFTIGUNGSSITUATION EINER REGION .................................................. 26
4.1. Arbeitsmarktlage und Ausbildung ........................................................................................................ 29
4.2. Qualifikationen im Tourismus .............................................................................................................. 31
4.3. Soziale Einflüsse ..................................................................................................................................... 32
4.4. Erreichbarkeit ........................................................................................................................................ 35
4.5. Umfeldfaktoren ....................................................................................................................................... 37
4.5.1. Landwirtschaftliche Infrastruktur der Region .............................................................................. 37
4.5.2. Die ökologische Situation ............................................................................................................ 39
4.5.3. Die Tourismusinfrastruktur .......................................................................................................... 40
4.6. Tourismus- und Regionalentwicklungsstrategien................................................................................ 42
4.7. Politik und Rechtsvorschriften .............................................................................................................. 43
4.8. Wirtschaftslage ....................................................................................................................................... 44
5.
MATERIAL UND METHODEN ............................................................................. 49
5.1. Vorgehensweise zurGewinnung statistischer Daten über Tourismus ................................................ 49
5.2. Qualitative Methoden und Case Study Approach ............................................................................... 54
5.3. Das qualitative narrative Interview als Datenerhebungsmethode ..................................................... 59
5.4. Die Inhaltsanalyse als Auswertungsmethode ....................................................................................... 61
6.
UNTERSUCHUNGSREGION KASHIN ................................................................ 72
vi
Inhaltsverzeichnis
6.1. Geographische Lage der Region Kaschin ............................................................................................. 72
6.2. Landwirtschaft in der Region Kaschin ................................................................................................. 75
6.3. Tourismus der Region Kaschin ............................................................................................................. 81
6.4. Beschäftigungsstatistik und Bevölkerungsstatistik .............................................................................. 90
6.5. Fallbeispielunternehmen ........................................................................................................................ 94
6.5.1
Touristenlager Medveditsa (Туристическая база Медведица) .................................................. 94
6.5.2
Schar-Ptitsa (Жар-Птица) ............................................................................................................ 95
6.5.3
Tourismusbüro Schemtschuschina Kaschin ................................................................................. 96
6.
ERGEBNISSE............................................................................................................ 98
7.1. Durchgeführte Interviews ...................................................................................................................... 98
7.2. Arbeit und Ausbildung im Agrartourismus ....................................................................................... 102
7.3. Soziale Einflüsse ................................................................................................................................... 110
7.4. Erreichbarkeit ...................................................................................................................................... 112
7.5. Die Umfeldfaktoren .............................................................................................................................. 114
7.6. Tourismus- und Regionalentwicklungsstrategien.............................................................................. 118
7.7. Politik und Rechtsvorschriften ............................................................................................................ 123
7.8. Wirtschaftslage ..................................................................................................................................... 131
7.
DISKUSSION .......................................................................................................... 135
8.
ZUSAMMENFASSUNG ......................................................................................... 138
9.
ABBILDUNGSVERZEICHNIS ............................................................................. 141
10.
TABELLENVERZEICHNIS ............................................................................. 142
11.
VERZEICHNIS DER ÜBERSICHTSVERZEICHNIS ................................... 143
12.
VERZEICHNIS DER ANHÄNGE .................................................................... 143
13.
QUELLEN- UND LITERATURVERZEICHNIS ............................................ 144
14.
ANHANG ............................................................................................................. 150
vii
Einleitung
1. EINLEITUNG
Diese Masterarbeit widmet sich der Rolle des Agrartourismus (Urlaub auf dem Bauernhof)
für die Beschäftigungssituation in Kaschin, Russland. Kaschin ist eine Provinzstadt,
welche sich 210 km nördlich von Moskau im Gebiet Tver befindet. In der Stadt selbst und
den umliegenden „Dörfern“ leben rund 27.000 Menschen auf einem Territorium von 2010
km2. Die vorliegende
Masterarbeit
verfolgt
das
Ziel, herauszufinden, welche
Beschäftigungseffekte in der Region auf den aufkommenden ländlichen Tourismus und
insbesondere den Agrartourismus während der letzten sieben Jahre zurückzuführen sind.
Der Agrartourismus scheint zurzeit in Russland und insbesondere in der Region Kaschin
absolut bedeutungslos zu sein. Die Wirtschaftsstruktur im Agrartourismus muss erst
aufgebaut werden. Der Agrartourismus hat in westlichen Ländern eine große Bedeutung
für die Fremdenverkehrswirtschaft und für die Landwirtschaft. Seit sich die wirtschftliche
und politische Struktur in Russland zu Beginn der 90er Jahre geändert hat, versuchte man
die Tourismusentwicklung bewusst zu forcieren. Aktuell sind die Olympischen Spiele in
Sotschi im Jahr 2014 ein gutes Beispiel für eine solche Tourismusforcierung. Auch für die
an das Moskauer Gebiet angrenzenden Regionen, wie zum Beispiel Kaschin, gibt es
Chancen, die Tourismusinfrastruktur zu verbessern und die Beschäftigung zu
diversifizieren. Die Region Kaschin ist reich an Naturressourcen, auf denen der Tourismus
aufbauen kann. Zurzeit ist der Agrartourismus wenig entwickelt.
Zielsetzung dieser Masterarbeit, ist die Beschäftigungseffekte des Agrartourismus in der
Region Kaschin darzustellen. Diese Forschungsfrage - welche Beschäftigungseffekte gibt
es aufgrund des Agrartourismus in der Region Kaschin - lässt sich in folgende Unterfragen
auflösen. Die erste Unterfrage ist, was in Russland ein ländlicher Raum ist. Denn davon ist
auch abhängig, was man unter Agrartourismus bzw. ländlichem Tourismus in der Region
Kaschin versteht. Begriffe wie zum Beispiel Beschäftigungseffekte oder Agrartourismus
brauchen für diese Arbeit eine genaue Bestimmung. Anschließend wird auf theoretische
Aspekte der Beschäftigung sowie der Regionalentwicklung eingegangen.
Als Grundlage zur Erforschung der Beschäftigungseffekte dient die Beschäftigungstheorie
bzw. Arbeitsmarkttheorie. Darüber hinaus wird der Multiplikatoreffekt nach Keynes bei
der Entwicklung der Beschäftigung erläutert. Die Exportbasistheorie stellt einen Bezug zur
1
Einleitung
regionalen Entwicklung her, da sie eine Entwicklungstheorie ist, die „ihre Stärken in der
Analyse kleinräumig definierter Regionalwirtschaften hat“ (BRAUN and SCHULZ, 2012).
Tourismus wird als exportierte Dienstleistung für die Entwicklung einer Region betrachtet.
Um Hypothesen zur Beantwortung der Forschungsfrage aufzustellen, wird anhand der
Literaturrecherche ein theoretisches Modell ausgearbeitet. Das Modell stellt verschiedene
Einflussfaktoren auf Beschäftigungseffekte in einer Region dar, woraus sich die
Hypothesen für die empirische Untersuchung ableiten lassen. Im nächsten Kapitel
„Material und Methoden“ werden statistische Vorgehensweise sowie qualitative Methoden
(Case Study Design nach Yin, narrative Interviews, qualitative Inhaltsanalyse nach
Mayring) beschrieben. Die eigenen Datenerhebungen erfolgten mit Experten im Bereich
der Tourismusentwicklung und Mitarbeitern der Agrartourismusbetriebe in der Region
Kashin mittels telefonisch geführter Interviews. Diese Daten lassen sich mit Hilfe der
qualitativen Inhaltsanalyse nach Mayring auswerten. In einem weiteren Kapitel wird die
Untersuchungsregion Kashin vorgestellt, bevor die Ergebnisse der vorliegenden Arbeit
dargestellt werden. Abschließend werden Verbesserungsstrategien für die Entwicklung des
ländlichen Tourismus in der Region erörtert und zusammengefasst.
2
Definitionen
2. DEFINITIONEN
In diesem Kapitel werden die für die Arbeit wichtigsten Begriffe erläutert, wozu vor allem
die Begriffe ländlicher Raum, Agrartourismus und ländlicher Tourismus, Beschäftigung,
Beschäftigungseffekte und Arbeitslosigkeit zählen. Unterschiedliche Definitionen von
Agrartourismus, Urlaub am Bauernhof, sowie ländlicher Tourismus werden ebenso in
diesem Kapitel diskutiert, da in Russland zum Zeitpunkt des Entstehens der vorliegenden
Arbeit kein offizieller Begriff den Agrartourismus betreffend, z. B. in der amtlichen
Statistik oder im Tourismusgesetz, existiert. Der Fakt der fehlenden Definition hat die
Autorin vor die Aufgabe gestellt, nach einer eigenen, für diese Arbeit passenden
Agrartourismusdefinition zu suchen. Diese Definition wird anschließend dargestellt.
2.1. Ländlicher Raum
Da die vorliegende Arbeit hauptsächlich die Beschäftigungseffekte des ländlichen
Tourismus in Russland zu erforschen hat, müssen die Begriffe Ländlichkeit und ländlicher
Raum aus der russischen Sicht definiert werden. Diese Definition ist im „Konzept der
nachhaltigen Entwicklung der ländlichen Gebiete der Russischen Föderation für den
Zeitraum bis 2020“ (2010) zu finden. „Ländliche Territorien sind Territorien der
ländlichen Siedlungen und dazugehörende Zwischensiedlungsterritorien ("сельские
территории" - территории сельских поселений и соответствующие межселенные
территории). Unter Zwischensiedlungsterritorien versteht man Territorien, welche sich
außerhalb der Siedlungsgrenzen befinden ("межселенные территории" - территории,
находящиеся вне границ поселений). Die Definition ist nicht genau und braucht
offensichtlich einige Erklärungen. Laut dieser Definition bleibt unklar, ob nicht bewohnte
Territorien Russlands als ländlich betrachten werden sollen oder nicht; wie weit sollten die
Siedlungen voneinander entfernt sein, damit die Zwischenterritorien als ländlich gelten; ob
alle Territorien, welche nicht städtisch sind, als ländlich verstanden werden dürfen. Das
Programm ist für wirtschaftspolitische Zwecke entworfen worden und beinhaltet keine
wissenschaftliche Grundlage. Zum Teil lässt sich das Problem durch methodische
Vorschriften des ROSSTATISTIKA erklären. In Russland nimmt der ländliche Raum
(bewohnte Territorien außerhalb städtischen Siedlungen) zwei Drittel der Landfläche ein
3
Definitionen
und ist von 39,2 Mio. Menschen (27% der Landbevölkerung) bewohnt. Rund 150 Tsd.
bewohnte Orte werden durch 24409 ländliche Administrationen und 1865 ländliche
Regionen verwaltet. Als städtische zählt man bewohnte Orte, die rechtlich als Städte bzw.
Siedlungen städtischer Typ (Mitarbeitersiedlungen, Kursiedlungen, Datschasiedlungen)
bestimmt sind. Alle anderen Siedlungen nach der Methodik des ROSSTATISTIKA zählen
zu ländlichen Siedlungen.
Als wissenschaftliche Grundlagen dieser Arbeit dienen Werke von Lane, Robinson,
Hoggart, Sharpley, Roberts and Hall.
Die Begriffe Ländlichkeit, ländlicher Raum und ländlicher Tourismus brauchen für diese
Arbeit eine klare Definition. Lane weist in seinem oft zitierten Artikel „What is rural
tourism“ darauf hin, dass die Abgrenzung des ländlichen Raums bereits allgemein
schwierig ist. Allerdings ist eine Abgrenzung des ländlichen Tourismus mit der Definition
des ländlichen Raums eng verbunden. Lane bezeichnet ländlichen Tourismus als „multifaceted“ und sehr von den landspezifischen Merkmalen abhängig. In dem Artikel
beschreibt er ländliche Regionen als diejenigen, die eine niedrige Bevölkerungsdichte
haben
und
wo
die
land-
und
forstwirtschaftlichen
Kulturlandschaften
sowie
Naturlandschaften dominieren.
Weiters erwähnt er, dass das OECD Rural Development Programme als Indikatoren für
ländlichen Raum auf lokaler Ebene eine Bevölkerungsdichte unter 150 Personen pro
Quadratkilometer
benutzt,
und
auf
regionaler
Ebene
anhand
des
ländlichen
Bevölkerungsanteils zwischen überwiegend ländlich (>50%), teils ländlich(15-50%) und
überwiegend städtisch (<15%)” (ROBERTS and HALL, 2001 and BRAMWELL and
INTERNATIONAL SCHOOL ON RURAL DEVELOPMENT, 1994) unterscheidet.
“from this array of varying definitions, two clear points stand out. Rural settlements may
vary in size, but they are small, and always with a population of less than 10,000
inhabitants. They are almost always in areas of relatively low population density. Both of
these points are important in tourism terms: the majority of tourists come from densly
populated and large settlements – they seek a change of scene while on holiday. Tourism is
in many respects a form of escapism (Plog, 199) (BRAMWELL and INTERNATIONAL
SCHOOL ON RURAL DEVELOPMENT, 1994).
4
Definitionen
Die
Bevölkerungsdichte,
die
Landwirtschaft
und
-nutzung
und
traditionelle
Soziostrukturen hat Lane im Jahr 1994 als drei klare wichtige Identifizierungsmerkmale
für den ländlichen Raum vorgeschlagen. Das erste Kriterium ist eine rurale
Bevölkerungsdichte unter 150 Personen pro km² (ROBERTS and HALL, 2001,
BRAMWELL and INTERNATIONAL SCHOOL ON RURAL DEVELOPMENT, 1994).
Das zweite Kriterium definiert ländlichen Raum als hauptsächlich diejenigen Gebiete,
deren Wirtschaftsleistung auf traditioneller Agrar- und Forstindustrie basieren (ROBERTS
and HALL, 2001). Das dritte Kriterium zur Unterscheidung evident ländlichen Raums von
urbanen Gebieten sind traditionelle soziale Strukturen. In der modernen urbanen
Gesellschaft sind Eigenschaften, die mit der ländlichen Gesellschaft assoziiert werden, wie
Zusammengehörigkeitsgefühl, eher lokale als kosmopolitische Kultur und langsame,
weniger materialistische Lebensweise, zum Großteil verloren. (ROBERTS and HALL,
2001).
Außerdem wird laut Europäischer Charta des ländlichen Raums der Begriff ländlicher
Raum durch folgende Charakteristiken gekennzeichnet:
„A stretch of inland or coastal countryside, including small towns and villages, where the
main part of the area is used for:
a) agriculture, forestry, aquaculture and fisheries;
b) economic and cultural activities of country-dwellers (crafts, industry, services,
etc.)
c) non-urban recreation and leisure areas (or natural reserves);
d) other proposes, such as for housing” (ROBERTS and HALL, 2001).
Mormont (1987) konzeptualisierte ländliche Territorien als „a set of overlapping social
spaces, each with their own logic, institutions and network of actors… Rural spaces need
to be defined in terms of how the occupants perceive it: as a social construct where the
occupants of rural spaces interact and participate in activities such as recreation and
tourism” (ROBERTS and HALL, 2001). Der Wunsch der Touristen, die traditionelle
Lebensweise kennen zu lernen, motiviert sie und steigert das Interesse an dem ländlichen
Kulturerbe. Sørensen und Nilsson argumentierten im Jahr 1994, dass “the attraction of the
offer, and thereby a definition … is predicated on a negative assumption: countryside life
5
Definitionen
is what urban life is not. Und weiters ergänzten sie “the notion of ‘rural tourism’ shares the
same origin as the notion of ‘alternative tourism’, this again conceived by means of
negation: non-urban, i.e. rural; non costal, i.e. non-hedonistic; non-mass i.e. small-scale;
nonpackaged i.e. individualistic… this… comes close to be(ing) perceived as an antitourism tourism… Im Jahr 1997 schrieben Sørensen und Nilsson dazu noch “ the attraction
of the rural is not only rural but also of images of models of tourism” (ROBERTS and
HALL, 2001). Es ist bereits zu sehen, wie stark die Begriffe „Tourismus im ländlichen
Raum“ und „Ländlichkeit“ verbunden sind. In nächstem Unterkapitel werden die Begriffe
Agrartourismus und ländlicher Tourismus näher in der Literatur betrachtet.
Der Begriff „rural“ bezeichnet einen besonderen Typ sozialer und politischer Strukturen
mit charakteristischen Merkmalen. Diese Merkmale unterscheiden sich von urbanen.
„While national governments use specific criteria to define „rural“, often based on the
population density of settlements, there is no universal agreement on the critical population
threshold which distinguishes between urban and rural populations, although some
commonality is emerging within Europe“ (ROBERTS and HALL, 2001).
2.2. Unterschied Agrartourismus und ländlicher Tourismus
Zu Beginn richten wir einen Blick auf die internationale Definition des Tourismus der
UNWTO. „Der Tourismus umfasst Reisen, die:
1. außerhalb der gewohnten Umgebung stattfinden;
2. zu Freizeit-, Geschäfts- oder bestimmten Nicht-Erwerbszwecken erfolgen;
3. mit einer Aufenthaltsdauer von nicht länger als einem Jahr ohne Unterbrechung
stattfinden (RÖSNER and STOCKERT, 2012).
Die „Gewohnte Umgebung“ ist das geografische Gebiet (beziehungsweise mehrere
geografische Gebiete) der alltäglichen Routine. Die Abgrenzung erfolgt individuell und
bleibt dem Befragten überlassen (d. h., konkrete Vorgaben, beispielsweise bezogen auf die
Reiseentfernung, erfolgen grundsätzlich nicht). Eigene Ferienhäuser gehören nicht zur
gewohnten Umgebung (somit werden Aufenthalte in eigenen Ferienhäusern im Sinne
dieser Definition als touristische Reisen betrachtet). Und Nicht-Erwerbszwecke sind
6
Definitionen
beispielsweise Aufenthalte in Kur- und Rehabilitationskliniken, Studienaufenthalte (kürzer
als ein Jahr), etc.“ (RÖSNER and STOCKERT, 2012).
In Russland definiert man Tourismus etwas genauer als in der internationalen Definition
des Tourismus der UNWTO. Im Unterschied zur UNWTO wird in Russland für Tourismus
eine Aufenthaltsdauer von 24 Stunden bis 6 Monaten bestimmt. Ausserdem soll laut
Tourismusgesetz der Russischen Föderation mindestens eine Übernachtung stattfinden.
Tagesreisen ohne Übernachtungen werden im Tourismusgesetz als Exkursionen definiert
(TOURISMUSGESETZ, 1996).
Wenn die touristische Tätigkeit in ländlichem Raum stattfindet, ist die Terminologie, die
touristische Aktivitäten im ländlichen Raum beschreibt vielfältig: Ländlicher Tourismus,
Agrartourismus, Urlaub am Bauernhof, sanfter Tourismus, Ökotourismus, grüner
Tourismus etc. Diese Begriffe werden entweder synonym oder, von einem Land zum
anderen, von einem Benutzer zum anderen verschieden verwendet (ROBERTS and HALL,
2001). Die Begriffe
„Ländlicher Tourismus“ und „Agrartourismus“ liegen eng
beieinander, spielen sich aber teilweise auf unterschiedlichen Ebenen ab (STRASDAS).
Der Begriff „ländlicher Tourismus“ – “the term ‘rural tourism’ has been adopted by the
European Community (EC) to refer to all tourism activity in rural area. This is doubly
problematic while, helpfully, it draws away from the dominance of farm-related activity
inherent in such terms as agri- and agrotourism, it: (i) ignores large-scale mass recreation
complexes such as Center Parcs, located in otherwise rural areas; and (ii) it begs the
question of how rural tourism it defined” (ROBERTS and HALL, 2001). Der Begriff
„Ländlicher Tourismus“ ist umfassender als der Begriff „Agrartourismus“. „Ländlicher
Tourismus“ erschöpft sich demnach nicht allein im „Urlaub auf dem Bauernhof“ und ist
ebenso nicht zwangsläufig an ein landwirtschaftliches Angebot geknüpft“ (STRASDAS).
Folgend werden die Definitionen der Tourismusformen im ländlichen Raum nach Sharpley
dargestellt (ROBERTS and HALL, 2001):

Agri-/agrotourism: although often used to describe all tourism activities in rural
areas (covering, for example, festivals, museums, craft shows and other cultural events and
attractions), more frequently either term relates to tourism products which are ‘directly
connected with the agrarian environment, agrarian products or agrarian stays’: staying on a
farm, whether in rooms or camping, educational visits, meals, recreational activities, and
7
Definitionen
the sale of farm produce or handicrafts (Jansen-Verbeke and Nijmengen, 1990)
(ROBERTS and HALL, 2001).

Farm tourism: explicitly farm-related and most usually associated with tourism
involving staying in farm accommodations and seeking experience from farm operations
and attractions (e.g. Gladstone and Morris, 1998, 1999) (ROBERTS and HALL, 2001).

Wilderness and forest tourism: may be implicitly included within notions of rural t
ourism, or they may be regarded as separate (e.g. Meier-Gresshof, 1995; Asikainen, 1997).
In a number of countries they will not be relevant, or their relevance will vary considerably
. (ROBERTS and HALL, 2001).

Green tourism: although in some countries the term ‘green tourism’ refers
specifically to the tourism in the countryside (‘green areas’), it is more commonly used to
describe forms of tourism that are considered to be more environmentally friendly than
traditional, mass tourism, or as marketing ploy to suggest such eco-friendliness, even
where it may not exist. Variously employed synonymously with ‘alternative’ (Butler,
1990; Wheeller, 1993), ‘responsible’ (Wood and House, 1991), ‘soft’ (Slee, 1998), or
‘new’ (Poon, 1993) tourism, green tourism is portrayed as an approach to tourism
development which seeks to develop a symbiotic relationship (Budowski, 1976) with the
physical and social environment on which it depends, and implicitly seeks to attain
sustainability ideas. Such terminology has been particularly important in what some might
view as little more than a make-over of the marketing of certain types of mass activity
which might otherwise be characterized as entailing a parasitic rather than symbiotic
relationship. Indeed, the ‘green’ of green tourism might be seen to apply to some tourists’
unquestioning consumption of eco-related labeling (also below) (ROBERTS and HALL,
2001).

Ecotourism: a form of nature tourism (tourism to natural, unposit areas) which
assumes active promotion of environmental conservation and direct benefits for local
societies and cultures, together with the provision for tourists of a positive, educative
experience. It has been viewed as offering opportunities for the integration of rural
development, tourism, resource management and protected area management (Hvenegaard,
1994), and is regarded as a subset of rural tourism … However, specialist interest of the
natural environment – such as birdwatching or geology – does not necessarily presuppose
8
Definitionen
environmental awareness in a holistic sense, and the above reservation about eco-labeling
particularly applies (ROBERTS and HALL, 2001)
Die von Lane (1994) identifizierten Schlüsselelemente für ländlichen Tourismus sind
folgende:

Located in rural areas;

Functionally rural: built upon the rural world’s special features of small-scale
enterprise, open spaces, contact with nature and the natural world, heritage, ‘traditional’
societies and ’traditional’ practices;

Permits participation in the activities, traditions and lifestyles of local people;

Provides personalized contact;

Rural in scale – both in terms of building and settlements – and, therefore, usually
small-scale;

Traditional in character, growing slowly and organically, and connected with local
families. It will often be very largely controlled locally and developed for the long-term
good of the area;

Of many different kinds, representing the complex pattern of rural environment,
economy, history and location;

A high percentage of tourism revenue benefiting the rural community.
Zu einem internationalen Vergleich und näherer Betrachtung werden weitere komplexe
Definitionen aus Italien und Frankreich dargestellt. Eine Definition des Agrartourismus in
Italien in einem wissenschaftlichen Artikel lautet: Agrartourismus ist eine Aktivität in der
Welt der landwirtschaftlichen Produktion, wo typische Produkte und Dienstleistungen wie
Unterkunft, Kultur und Erholung angeboten werden… Schon 1983 definierte Albisinni den
Agrartourismus nicht nur als eine Form touristischer Initiative im ländlichen Raum,
sondern auch als eine, welche vom Landwirt selbst oder in einer assoziativen Form
gesteuert wird (INTERNAZIONALE SULL’AGRITURISMO, s.a.). „Agriturismo non è
qualunque formadi iniziativa turistica in ambiente rurale, ma solo quella che sia gestita,
9
Definitionen
individualmente o in forma associata, da chi è già imprenditore agricolo”. Eine Studie aus
Frankreich beschreibt es noch deutlicher, que le tourisme rural englobe l’ensemble des
activités touristiques pratiquées dans le territoire rural humanisé, l’agrotourisme se
pratique dans un milieu agricole ou à vocation agricole, alors que le tourisme à la ferme
se limite au territoire de la ferme (MARCOTTE, s.a.) – dass der ländliche Tourismus alle
touristischen Aktivitäten im bewohnten ländlichen Raum einschließt. Agrartourismus
findet im landwirtschaftlichen Raum oder im landwirtschaftlichen Betrieb statt, während
Urlaub am Bauernhof sich auf das Territorium des Bauernhofs beschränkt.
Auch in Übersee wird der Agrartourismus betrieben. Wissenschaftler in Chile, Brasilien
und Panama haben sich mit dem Agrar- bzw. ländlichen Tourismus auseinandergesetzt.
Beispielsweise sind folgende Definitionen des Agrartourismus zu finden. In Chile wird der
Begriff ähnlich wie in Italien definiert. Das touristische Angebot basiert auf
Dienstleistungen wie Unterkunft und Gastronomie, dabei ist Agrartourismus als eine in
ländlichen Gebieten entwickelte Form des Tourismus definiert. Eine Bedingung dafür ist
die Land- und Forstwirtschaft als Hauptbeschäftigung und Einkommensquelle der
Einwohner. Der Tourist kann aktiv an verschiedenen Produktionsarbeiten teilnehmen
(CONSTABEL et al., 2011). Aktivitäten wie Ernten, Melken, Dreschen, Konservieren,
Hilfe bei der Fütterung und Pflege der Tiere im Betrieb sollen dem Vergnügen oder der
Ausbildung dienen. Dadurch entsteht ein Zusatzeinkommen für den landwirtschaftlichen
Betrieb (FENTANES, s.a.). Agrartourismusbetriebe können Unterbringungsmöglichkeiten
zur Verfügung stellen oder nur Tagesaktivitäten anbieten (GAGNON, 2012). Die Familie
eines Agrartourismusbetriebs betreut ihre Gäste bei den verschiedenen Aktivitäten.
(ROMÁN and CICCOLELLA, 2009).
Nach einer Studie aus Brasilien schafft Agrartourismus zusätzliche Beschäftigung zur
landwirtschaftlichen Aktivität einer Familie. Im Gegensatz zum Agrartourismus ist
ländlicher Tourismus über den ländlichen Raum, in dem touristische Aktivitäten
stattfinden, definiert. Dabei dient im weiteren Sinne der ländliche Raum als Basis für
diesen Tourismustyp (DE OLIVEIRA SANTOS et al., 2012). Es ist anzumerken, dass
dabei die Landwirtschaft sowohl Haupttätigkeit, als auch Nebentätigkeit einer Familie sein
kann.
Der Agrartourismus erfüllt genau die Anforderungen, die eine nachhaltige Entwicklung an
neue
wirtschaftliche
Möglichkeiten
stellt:
eine
Tätigkeit,
die
neue
10
Definitionen
Beschäftigungsmöglichkeiten generiert, vor allem für Frauen und Jugend im ländlichen
Raum; neue Initiativen in Zeiten traditionell niedriger Produktion; ergänzt Ackerbau,
Viehzucht, Milchwirtschaft, Gartenbau, Blumenzucht, Imkerei, etc.., schont die Qualität
der nationalen Ökosysteme und stellt eine gute Möglichkeit für die Vermarktung
landwirtschaftlicher Produkte mit Ursprungsbezeichnung als auch den Namen der
Regionen, welche mit traditionellen Produkten assoziiert werden, dar. (El agroturismo
cumple precisamente estos requisitos que el desarrollo sustentable le pide a las nuevas
opciones económicas: es una actividad que genera nuevas oportunidades de empleo,
especialmente para las mujeres y los jóvenes rurales; aporta ingresos frescos en épocas de
baja actividad productiva tradicional, se complementa con la agricultura, ganadería,
lechería, horticultura, floricultura, apicultura, etc.; ayuda a la conservación de la calidad
de los ecosistemas nacionales y representa una buena opción para la comercialización de
productos agropecuarios con denominación de origen, posicionando a nivel internacional
el nombre de las regiones y zonas asociadas a productos tradicionales.) Der
Agrartourismus ist nicht nur eine neue Wirtschaftstätigkeit, oder eine zusätzliche Tätigkeit
neben der Landwirtschaft. Der Agrartourismus ist ein außergewöhnliches Instrument um
die ländlichen Gebiete mit der städtischen Welt zusammen zu führen. Der Agrartourismus
verbindet "zwei Welten", welche so anders sind und welche, wie die Gesellschaft, einen
gemeinsamen Ursprung und ein gemeinsames Schicksal haben: das Land, seine Menschen
und seine Kultur. Der Motor der Entwicklung des Agrotourismus ist sein wirtschaftliches
Potenzial, da er u.a. viele positive externe Effekte erzeugt, was ihn zu einem
leistungsfähigen Werkzeug für die Entwicklung und Verbreitung von Kultur macht. (El
agroturismo no es simplemente una actividad económica más, o adicional al trabajo
agrícola. El agroturismo constituye un extraordinario vehiculo o instrumento para
vincular al mundo rural con el mundo urbano, para juntar “dos mundos” que aparecen
tan distintos y que, como sociedad tiene un origen y destino común: el territorio, su gente y
su cultura. El motor del desarrollo del agroturismo es su potencial económico, pero
genera muchas externalidades positivas que lo convierten en un potente instrumento de
desarrollo y de difusión cultural) (CONSTABEL et al., 2011).
Die Darstellung der zahlreichen Merkmale des Agrartourismus bzw. ländlichen Tourismus
zeigt, dass man ihn zweckgebunden definieren kann.
11
Definitionen
Das russische Landwirtschaftsministerium hat ein Entwicklungsprogram für ländliche
Territorien iniziiert. TOPOROV (2010) hat in seinem Beitrag während des ersten
internationalen Forums „Ländlicher Tourismus in Russland“ im Jahr 2010 formuliert, dass
der Begriff Agrartourismus nicht eindeutig sei und alle „abwechslungsreichen
Tourismustypen, vom ethnographischen bis Wellnesstourismus“ zu ihm gezählt werden.
Im selben Vortrag hat er angemerkt, dass das Ziel des Aufenthalts Erholung und/oder ein
Kennenlernen der landwirtschaftlichen Arbeitsweisen ist. In diesem Beitrag zeigt Toporov
die Notwendigkeit der Distanz zwischen „ländlichen Siedlungen und Zonen des
mehrstöckigen Industriebaus“ für den Agrartourismus auf.
Aus methodischen Empfehlungen für den Agrartourismus in Russland geht hervor, dass
der ländliche Tourismus für städtische Bewohner eine Erholung in Gästehäusern biete.
Solche Gasthäuser werden von einer Familie auf dem für die Farm zugeordneten Land und
auf der Grundlage ihrer eigenen Wohnung bzw. ihres Hauses geschaffen. Die Familie sorgt
für die Unterkunft, Verpflegung und das Kennenlernen der Sehenswürdigkeiten auf dem
Land. (Сельский туризм – это отдых горожан в сельской местности в гостевых
домах, созданных сельской семьей на основе собственного жилого дома и
приусадебного участка, а также на земельном участке, отведенном под
фермерское хозяйство. Главной фигурой, обеспечивающей проживание, питание и
знакомство с достопримечательностями сельской местности, является сельская
семья) (КАРЯКИН, 2011).
Aus einem Artikel von ALEKSANDROVA (2010) stammt diese Definition: „der grüne
Tourismus (green rural tourism) oder Agrartourismus (agrotourism, farm tourism) ist eine
Erholung in ländlichen Gebieten (Dörfer, Bauernhäuser). Insbesondere ist der
Agrartourismus in den USA und westeuropäischen Ländern bekannt. Touristen führen eine
Zeit lang ein ländliches Leben. Sie leben in der Natur und lernen Werte der volkstümlichen
Kultur und der angewandten Kunst, nationale Lieder und Tänze und lokale Bräuche
kennen. Außerdem nehmen Touristen an der traditionellen Arbeit, volkstümlichen Festen
und Festivals teil. Agrartourismus ist einer der Sektoren der Tourismusbranche. Er
konzentriert sich auf die Nutzung von Naturressourcen und weiteren Ressourcen des
ländlichen Raums sowie auf die Nutzung der spezifischen regionalen Merkmale zur
Schaffung eines komplexen touristischen Produkts.
12
Definitionen
Agrartourismus bestimmt in vieler Hinsicht die Beschäftigung der ländlichen Bevölkerung
sowie einen Teil des Einkommens eines landwirtschaftlichen Betriebes. Das Konzept des
Agrartourismus ist sehr einfach: das Angebot für die Urlauber beinhaltet die Möglichkeit
im ländlichen Raum zu wohnen, traditionellen Lebensstil und traditionelle Küche kennen
zu lernen, an landwirtschaftlichen Arbeiten teilzunehmen, die Schönheit der unberührten
Ecken der Natur und den Vogelgesang zu genießen sowie Reiten, Angeln, Jagen und
Wandern. Im Gegensatz zu anderen Richtungen des Tourismus hat der Agrartourismus
seine Besonderheit in niedrigen Kosten, vor allem für Unterkunft und Verpflegung.
Selbstverständlich ist die Verpflegung auf dem Land um etwa die Hälfte billiger als in der
Stadt. Die Unterkunft ist hier auch billiger, vor allem im Sommer. Dadurch werden die
Kosten für die Reise zumindest halbiert“. (Зеленый сельский туризм (green rural
tourism), или агротуризм (agrotourism, farm tourism), особенно популярный в США и
странах Западной Европы, – отдых в сельской местности (в деревнях, на хуторах, в
удобных крестьянских домах). Туристы некоторое время ведут сельский образ
жизни среди природы, знакомятся с ценностями народной культуры, прикладного
искусства, с национальными песнями и танцами, местными обычаями, принимают
участие в традиционном сельском труде, народных праздниках и фестивалях.
Агротуризм – один из секторов туристической отрасли, который ориентирован на
использование природных и иных ресурсов сельской местности и её специфики для
создания комплексного туристского продукта. Аграрный туризм во многом
определяет занятость сельского населения и определенную долю прибыли хозяйств.
Его концепция довольно проста: клиенту предлагают проживание в сельской
местности и приобщение к традиционному образу жизни деревень, участию в
сельскохозяйственных
работах,
знакомству
с
подлинной
местной
кухней,
наслаждению красотами нетронутых уголков природы, пением птиц, верховой
ездой, рыбалкой, охотой и прогулками в горах и цветущих долинах. В отличие от
других направлений туристской сферы агротуризм имеет свою специфику, которая
выражается в минимизации издержек, прежде всего на питание и проживание.
Проживание здесь также обходится дешевле, особенно в летний период. Это как
минимум вдвое снижает стоимость путевок.)
Für diese Masterarbeit ist die Definition ländlicher Tourismus inklusive Tagesaktivitäten
ohne Übernachtung relevant. Dadurch kann die Vielfalt aller landwirtschaftlichen, ländlich
13
Definitionen
und touristisch geprägter Beschäftigung sowie Beschäftigungseffekte in einer lokalen
Region ausführlich dargestellt werden.
2.3. Beschäftigung und Beschäftigungseffekte
„Als arbeitsintensiver Dienstleistungssektor schafft der Tourismus Arbeitsplätze. Zu den
direkten Beschäftigungswirkungen werden z.B. Arbeitsplätze in Hotels, bei Seilbahnen,
Verkehrs- und Reisebüros gezählt. Indirekte Beschäftigungswirkungen sind Arbeitsplätze
bei
Zulieferbetrieben
aller
Art
(Baugewerbe,
Groß-
und
Detailhandel,
Lebensmittelproduktion, Auto- und Transportgewerbe) und bei den übrigen privaten
Dienstleistungsbetrieben… Der Tourismus schafft nicht nur Arbeitsplätze, sondern auch
Einkommen…(MÜLLER, 2002)“. Der Beschäftigungseffekt im ländlichen Raum kann als
geschaffener oder erhaltener Arbeitsplatz, oder als ein Beitrag zum betrieblichen
Einkommen definiert werden. Die „Erhaltung oder Schaffung“ von Arbeitsplätzen hat eine
wichtige Bedeutung, weil sie einen großen Einfluss auf die Abwanderung bzw.
Arbeitslosigkeit mit sich bringt (TAMME, 2002). Der Begriff Beschäftigungswirkung und
der Begriff Beschäftigungseffekt sind gleich, weil sie dieselben Effekte bzw. Wirkungen
des Tourismus auf die Beschäftigung beschreiben. Maßgebend für die Bestimmung der
Beschäftigungseffekte des Agrartourismus sind die Definitionen der Begriffe ländlicher
Raum, Agrartourismus bzw. ländlicher Tourismus, Wertschöpfung und Einkommen sowie
Beschäftigung und Arbeitslosigkeit. Die Begriffe Wertschöpfung und Einkommen sind für
die spätere Messung der Beschäftigungseffekte relevant, denn die Messung der
Beschäftigungseffekte wird im Zusammenhang mit den Wertschöpfungseffekten
durchgeführt. Außerdem verbessern Einkommenseffekte die Lebensqualität, welche für die
Regionalentwicklung ein wichtiger Aspekt ist (VORLAUFER, 2003). „Wertschöpfung
bedeutet Einkommen und wird als Summe der Löhne, Gehälter und Gewinne dargestellt“
(MAYER, 2007). Die Bruttowertschöpfung resultiert, wenn vom „Gesamtumsatz die
Vorleistungen, d.h. die von Dritten bezogenen Güter und Dienstleistungen abgezogen
werden… Diese setzt sich seinerseits zusammen aus der Nettowertschöpfung (Löhne,
Steuern, Gewinne, Zinsen) und den Abschreibungen“ (MÜLLER, 2002). „Die
Beschäftigung bezeichnet den tatsachlichen Einsatz von Erwerbspersonen in einer
14
Definitionen
Volkswirtschaft. Generell kann Beschäftigung mittels verschiedener Größen ausgedrückt
werden:
 Einerseits als Anzahl der Beschäftigungsverhältnisse (BVH; entspricht Jobs);
 Andererseits
durch
Aggregate
wie
Vollzeitäquivalente
(VZÄ)
oder
Beschäftigungsvolumen (Gesamtzahl der Arbeitsstunden).
Ein Beschäftigter kann ein oder mehrere Beschäftigungsverhältnisse haben; daraus
resultiert die Summe an Beschäftigungsverhältnissen, gleichgültig ob es sich dabei um
Voll- oder Teilzeitverhältnisse handelt“ (LAIMER and SMERAL, 2004, LANDMANN
and JERGER, 1999). Statistisch gesehen kann man die Beschäftigung sowohl anhand der
Zahl von Erwerbstätigen oder auch anhand der geleisteten Arbeitsstunden in einem
bestimmten Zeitraum messen (LAIMER and SMERAL, 2004).
„Arbeitslosigkeit bezeichnet den Zustand von Erwerbspersonen ohne Arbeit. Sie resultiert
aus einem Ungleichgewicht auf dem Arbeitsmarkt oder Teilarbeitsmärkten, bei dem das
Arbeitsangebot die Arbeitsnachfrage übersteigt und arbeitswillige Erwerbspersonen
zeitweise
keine
Beschäftigung
von
Arbeitgebern
erhalten.
Man
unterscheidet
konjunkturelle, strukturelle, saisonale und friktionelle Arbeitslosigkeit(LANDMANN and
JERGER, 1999). Außerdem kann zwischen freiwilliger und unfreiwilliger Arbeitslosigkeit
sowie zwischen dauernder und vorübergehender Arbeitslosigkeit unterschieden werden.
Unfreiwillige Arbeitslose sind diejenigen, unter geltenden Marktbedingungen keine
„Beschäftigung gefunden haben“ im Gegensatz zu freiwilligen Arbeitslosen, welche „über
die herrschenden Bedingungen hinausgehende Forderungen stellen“ (FRANZ, 1991).
Die
Arbeitslosenquote
bzw.
Arbeitslosenrate
gibt
an,
wie
viel
Prozent
der
Erwerbspersonen, die dem Arbeitsmarkt offiziell zur Verfügung stehen, bei dem Arbeitsam
als arbeitslos gemeldet sind. Die Arbeitslosenquote ist die wichtigste Kennzahl zur
Darstellung der Beschäftigungssituation und
des Umfangs der Arbeitslosigkeit
(LANDMANN and JERGER, 1999). Wenn Erwerbspersonen ihre Arbeit in einem fremden
Bereich für Tourismus bzw. Agrartourismus aufgeben, werden zusätzliche Arbeitsplätze
im Agrartourismus besetzt. Wanderung der Arbeitskräfte aus einem Beruf in den
Agrartourismus
verursacht
die
Notwendigkeit,
neue
Ausbildungen
sowie
neue
Qualifikationen zu erwerben, denn es werden neue Arbeitsweisen und Arbeitsabläufe
15
Definitionen
ausgeübt. Dem Artikel „Organisatorische Änderungen und betriebliche Beschäftigungsund Qualifikationseffekte 1999-2001“ von Alda Holger und Bellmann Lutz sind positive
und negative Effekte der Beschäftigung sowie Qualifikationseffekte zu entnehmen. Die
Effekte ergeben sich nach der Durchführung von organisatorischen Änderungen in
Betrieben. Die „Qualifikationseffekte stehen oft im Vordergrund, … denn die Erhöhung
der Produktivität wird eher qualifizierten Beschäftigten zugetraut“ (ALDA and
BELLMANN, 2002). Positive Beschäftigungseffekte ergeben sich bei Aufbau der
Beschäftigung und negative bei Abbau der Beschäftigung.
Arbeitslose werden einerseits als eine eventuelle Arbeitskraft für den Agrartourismus
betrachtet. Andererseits diversifiziert der Agrartourismus die Beschäftigung im ländlichen
Raum (BRAMWELL and INTERNATIONAL SCHOOL ON RURAL DEVELOPMENT,
1994, ROBERTS and HALL, 2001, БОНДАРЕНКО, 2011, SHARPLEY and VASS,
2006). „Many experts concure that rural tourism is a growth sector and a means of
diversification of rural economies affected by decline in agriculture and traditional
industries. Local operators frequently view it as a way to develop new initiatives and create
jobs, if not restructure the entire economy… A recent OECD report contends that tourism
helps, inter alia, to preserve rural jobs in marginal rural areas, create new jobs where the
activity prospers, and diversify employment, but there are few figures to substantiate the
claims” (OECD, 1995). Die Autoren gehen bezüglich des ländlichen Raums aber nicht
genau darauf ein, welche Beschäftigungseffekte in einer Region aufgrund des
Agrartourismus bzw. ländlichen Tourismus induziert werden können.
Folgend werden Netto- und Bruttobeschäftigungseffekten und Vorgehensweise zusammen
mit entsprechenden Mitnahme-, Verlagerungs-, Multiplikations- und Substitutionseffekten
betrachtet.
„Zur
genauen
Einschätzung
und
Gegenüberstellung
der
echten
Beschäftigungseffekte müssen Nettoeffekte dargestellt werden, d.h. nach Berücksichtigung
der Mitnahmeeffekte (ohnehin eintretender Beschäftigungsgewinn), Verlangerungseffekte
… und Multiplikationseffekte… Alle diese Effekte sind laut dem Berechnungskonzept in
Vollzeitäquivalenten auszudrücken. Die Schaffung von Arbeitsplätzen in dem geförderten
Unternehmen durch Arbeitsplatzverluste in den anderen Unternehmen ganz oder teilweise
wieder
ausgeglichen
wird.
Bruttobeschäftigungswirkung
Aufgrund
verringert.
Die
Verlagerungseffekte
Multiplikatoreffekte
wird
die
ergeben
sich
16
Definitionen
beispielsweise durch die Wertschöpfungsketten und werden auch als induzierte Effekte
genannt. Die induzierten Effekte werden in folgenden Absätzen beschrieben. Von
Substitutionseffekten wird gesprochen, wenn eine Maßnahme zur Beschäftigung
förderfähiger Personen an Stelle anderer, nichtförderfähiger Personen führt, die sonst
beschäftigt worden wären. Ein solcher Effekt sollte als Mitnahmeeffekt behandelt werden,
es sei denn, das Ziel der Maßnahme bestand darin, Arbeitsplätze für eine bestimmte
Zielgruppe zu schaffen“…„Inwieweit sich der Brutto-Beschäftigungseffekt durch
Mitnahme-, Verlagerungs- und Substitutionseffekte verringert, … wird insbesondere für
die Bereiche Verkehr, Tourismus und Berufsbildung … unterschiedlich sein. Dabei handelt
es sich um Zwischeneffekte, die letztendlich einen Beschäftigungseffekt haben werden.
Bruttoeffekte sind der aggregierte Beschäftigungseffekt ohne Berücksichtigung von
Faktoren wie Mitnahme-, Verlagerungs- und Substitutionseffekten. Bei den Nettoeffekten
werden Mitnahme-, Verlagerungs- und Substitutionseffekte sowie gegebenenfalls
Multiplikationseffekte berücksichtigt“ (EUROPÄISCHE KOMMISSION, 2014).
„Die wichtigsten Beschäftigungseffekte werden darüber hinaus als direkte und indirekte
Folge einer Strukturfondsmaßnahme (EUROPÄISCHE KOMMISSION, 2014) dargestellt:
•
Entstehung von Arbeitsplätzen als direktes Ergebnis der regionalpolitischen
Maßnahmen, z.B. durch Bauarbeiten oder Ausführung von Fortbildungsprojekten. Diese
Arbeitsplätze sind meist befristet, und die entsprechenden Zahlen sollten deutlich als
solche gekennzeichnet und in Personenjahren ausgedrückt werden.
•
Neue oder umgewandelte Arbeitsplätze als direkte Folge der regionalpolitischen
Maßnahmen. In diesen Fällen
kommt der Beschäftigungseffekt überwiegend den
Begünstigten der Maßnahmen zugute.
•
Neue oder umgewandelte Arbeitsplätze als indirekte Folge der regionalpolitischen
Maßnahmen, z.B. Verbesserung der allgemeinen oder spezifischen Infrastruktur (z.B.
Fremdenverkehrsattraktion). In diesen Fällen äußert sich die Wirkung in nicht
beschäftigungsbezogenen
Indikatoren,
wie
kürzeren
Fahrzeiten,
erhöhtem
Frachtaufkommen oder zunehmenden Gästezahlen. Der Beschäftigungseffekt entsteht hier
eher indirekt - mit steigenden Urlauberzahlen erhöht sich der Umsatz der örtlichen
Wirtschaft, was wiederum einen Beschäftigungszuwachs oder eine Umwandlung bewirkt.“
17
Definitionen
Weiters werden Beschäftigungseffekte als direkte, indirekte und induzierte betrachtet
(LAIMER and SMERAL, 2004, RÖSNER and STOCKERT, 2012, ASHLEY et al., 2007,
KULKE, 2013). Die äußeren Beziehungen eines Betriebes werden als Verflechtungen und
„als Effekte die dadurch in anderen Einheiten auftretenden Wirkungen“ bezeichnet. „Die
Gliederung von Verflechtungen und Effekten erfolgte in den klassischen Ansätzen -wie
zum Beispiel bei Standortfaktoren entsprechend dem Materialfluss in einem Unternehmen.
So lassen die Verflechtungen aus der Input- oder Einsatzseite (z.B. Bezug von Rohstoffen,
Vorprodukten,
Produktionsmitteln,
Arbeitskräften),
deren
Wirkungen
als
Rückwärtskopplungseffekte bezeichnet werden, auf der Durchführungsseite (z.B.
Wartungsdienste, Transportdienste), die zumeist als Dienstleistungseffekte benannt
werden,
und
der
Output-
oder
Absatzseite
(Endverkauf
im
Einzelhandel,
Weiterverarbeitung in anderen Betrieben), die als Vorwärtskopplungseffekte betitelt
werden, unterscheiden. Neben den direkten Effekte eines Unternehmens (beispielsweise
Lohnauszahlungen an Arbeitskräfte) treten zusätzliche Folgewirkungen auf (so geben die
Arbeitskräfte den für ihre Arbeitsleistungen erhaltenen Lohn in anderen Unternehmen für
Güter und Dienstleistungen aus), die sekundäre, über den Umfang des direkten Effektes
herausgehende Impulse induzieren, sie werden als Multiplikatoreffekte bezeichnet“
(KULKE, 2013). „The ODI [The Overseas Development Institute] and World Bank
Review identifies three main mathways through which tourism affects poverty reduction:
first tourism’s direct effects, the wages and earnings of those who participate directly in the
sector as workers or entrepreneurs… It also uses a relatively high proportion of unskilled
or semi-skilled laborers… Secondly, indirect effects occur through the tourism value
chain… Finally, tourism has a wide range of dynamic effects” (ASHLEY et al., 2007).
Die Klassifizierung von indirekt induzierten Beschäftigungseffekten hat zum Vorteil, dass
sie mit einer Rechnungsmethode anhand des Tourismussatellitenkonto (TSA) verbunden
ist und auf die amtliche und betriebliche Statistik zurückgreift. Dies macht die Methode
nachvollziehbar
und
überzeugend.
Die
Methodologie
für
die
Messung
von
Beschäftigungseffekten greift auf TSA zurück. Dadurch, dass amtliche Statistiken sich mit
Wirtschaftsstatistiken überschneiden, wurden 2008-2009 auf Vorschlag von EUROSTAT,
OECD und UNWTO sogenannte Tourismussatellitenkonten TSA eingeführt (STATISTIK
AUSTRIA and 2014, EUROSTAT 2014). Tourismus-Satellitenkonten „dienen der
Erfassung und Analyse des Tourismus als ökonomisches Phänomen im Zusammenhang
18
Definitionen
mit der Volkswirtschaftlichen Gesamtrechnung (VGR) und anderen Wirtschaftsstatistiken“
(LAIMER and SMERAL, 2004). In TSA werden Tourismusnachfrage einerseits sowie
Wertschöpfung und Beschäftigungseffekte andererseits erfasst (MAYER et al., 2007,
RÖSNER and STOCKERT, 2012, LAIMER and SMERAL, 2004).
Zur „Messung der Beschäftigungseffekte wird auf die Zahl der Erwerbstätigen [sowohl
Selbständige als auch Arbeitnehmer] abgestellt“… Die Anzahl der Erwerbstätigen in der
Herstellung der von Touristen im Land nachgefragten Güter und Dienstleistungen ist ein
direkter Effekt… Er kann auch „nach dem jeweiligen Anteil der Tourismuswirtschaft an
der gesamten Volkswirtschaft ausgewiesen“ werden (RÖSNER and STOCKERT, 2012).
„Direkte Effekte berücksichtigen nur die Beschäftigungseffekte, die in Zusammenhang mit
der direkten Tourismusnachfrage (auf Angebot- und Nachfrageseite wird näher im
theoretischen Model eingegangen) stehen bzw. in jenen Sektoren entstehen, die direkt von
den Ausgaben der Touristen profitieren.
Indirekte Beschäftigungseffekte treten bei jenen Unternehmen auf, welche den Betrieben,
die das direkt nachgefragte Konsumgut produzieren, Güter und Dienstleistungen liefern.
Indirekte Effekte „erfassen Wertschöpfung und Beschäftigung, die durch die Herstellung
von Vorleistungsgütern und -dienstleistungen ausgelöst werden“ (RÖSNER and
STOCKERT, 2012). „Zusammen mit den inländischen Vorleistungsanbietern entlang der
Wertschöpfungskette beschäftigten Erwerbstätigen (indirekter Effekt) sowie unter
Berücksichtigung der durch die Verausgabung der gesamten Einkommen zusätzlich
induzierten Beschäftigung (induzierter Effekt) löst der Tourismus eine Beschäftigung“…
aus. Dies entspricht in einem Land einem Anteil der touristischen Beschäftigung an der
gesamten Beschäftigung (RÖSNER and STOCKERT, 2012, MÜLLER, 2002).
Induzierte Effekte „entstehen durch die Verausgabung der von den direkten und indirekten
Effekten resultierenden zusätzlichen Einkommen“ und werden deswegen auch
Einkommenseffekte genannt (RÖSNER and STOCKERT, 2012). „Die Verausgabung der
durch den Tourismus direkt oder indirekt geschaffenen Einkommen löst einen
Multiplikatorprozess aus, wodurch wieder Wertschöpfung und Beschäftigung entstehen“
(LAIMER and SMERAL, 2004).
19
Theoretisches Rahmenkonzept
Induzierte Beschäftigungseffekte (oder auch als dynamische Beschäftigungseffekte und als
Multiplikatoreffekte genannt) werden somit entsprechend dem Multiplikator-Modell nach
Keynes definiert. Der Multiplikator spielt eine große Rolle bei der Untersuchung der
Beschäftigungseffekte und wird ebenfalls im nächsten Theoriekapitel beschrieben. Direkte,
indirekte und induzierte Beschäftigungseffekte werden in Vollzeitäquivalenten sowie
durch Geldströme in der Wertschöpfungskette ausgedrückt.
3. THEORETISCHES RAHMENKONZEPT
„Rural tourism is considered to be a possible engine for development. There are a number
of reasons for adopting this attitude” (BRAMWELL and INTERNATIONAL SCHOOL
ON RURAL DEVELOPMENT, 1994). Bei der Beschreibung von Definitionen wurde
bereits der Multiplikator bzw. Multiplikatoreffekt, Multiplikatorfaktor angekündigt.
Induzierte
Beschäftigungseffekte
Beschäftigungsmultiplikators
werden
nach
für
Keynes
diese
Arbeit
aufgefasst.
im
Kontext
Wirtschaft
eines
bzw.
Tourismuswirtschaft hat einen Multiplikatoreffekt von touristischen Ausgaben. Wie in der
Exportbasistheorie steuern Basis- und Nichtbasisaktivitäten die wirtschaftliche Lage der
Region - für exportierte Dienstleistungen des Agrartourismus bzw. des Tourismus fließen
Geldströme in die Region.
Laut der Exportbasistheorie fließen die Geldströme für die Basisaktivitäten in die Region
ein. Geld kommt von außen in die Region und die touristischen Dienstleistungen werden
dafür exportiert, denn wirtschaftliches Einkommen aus dem Tourismus ist eine
Exportleistung einer Region (LUNDBERG et al., 1995). Eine Region bietet
Dienstleistungen, die exportiert werden sollen. In einer Region sind das beispielsweise der
Fremdenverkehr, u.a. agrartouristische Leistungen. Touristische Dienstleistungen sind der
„basic sector“ der Region. Es herrscht eine außerregionale Nachfrage bezüglich dieser
Dienstleistungen. Unternehmen, die ihre Produkte exportieren, bilden die wirtschaftliche
Basis einer Region (Exportbasis, "basic sector"), von denen der nicht exportierende lokale
Sektor ("nonbasic sector") abhängt (SCHÄTZL, 1998, KULKE, 2013, BRAUN and
SCHULZ, 2012).
Durch die Geldströme werden auch andere Dienstleistungen aus dem „nonbasic sector“
versorgt, denn das Geld wird im Nichtbasissektor ausgegeben. Dies geschieht dadurch,
20
Theoretisches Rahmenkonzept
dass ein Teil des Geldes für lokale Güter und Dienstleistungen ausgegeben wird. Fließt das
Geld in die Wirtschaft einer Region, in Form von touristischen Ausgaben, Investitionen,
Subventionen etc. ein, wird die Wirtschaft mehrfach stimuliert. Diese Stimulation hat
Keynes „multiplier effect“ genannt. Laut John Maynard Keynes und R.K. Kahn spielen die
Exportinjektionen im Wirtschaftswachstum mit, zum Beispiel in der Form von neuen
Arbeitsplätzen sowie Einkommen für die Zukunft. Das injizierte Geld bleibt in der
Wirtschaft, wird ausgegeben und im Laufe der Zeit wiederausgegeben. Exportinjektionen
induzieren lokale Wachstumseffekte. Ein Anstieg der Einkommen aus den Exporten führt
über Multiplikatoreffekte zu einem Einkommensanstieg in der gesamten Region, der vor
allem von den Exporten bestimmt wird. Das Geld in Form von Ersparnissen und Importe
reduzieren den Multiplikatoreffekt. Das Wirtschaftswachstum ist dann zu beobachten,
wenn das einfließende Geld bzw. die Injektion mehr ist als die Ersparnisse.
(VORLAUFER, 2003, LUNDBERG et al., 1995). Je mehr von den Ausgaben der
Touristen von den Tourismusbetrieben für die Nachfrage nach Waren des örtlichen nonbasic Sektors ausgegeben wird, desto größer ist der Multiplikatoreffekt. Dieser kann auch
in einer Expansion der Beschäftigung bestehen. Der Einkommensanstieg ist umso höher, je
größer die regionale Konsumneigung und je kleiner die regionale Importneigung ist
(BRAUN and SCHULZ, 2012).
Der Multiplikatoreffekt ist auch unter folgenden Worten einfach zu verstehen: „the
multiplicator says in effect that tourism spending not only brings new dollars into local
economy, but as new dollars are circulated their effect is multiplied”(OECD, 1996). Für
die Beschäftigung bedeuten touristische Geldströme Schaffung neuer Arbeitsplätze,
Auszahlungen von Gehältern, Reinvestitionen in Betrieben und nicht zuletzt Steuern und
somit Geld für das lokale Budget.
Die Exportbasistheorie stellt eine Brücke zwischen der Beschäftigung und der regionalen
Entwicklung einer kleinen Region dar. Die Erklärung der jeweiligen Theorie zur
Beschäftigung in einer Region liegt darin, dass die Dienstleistungen im Agrartourismus als
der Exportsektor einer regionalen Wirtschaft betrachtet werden. „As with any “export”
activity that is organized and developed, tourism is of course a source of employment and
income“
(BRAMWELL
and
INTERNATIONAL
SCHOOL
ON
RURAL
DEVELOPMENT, 1994). Das Wirtschaftswachstum einer Region hängt nicht von ihrem
21
Theoretisches Rahmenkonzept
Angebotspotenzial
ab,
sondern
im
Wesentlichen
von
der
außerregionalen
Nachfrageexpansion, d.h. von der Entwicklung ihres Exportsektors (BAUM, 2012).
Um eine Messung von regionalökonomischen Effekten zu ermöglichen, müssen interne
Finanzströme von Externen separat betrachtet werden. Ausgaben der Bevölkerung eines
Untersuchungsgebietes setzen nur regionsinterne Finanzströme in Gang und sollten
deswegen nicht berücksichtigt werden… Aufgrund der dem theoretischen Teil zugrunde
liegenden Exportbasistheorie sollen nur die von außen in die Region fließenden
Geldströme berücksichtigt werden. Für die Erstellung von Leistungen innerhalb einer
Region sind auch Vorleistungen von außerhalb notwendig, da sie den verbleibenden
Wertschöpfungsanteil in der Region beeinflussen (MAYER et al., 2007).
Die Abbildung 1 skizziert die einzelnen Schritte der Berechnung von Wertschöpfungs- und
Beschäftigungseffekten.
Abbildung 1: Berechnung von Wertschöpfungs- und Beschäftigungseffekten (MAYER et al., 2007)
„Für die Berechnung regionalökonomischer Effekte ist es notwendig, die Ergebnisse von
Gästezählungen, Gästebefragungen und einzelbetrieblichen Analysen miteinander zu
verknüpfen.
Gästezählungen
Nachfragevolumen
und
die
und
Gästebefragungen
Ausgaben
der
Gäste.
geben
Die
Auskunft
über
das
branchenspezifischen
Kostenstrukturen der von der touristischen Nachfrage profitierenden Unternehmen können
22
Theoretisches Rahmenkonzept
nur aus betrieblichen Analysen abgeleitet werden. Da die direkt von den Gästeausgaben
profitierenden Unternehmen ihr Angebot in der Regel nicht ohne den Bezug von
Vorleistungen aufrechterhalten können, sind auch die indirekten Einkommenswirkungen
zu berücksichtigen, z.B. durch Lieferanten. Daher werden die Ausgaben der Gäste im
Zielgebiet nach verschiedenen Branchen differenziert erfasst. Aus der Multiplikation mit
der gezählten Menge der Gäste lassen sich so die Umsätze ableiten (vgl. JOB/METZLER
2005: 466). Die kritische Grösse bei der Berechnung regionalökonomischer Effekte ist die
Gesamtzahl der Gäste (Tages- und Übernachtungsgäste). Hierzu liegen selten Zahlen der
amtlichen Statistik vor, so dass diese Angaben meistens auf Schätzungen und
Hochrechnungen basieren und eine möglichst repräsentativitätsnahe Stichprobe gezogen
werden muss. Generell unterliegen touristische Zielgebietsanalysen dem Nachteil, dass die
Grundgesamtheit der Gäste unbekannt ist. Mit Hilfe der als Zufallsstichproben
durchgeführten Kurzinterviews können die Ergebnisse verlässlich hochgerechnet werden“
(MAYER et al., 2007).
Die Exportbasistheorie bietet vor allem einen Erklärungswert für die kurzfristige
Entwicklung einzelner, relativ kleiner und insbesondere stark spezialisierter Regionen mit
rasch mobilisierbaren Produktionsreserven und geringen Wachstumsimpulsen durch
intraregionale Nachfrage (SCHÄTZL, 1998). Das Entstehen der externen Exportnachfrage
als wichtigster Einflussfaktor wird exogen gegeben und nicht erklärt und ist stark abhängig
von der Abgrenzung der Regionen. Werden Regionen zu einem geschlossenen System
untereinander verflochtener Regionen verbunden, ist externe Nachfrage und damit eine
Erklärung des Wirtschaftswachstums nicht mehr möglich. Des Weiteren werden die
Rückwirkungen steigender Exporte auf die Einkommensentwicklung anderer Regionen
und damit die eigene Exportquote außer Acht gelassen. Schließlich gibt es Probleme bei
der empirischen Überprüfung der Exportbasistheorie, da eine exakte Trennung vom
„basic“ Sektor“ und „non basic“ Sektor nicht möglich ist und regionale Exporte nur
geschätzt werden können (BRAUN and SCHULZ, 2012).
Für die vorliegende Arbeit ist der Bezug zu der Regionalentwicklung am Beispiel der
Exportbasistheorie sowie des Multiplikatorfaktors betrachtet worden. Es wird deshalb auf
die Exportbasistheorie gesetzt, weil man die Entwicklung einer ländlichen Region
vorantreiben will und anhand der Exportbasistheorie wird ersichtlich, welche Aktivitäten
dem Basissektor angehören. Der Basissektor produziert die exportierten Leistungen, deren
23
Theoretisches Rahmenkonzept
eine der Fremdenverkehr ist. Über den Fremdenverkehr werden Aktivitäten gefördert,
welche die Multiplikatoreffekte sowie Beschäftigungseffekte in Gang bringen. „To extent
that this rural tourism attracts tourists from outside the economic space in question, it
stimulates the injection of exogenous flows of expenditure and brings about traditional
multiplier effects” (BRAMWELL and INTERNATIONAL SCHOOL ON RURAL
DEVELOPMENT, 1994)
Andererseits sind theoretische Ansätze wie Beschäftigungs- sowie Arbeitsmarkttheorien
für die vorliegende Arbeit relevant. Von der Wohnbevölkerung eines Landes ausgehend,
„können wir die Bestandgrößen auf drei Ebenen unterscheiden. Auf einer ersten Ebene
sind die erwerbsfähige und die nichterwerbsfähige Bevölkerung auseinanderzuhalten. Die
diesbezügliche Zusammensetzung der Wohnbevölkerung ist in erster Linie von deren
Altersaufbau abhängig, daneben können Personen zwar im erwerbsfähigen Alter, aber
aufgrund einer Krankheit nicht oder eingeschränkt erwerbsfähig sein… Die Größe und
Struktur der Wohnbevölkerung werden durch demographische Faktoren bestimmt, also
Fertilität, Mortalität und Wanderungsbewegungen… Von der Änderung solcher
Faktoren… können nachhaltige Auswirkungen auf Arbeitsmarkt und Beschäftigung
ausgehen … Auf einer zweiten Ebene stellt sich die Frage, welcher Anteil der Bevölkerung
im erwerbsfähigen Alter tatsächlich am Arbeitsmarkt teilnimmt (bzw. teilnehmen möchte)“
(LANDMANN and JERGER, 1999).
Bei Erwerbspersonen unterscheidet man grundsätzlich zwischen selbständigen und
unselbständigen Beschäftigten. „Selbständig beschäftigte sind Personen, welche alle
alleinigen
oder
gemeinsamen
Eigentümer
eines
Unternehmens
ohne
eigene
Rechtpersönlichkeit sind, in dem sie arbeiten, ausgenommen jene, deren Unternehmen
ohne eigene Rechtspersönlichkeit als quasi Kapitalgesellschaften eingestuft werden.
Unselbständig Beschäftigte sind Personen“ (LAIMER and SMERAL, 2004), die auf
vertraglicher Basis für ein anderes Unternehmen arbeiten und eine Vergütung erhalten. Der
Anteil der Erwerbspersonen an der Wohnbevölkerung wird auch als Partizipationsquote
bezeichnet. „Die Partizipationsquote reflektiert das Arbeitsangebotsverhalten der privaten
Haushalte, d.h. deren Wahl zwischen Arbeit und Freizeit. Die Faktoren, welche auf
individueller
Ebene
Arbeitsmarkttheorie.
diese
Entscheidung
bestimmen,
sind
ein
Bestandteil
der
Auf der dritten Ebene teilen sich die Erwerbspersonen in
24
Theoretisches Rahmenkonzept
Erwerbstätige (bzw. Auszubildende) und Arbeitslose auf. Die Relation zwischen
Erwerbstätigen
und
Erwerbspersonen
wird
als
Beschäftigungsgrad
(gleich
1-
Arbeitslosenquote) einer Volkswirtschaft bezeichnet… Die Arbeitslosenquote ist definiert
als
der
prozentuelle
Anteil
der
Arbeitslosen
am
gesamtwirtschaftlichen
Arbeitskräftepotenzial. Ermessensspielräume gibt es nicht nur bei der Erfassung der
Arbeitslosen,
sondern
auch
bei
der
Abgrenzung
des
Arbeitskräftepotenzials“
(LANDMANN and JERGER, 1999).
Beschäftigungseffekte im Agrartourismus und allgemein im Tourismus sind von der
Beschäftigungsnachfrage und dem Beschäftigungsangebot im Tourismus abhängig. „Wir
können die Angebots-Nachfrage-Konstellation durch das Verhältnis von offenen Stellen zu
Arbeitssuchenden ausdrücken… Veränderungen der friktionell-strukturellen Komponente
der
Arbeitslosigkeit
und
Veränderungen
der
aggregierten
Angebots-Nachfrage.
Konstellation können sich natürlich jederzeit überlagern“ (LANDMANN and JERGER,
1999). Die Beschäftigungsnachfrage kommt von Tourismusunternehmen, wenn der
Tourismus in der Region floriert und wenn in der Region die Nachfrage nach touristischen
Dienstleistungen herrscht. Die Nachfrage, die in der Region entsteht generiert ein
zusätzliches Einkommen für die Region.
Nach den Erläuterungen zu den regionalen Beschäftigungseffekten wird nachfolgend auf
die Einflussfaktoren näher eingegangen.
25
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
4. EFFEKTE DES AGRARTOURISMUS AUF DIE
BESCHÄFTIGUNGSSITUATION EINER REGION
Dieses Kapitel hat zum Ziel, Einflussfaktoren auf die Beschäftigung, welche direkte,
indirekte und induzierte Beschäftigungseffekte des Agrartourismus in einer Region
verursachen,
aus
Einflussfaktoren
der
aus
Literatur
der
zusammenzufassen.
Literatur
zusammengesucht
Zuerst
und
werden
in
dafür
einem
die
Modell
zusammengefasst. Logische Rahmenbedingungen für die Literaturrecherche sind folgende:
jene Einflussfaktoren, die den Agrartourismus beeinflussen, beeinflussen auch seine
Beschäftigung; jene Einflussfaktoren, die die Beschäftigung im Tourismus bewirken und
mitprägen, prägen auch die agrartouristische Beschäftigung. Die Einflussfaktoren auf die
Beschäftigung können in einer Region die Beschäftigung mehrerer Unternehmen
beeinflussen, eben auch im Agrartourismus. So hat beispielsweise ein neuer Bahnanschluss
für die Region unmittelbar verbundene Rückkopplungseffekte wie zum Beispiel die
verkehrsstaufreie Erreichbarkeit eines Ortes. Manche Faktoren werden hauptsächlich auf
die agrartouristische Beschäftigung Einfluss ausüben. Auch landwirtschaftsspezifische
Merkmale, wie zum Beispiel die Saisonalität der Produktion, wirken sich auf die
agrartouristische Beschäftigungssituation aus.
Anzumerken
ist,
dass
der
Agrartourismus
sowohl
als
Nebentätigkeit
eines
Landwirtschaftsbetriebes als auch als vollwertiger Tourismus betrachtet wird. „Looking at
in this light, rural tourism goes far beyond the stage of simply complementing traditional
agricultural activity, the role most often attributed to it (BRAMWELL and
INTERNATIONAL SCHOOL ON RURAL DEVELOPMENT, 1994).
Dieser Abschnitt beschäftigt sich mit den einzelnen Einflussfaktoren der Beschäftigung im
ländlichen Tourismus einer Region vor dem Hintergrund des globalen Umfeldes. Folgend
werden einzelne Einflussfaktoren sowie deren Beschäftigungseffekte näher betrachtet.
Das Tourismusbusiness sollte unter folgendem Aspekt verstanden werden: „Tourism
proponents put the economical benefits of tourism in easily understood terms: total dollar
receipts, wages and salaries, jobs created, tax revenues and new establishments“ (OECD,
1996). Dabei braucht das Tourismusgeschäft weniger Investitionen im Vergleich zur
anderen Geschäftszweigen, zum Beispiel Landwirtschaft (VORLAUFER, 2003). “The
logical partners tend to be transport undertakings, travel agents, financial services,
26
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
agricultural or rural organisations and local authorities, so that the farmer finds himself
‘endowed’ with many partners (BRAMWELL and INTERNATIONAL SCHOOL ON
RURAL DEVELOPMENT, 1994). Solche “logical partners” verweisen auf die
Einflussfaktoren des ländlichen Tourismus. MAYER (2007) zählt zu den Einflussfaktoren
„zeitliche
(beispielsweise
Saison-,
Wochen-,
Tagesrhytmus),
räumliche
(z.B.
unterschiedliche Frequentierung an verschiedenen Standorten), strukturelle (z.B. Tages/Übernachtungsgäste) und witterungsbedingte (z.B. gutes und schlechtes Wetter)“.
LUNDBERG (1995) weist auf die Rolle der Saisonalität, welche sich u.a. aus dem Klima
und sozialen Gewohnheiten ergibt. Die Beschäftigung im Bereich Agrartourismus einer
Region hängt von zahlreichen Einflussfaktoren ab. „Factors include culture, business
structure, social relationships, physical features like nature, climate, and landscape and
proximity to infrastructure. Many of these factors can even be regarded as part of the
tourism product” (FORBORD et al., 2012b).
Tourismusbetriebe sind die Wirtschaftseinheiten, die Beschäftigungseffekte tragen. „Die
Fremdenverkehrs- bzw. Tourismusunternehmungen sind Wirtschaftseinheiten, die durch
dauerhafte Verbindung geeigneter Produktionsmittel (Arbeit, Kapital, Boden) die
Bereitstellung von Sach- und Dienstleistungen des Fremdenverkehrs bzw. Tourismus auf
wirtschaftliche Art und Weise bezwecken (KASPAR, 1990).
Wie bereits im Kapitel Definitionen erklärt wurde, gibt es direkte, indirekte sowie
induzierte Beschäftigungseffekte. Die Beschäftigungseffekte lassen sich nach einer
komplizierten Rechnungsmethode in VZÄ ausdrücken. Quantitative Beschäftigungseffekte
zielen rein auf Veränderungen der Zahl an Arbeitskräften ab, d.h. auf deren Zu- oder
Abnahme. Eine Zunahme der Arbeitskräfte im Agrartourismus bedeutet für die Region ein
Beschäftigungsplus oder auch einen positiven Effekt. Logisch betrachtet kann
angenommen werden, dass die Reduktion der Arbeitsplätze auf einen Reduktionseffekt
(negativer Effekt) in der Beschäftigung schließen lässt. Die Beschäftigten im
Agrartourismus können ihren Beruf entweder in Voll- oder Teilzeit ausüben. Teilzeitjobs
werden als ein entsprechender Anteil des VZÄ in TSA berücksichtigt.
Zusätzlich zu quantitativen Effekten verändert sich die Struktur der Mitarbeiter im
Agrartourismus
und
deren
Beschäftigungsart
auch
qualitativ.
Qualitative
Beschäftigungseffekte des Agrartourismus in der Region drücken sich durch die benötigten
Qualifikationen der Arbeitskräfte aus. So gibt es je nach Bildungsgrad hochqualifizierte,
27
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
mäßig qualifizierte oder gering qualifizierte Arbeitskräfte. Offensichtlich werden im
Tourismus die hochqualifizierten, z.B. Reitlehrer, Skilehrer, Reiseführer, Flugzeugpiloten
etc. sowie die unqualifizierten Arbeitskräfte wie z.B. Zimmermädchen, Tellerwäscher,
Reinigungspersonal usw. in verschiedenen Maßen gefragt.
Zudem kann zwischen selbständigen oder unselbständigen Arbeitskräften unterschieden
werden. Selbständige Erwerbspersonen schaffen erstens Arbeitsplätze für sich und
generieren zweitens zusätzliche Teil- und Vollzeitarbeitsplätze. Ein Selbständiger im
Agrartourismus versorgt sich selbst mit einer Arbeitsmöglichkeit und schafft eventuell eine
Beschäftigungsmöglichkeit für einen Mitarbeiter. “They can be almost indistinguishable
from normal family operations, such as bed-and-breakfast establishments operated out of
one’s house, require little or no capital investment, involve few if any paid employees, and
generate very small amounts of revenue“ (GETZ and CARLSEN, 2005). Ein
Unselbständiger wird in der Regel von einem Betrieb angestellt und bekommt dort
bestimmte Aufgaben zugeteilt. Es ist anzunehmen, dass die Beschäftigungsstruktur sich
außerdem hinsichtlich Alter und Geschlecht unterscheidet.
Abbildung 2. zeigt die wichtigen zusammengefassten ökonomischen, sozialen und sonstige
Einflussfaktoren auf die Beschäftigung im Agrartourismus einer Region. Diese Abbildung
wurde anhand der Literaturrecherche zusammengestellt. Die Betrachtungen stützen sich
dabei auf die im Folgenden angegebenen Quellen:

Arbeitsmarktlage und Ausbildung.

Soziale Einflüsse.

Erreichbarkeit (MAYER et al., 2007, VORLAUFER, 2003).

Umfeldsituation (ORGANISATION FOR ECONOMIC CO-OPERATION AND,
1996, VORLAUFER, 2003).

Tourismus- und Regionalentwicklungsstrategien(KRAMMER, 2006).

Politik und Rechtsvorschriften (BRAMWELL and INTERNATIONAL SCHOOL
ON RURAL DEVELOPMENT, 1994).

Wirtschaftslage (VORLAUFER, 2003, LUNDBERG et al., 1995, KLIEM, 2003,
ECKEY and STOCK, 2000, KEYNES, 2009).
Ein Großteil der Beschäftigungseffekte im Agrartourismus sollte sich durch die
Einwirkung der oben genannten Einflussfaktoren erklären lassen.
28
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
Umfeldsituation
Arbeitsmarktlage
und Ausbildung
Erreichbarkeit
Regionale
Beschäftigungseffekte
des Agrartourismus
Wirtschaftslage
Politik und
Rechtsvorschriften
Soziale
Einflüsse
Tourismus- und
Regionalentwicklungsstrategien
Abbildung 2: Angenommene Einflussfaktoren auf regionale Beschäftigungseffekte des Agrartourismus (eigene
Darstellung)
4.1. Arbeitsmarktlage und Ausbildung
Zunächst wird der Einflussfaktor der Arbeitsmarktlage inklusive Ausbildung betrachtet.
Der Agrartourismus floriert und viele Menschen finden in der Folge im Agrartourismus
eine Anstellung in der Region.
Die
Übersicht
in
Abbildung
3
veranschaulicht
die
regionalen
und
globalen
Arbeitsmarktsituationen. Die Arbeitslosenrate ist hier deswegen einbezogen worden, weil
die Arbeitsmarktlage sich gut einerseits durch das Beschäftigungsangebot und die
Beschäftigungsnachfrage im Tourismus, andererseits durch die Arbeitslosenrate in einer
Region beschreiben lässt. Denn die Arbeitslosenrate zeigt, wie viele Arbeitskräfte in einer
29
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
Region für den Tourismus gefragt werden und zur Verfügung stehen. „Beschäftigung
durch den Fremdenverkehr ist in vielen Ländern und insbesondere auf regionaler Basis oft
ein wichtiger Faktor zur Milderung der Arbeitslosigkeit“ (VORLAUFER, 2003).
Vermutlich übt sowohl die regionale als auch die außerregionale Arbeitsmarktlage einen
Einfluss auf die Beschäftigung im Agrartourismus in einer Region aus. (Vgl. Abbildung 3).
Hohe Arbeitslosigkeit in einer Teilregion bedeutet, dass dort prinzipiell relativ viele,
vergleichsweise billige Arbeitskräfte, zu Verfügung stünden. Nimmt man an, dass in den
Nachbarregionen die Arbeitslosigkeit auf einem niedrigen Niveau liegt, es also im
weiterem Umfeld ausreichend Beschäftigung gibt, so scheinen verhältnismäßig günstige
Voraussetzungen für die Entwicklung des Agrartourismus in der Teilregion gegeben. Dies
erfolgt nicht zuletzt wegen ausreichend solventer Nachfrage nach touristischen
Dienstleistungen von den Regionen mit einer niedrigeren Arbeitslosigkeit.
Wie aus Abbildung 3 ersichtlich, wenn die Arbeitslosigkeit in der Teilregion niedrig ist, im
globalen Umfeld aber hoch, dann dürfte sich der Agrartourismus nur zögerlich entwickeln.
Bei hoher Arbeitslosigkeit im Umfeld der Region ist mit geringer agrartouristischer
Nachfrage zu rechnen. Außerdem dürfte der lokale Agrartourismus bei regional niedriger
Arbeitslosigkeit wenige Möglichkeiten haben, geeignetes Personal zu rekrutieren.
Arbeitslosenrate regional, %
niedrig
hoch
Arbeitslosigkeitsrate / mangelnde Nachfrage
Zögerliche Entwicklung des Agrartourismus und
aus der Außenregion
dessen Beschäftigung in der Teilregion
niedrig
Ausgeglichenes Verhältnis der
Umfeldes , %
Arbeitslosenrate des globalen
hoch
Beschäftigungspotenzial im Bereich
Agrartourismus in der Teilregion
Ausgeglichenes Verhältnis der
Arbeitslosigkeitsrate / dürftiges Angebot in der
Teilregion
Abbildung 3: Bedingungen für Tourismus im Zusammenspiel von regionaler und globaler
Arbeitslosenrate. (Quelle: eigene Darstellung)
30
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
4.2. Qualifikationen im Tourismus
Die Beschäftigung dürfte höher und die Arbeitslosigkeitsrate geringer sein, wenn im
ländlichen Raum ein hohes Ausbildungsniveau herrscht. In der Literatur wird dies
fallweise auch so beschrieben. “Among rural regions those with relatively high educational
levels tended to have greater employment, less unemployment and better ability to hold
onto their share of highly educated workers” (OECD, 1996). WILLIAMS und SHAW
schrieben (2009), “unemployment rates were lower in rural high education regions in
almost all the countries included, although the gains in unemployment were not necessary
lower than in the high educational regions”.
Es wird davon ausgegangen, dass jene Arbeiten, die viel Verantwortung brauchen, den
qualifizierten Mitarbeitern zugetraut werden (ALDA and BELLMANN, 2002). Es wird
auch davon ausgegangen, dass die Qualifizierung vorhanden sein muss, wenn ein
Selbständiger sein Unternehmen im Tourismus registriert (БУЙЛЕНКО, 2008).
Unqualifizierte und schlecht qualifizierte Arbeitskräfte bekommen weniger Gehalt und
können somit weniger als (hoch)qualifizierte Mitarbeiter den Multiplikatoreffekt
stimulieren. Nach einer Prämisse von Keynes (1936) in „Allgemeine Theorie der
Beschäftigung, des Zinses und des Geldes“, ist der Multiplikatoreffekt umso größer, je
mehr ausgegeben bzw. investiert wird. Hier geht es nicht nur um die Wertschöpfungskette
sondern auch um den Beschäftigungsmultiplikator.
Eine weitere Vermutung ist, je bedeutender der Agrartourismus als Arbeitsmarkt für eine
Region wird, desto höher werden das spezifische Qualifikationsangebot sowie die
Qualifikationsnachfrage
im
Tourismus.
Passende
Ausbildungen
wären
neben
handwerklichen Berufen auch noch gastgewerbliche Berufe. Die nächste Vermutung wäre,
je mehr der Agrartourismus in einer Region floriert, je länger die Beschäftigten im
Tourismus arbeiten, desto qualitativer und vielfältiger wird die Beschäftigung und desto
höher wird die Ausbildung. Das Fachwissen in einzelnen Arbeitsbereichen, wie z.B. die
Käsegewinnung oder Tierhaltung, dürfte die Beschäftigung ebenfalls weiter differenzieren.
Durch solche Diversifizierung wird auch die Gestaltung der Ferien oder Freizeit für den
Besucher professioneller. Die Verfügbarkeit an Ausbildung, Workshops oder Schulungen
wird die Qualität der Angestellten in ihrer Beschäftigung beeinflussen. Auch im
Agrartourismus wird ein gut ausgebildeter Manager einen Wissensvorsprung gegenüber
31
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
vergleichsweise geringer ausgebildeten haben. Die Beschäftigung dürfte also direkt von
der Qualität der Arbeitskräfte abhängig sein und umgekehrt. “For instance, low education
regions may have been disadvantaged by a relatively high concentration of unemployment.
The data collected in this study was not uniform across OECD countries, however, limited
advantages of rural education could be provided: … high educational regions may have an
advantage over low education regions.” (OECD, 1996). Es besteht Anlass zur Vermutung,
dass eine einfache Gestaltung des Tourismus am Land das Fehlen an qualifizierten
Arbeitskräften begleitet. Beispielsweise B&Bs – „bed and breakfast“, ein verbreitetes
touristisches Konzept, wo der Tourist einen Platz zum Schlafen und eben ein Frühstück
bekommt. Eine solche Businessgestaltung beinhaltet keine Herausforderung an das weitere
Lernen der Mitarbeiter bzw. Familie.
Eine Ansiedlung des ländlichen Tourismus und sein gutes Potenzial für die ländliche
Regionalentwicklung
würde
eine
neue
agrartouristische
Fachrichtung
in
dem
Ausbildungssystem eines Landes brauchen. Diese Vermutung hat MERZLOV (2012) für
die landwirtschaftlichen Universitäten in Russland ausgedrückt. Vermutlich dürfte eine
Universitätsausbildung für agrartouristische Zwecke die Beschäftigung im Agrartourismus
steigern sowie differenzieren.
4.3. Soziale Einflüsse
Die Suche nach wirtschaftlichen Potenzialen, wie Agrartourismus, hat u. a. zum Ziel, die
Lebensqualität im ländlichen Raum zu verbessern.
Unter sozialen Einflüssen auf die Beschäftigung im Agrartourismus werden vor allem das
Reiseverhalten und das Umweltbewusstsein der Touristen verstanden. Das Reiseverhalten
als soziales Phänomen stellt darauf ab, welche Prestigeeffekte die Wahl eines
Urlaubszieles hat (WYTRZENS, 2013). Es gibt Touristen, deren Reiseverhalten durch
jenen Gedanken geprägt ist, welche die Personen zum Urlaub am Bauernhof verleiten.
Lifestyle spielt dabei eine Rolle und kommt deutlich zum Tragen. Es gibt Anlass zu
vermuten, dass gewisse Gruppen mit ländlich relevanten „core values“ insbesondere zum
Agrartourismus neigen. Das Reiseverhalten der Touristen dürfte die Beschäftigung im
Agrartourismus qualitativ und quantitativ beeinflussen. Es lässt sich vermuten, dass der
Agrartourismus für sehr verschieden Kundengruppen anziehend sein könnte.
32
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
Verschiedene Touristen, zum Beipiel, der kosmopolitische Kunde würde im Vergleich zu
dem der Mode folgenden Kunden, vermutlich differenzierte Reisegewohnheiten haben.
Manche Gäste wünschen sich wenig Unterhaltung und Kontakt mit den Mitarbeitern des
Betriebes. Andere hingegen schätzen die persönliche Beziehung zur bäuerlichen Familie
und wollen mehr Kontakt mit dem ländlichen Leben. Diese Gäste erwarten im Urlaub, dass
auch die Familienmitglieder oder Mitarbeiter des Betriebs entsprechend bereit sind, viel
Zeit für Konversationen aufzuwenden, wodurch eine persönliche Beziehung zwischen Gast
und Personal entstehen kann. Sollte der Agrartourismusbetrieb Wert darauf legen, das
touristische Angebot aus mehr als nur „bed and breakfast“ zusammenzustellen, werden
vermutlich die Beschäftigungseffekte in ihrer Vielfalt unterschiedlicher als sonst. Man
sollte wissen wie Smalltalks geführt werden, Etikette und Umgang mit verschiedenen
Menschen und insbesondere das Fachwissen je nach dem Angebot – Kulturhistorisches
Wissen, Wissen über Tier- und Pflanzenwelt, traditionelle Küche usw. - muss angestrebt
werden. Dies erweitert selbstverständlich den Zeitaufwand im Betrieb während des
Aufenthaltes der Touristen und schon zuvor für den Erwerb des Fachwissens. Darüber
hinaus besteht Anlass zu vermuten, dass je mehr Wert die Agrartouristen und die Familien
im Betrieb auf die Schaffung der persönlichen Beziehung zu ihren Gästen legen, desto
intensiver und bedeutender wird die Beschäftigung im Agrartourismus für die Region.
Wäre gerade der Agrartourismus in einer Region „im Trend“, so würden sich vermutlich
Unternehmer vermehrt für den Agrartourismus entscheiden, denn trendiges Reiseverhalten
ist „ansteckend“. Somit wird angenommen: je angesehener, aktueller und stylisher der
Agrartourismus global und in der konkreten Region ist, desto mehr Beschäftigungseffekte
ergeben sich in der Region aufgrund des aufkommenden Agrartourismus.
Das Reiseverhalten von Agrartouristen beeinflusst die Kapazitätsauslastung eines
agrartouristischen Betriebes, was zur Beschäftigungssituation beitragen dürfte. Zu
vermuten wäre, dass hochfrequentierte Orte eine bessere Auslastung als ruhige und
weniger frequentierte Orte haben. Bei einer guten Auslastung in Betrieb wäre die
Beschäftigung im Agrartourismus für die Region bedeutender als bei einer schlechten
Auslastung.
Identifiziert sich eine Person/ ein Tourist in ihrem sozialen Leben mit einer Gruppe der
Agrartouristen, entsteht vermutlich ein Gruppendruck, wenn es um eine Reise geht.
Gruppendruck löst eine Änderung des Verhaltens eines Touristen innerhalb einer Gruppe
33
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
aus. Der Tourist würde vermutlich ein anderes Reiseziel als Urlaub am Bauernhof
bevorzugen, aber gerade weil er zur einen Gruppe dazugehören will, würde er mit der
Gruppe hinfahren. Wegen einem derartigen Gruppendruck könnte die Person dem
agrartouristischen Segment aber auch fernbleiben. Somit dürfte Gruppendruck einen
entsprechenden Einfluss auf die Beschäftigungssituation über Angebot und Nachfrage
haben. Das Reiseverhalten der Touristen lässt sich am einfachsten durch die Wirkungen
von Angebot und Nachfrage im Tourismus veranschaulichen. Angebot und Nachfrage
bewirken die tatsächliche Beschäftigung im Agrartourismus. Um dieses Verhalten besser
illustrieren zu können, wird ein Beispiel vorgeschlagen. Ein Unternehmen organisiert für
seine Mitarbeiter eine Wochenendfahrt in die Natur, und die Mehrheit dieser Gruppe
stimmt für einen Urlaub am Bauernhof. Klarerweise dürften einzelne Personen dieser
Organisation sich unter Druck gesetzt fühlen, selbst wenn sie gerne innerhalb der Gruppe
sind. Dann wird vermutlich folgendes im Agrartourismusunternehmen passieren – die
Nachfrage nach den touristischen Dienstleistungen entwickelt sich – zusätzliche
Mitarbeiter werden nachfrageabhängig kontaktiert.
Die Mitgliedschaft bei Organisationen, wie zum Beispiel World Wildlife Fund - WWF,
World
Wide
Opportunities
on
Organic
Farms
–
WWOOF,
dürfte
die
Beschäftigungssituation im Agrartourismus beeinflussen. Die Mitgliedschaft bei WWOOF
ist ein weiteres Phänomen des Reiseverhaltens, das die Beschäftigung im Agrartourismus
beeinflusst. Die Organisationen ermöglichen einen Aufenthalt in landwirtschaftlichen
Betrieben in anderen Ländern für die Mitglieder der Organisation. Die Farmen, die zum
Beispiel an WWOOF beteiligt sind, haben einen oder mehrere Voluntäre bei sich während
des Jahres. Die Voluntäre zahlen einen Beitrag an die Organisation und haben dafür die
Möglichkeit, bei verschiedenen Betrieben zu arbeiten und eine Unterkunft zu haben. Die
Voluntäre des Fonds werden als Touristen mit einem eigenen Reiseverhalten betrachtet.
Dabei ergeben sich vermutlich folgende Beschäftigungseffekte: die Betriebe steigen durch
den Fond in den Tourismusaustausch ein. Kultureller Austausch zwischen den Voluntären
und der Familie im Betrieb fördert vermutlich ökologische Landwirtschaft und produziert
somit Rückkopplungseffekte in der Tourismuswirtschaft, u.a. Beschäftigungseffekte. Die
touristische Tätigkeit im Betrieb gilt als nichtlandwirtschaftliche Beschäftigung im
ländlichen Raum. In ihrem Artikel benannte GAGNON (2012) die WWOOF als eine der
wichtigsten Agrartourismusquellen weltweit („WWOOF es uno de las fuentes más grande
34
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
del agroturismo en el mundo“). Es gibt vermutlich auch die Touristengruppen, die Natur
und wilde Tiere retten möchten, was Anlass zu vermuten gibt, dass von WWF betreute
Gebiete, z.B. Naturparks, die Beschäftigung u.a. im Agrartourismus fördern. Ein gutes
Beispiel dafür ist ein WWF Projekt zur Rettung von wilden Enten in Karelien, welches
zusätzlich 50 Arbeitsplätze im Agrartourismusbereich geschaffen hat (REZVYI, 2011).
Weiters wird kurz auf die Qualitätseinstufung eingegangen. Sie dürfte vermutlich die
Intensität der Beschäftigung und somit Beschäftigungseffekte im Agrartourismus einer
Region verursachen. „Eine Analyse der Struktur des Beherbergungsgewerbes vermittelt
daher wesentliche Einblicke in die Beschäftigungseffekte. Länder, Regionen oder einzelne
Standorte z.B. mit Betrieben vornehmlich für Besucher, die einfache Unterkünfte
aufsuchen, haben vergleichsweise wenige Arbeitsplätze in der Hotellerie… Luxushotels
beschäftigen zwar pro Bett in der Regel 2- bis 3mal mehr Beschäftigte als Einfach-Hotels,
jedoch ist die Kapitalintensität im allgemeinen höher“ (VORLAUFER, 2003). Je höher die
Qualitätsstufe ist, desto mehr Beschäftigung könnte es pro Gast am Betrieb geben. Für den
Agrartourismus bilden unterschiedlichste Angebote an Aktivitäten, als Beispiel sei hier der
Reitsport zu nennen, eine zusätzliche Beschäftigungmöglichkeit. Bei niedrigeren
Qualitätsstufen dürfte die Beschäftigung limitiert sein, zum Beispiel nur Schlüsselübergabe
für eine Unterkunft evtl. mit einer kleinen eigenen Küche. Der Tourist wird nicht weiter
verpflegt und verursacht mit diesem Reiseverhalten und niedriger Qualitätsstufe wenig
Beschäftigung im Betrieb.
4.4. Erreichbarkeit
Erreichbarkeit ist ein wichtiger Einflussfaktor für den Agrartourismus. Entfernung ist oft
ein entscheidendes Kriterium für die Urlauber. Schwer erreichbare Orte sind nur für
wenige Touristen attraktiv. Saisonbedingt kann die Erreichbarkeit ebenfalls variieren.
Schnee und Regen auf den Straßen verlangsamen das Vorankommen oder machen es ganz
unmöglich. Die Beschäftigung der Familie und der Mitarbeiter im Agrartourismus wird
von dem Klima der Region beeinflusst. Falls der Betrieb straßenbedingt nur schwer oder
überhaupt nicht erreichbar ist, wird der Betrieb lediglich geringe oder keine Auslastung
haben und in Folge direkt betroffen auch die Beschäftigung. Aber auch die Saisonalität
35
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
selbst übt auf die Beschäftigung einen Einfluss aus (LUNDBERG et al., 1995, FORBORD
et al., 2012, VORLAUFER, 2003). In der Literatur sind sogar die Begriffe Vor/Nachsaison bzw. Nach/Nebensaison als „Bezeichnung für die Reisemonate zwischen den
Hauptsaisonzeiten“ zu finden (OPASCHOWSKI, 2002, VORLAUFER, 2003). Bei einem
sonnigen Wetter ist eventuell der Agrartourismusstandort attraktiver und leichter
erreichbar als bei starken Niederschlägen, geringer Sonnenscheindauer. „Ein großer
Nachteil des Tourismus ist es nämlich, dass sich die Nachfrage in vielen Ländern oft
unterschiedlich über das Jahr verteilt und so fremdenverkehrswirtschaftliche Einrichtungen
saisonal nicht oder nur eingeschränkt genutzt werden, in der Nach- oder Nebensaison
investiertes Kapital brachliegt, die Zahl der Arbeitsplätze etwa im Hotelgewerbe oft
reduziert wird“ (VORLAUFER, 2003). Marktdifferenzierung im Tourismus einer Region
kann „oft extreme Saisonalität des Fremdenverkehrs mit ihren negativen Wirkungen auf
Beschäftigung und Einkommen“ (VORLAUFER, 2003) mildern.
Nun ist die Erreichbarkeit sowohl von der Saison als auch vom Transportsystem abhängig.
VORLAUFER (2003) schreibt, dass „die wesentliche Voraussetzung für die Expansion des
Tourismus die Erfindung leistungsfähiger und preisgünstiger Langstreckenjets war, durch
die vormals nur nach oft wochenlangen Anreisen erreichbare Destinationen jetzt in wenige
Stunden besucht werden können“. Vieler sonst schwer erreichbarer Orte hätten sonst keine
Möglichkeit Touristenströme aufrecht zu erhalten und Beschäftigungseffekte zu erzeugen
(Arbeitsplätze). Wenn zum Beispiel kleine Flugzeuge oder Hubschrauber die
Agrartouristen zu Inseln bringen und sie wieder abholen, handelt es sich eher um
qualitative Beschäftigungseffekte. Es würden spezielle Qualifikationen, beispielweise von
Piloten benötigt, welche die Beschäftigung in der Region steuern. Wenn die Gäste von
nahen Bahnhöfen zu Betrieben gebracht werden müssten, würde eine schwere
Erreichbarkeit allerdings auch zusätzliche Beschäftigung für die agrartouristischen
Betriebe verursachen – es werden vermutlich spezielle Transporte und Fahrer benötigt. Für
manche Agrartouristen dürfte die schwere Erreichbarkeit des Ortes sogar einen Reiz
ausmachen. Ansonsten wird angenommen, dass bei schlechter Erreichbarkeit eines Ortes
die Beschäftigungseffekte, die vom Agrartourismus ausgehen, für eine Region ohne große
Bedeutung sind. „Not all rural areas are equally attractive to tourists“ (SHARPLEY et
VASS, 2006) - gute Erreichbarkeit im Agrartourismus legt den Schluss nahe, dass die
Touristenströme und somit die Beschäftigung größer sind im Vergleich zu schwer
36
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
erreichbaren
Orten.
Für
die
Beschäftigungssituation
bedeutet
schnelle/leichte/kostenfreundliche Erreichbarkeit mehr Arbeit, vermutlich werden wohl
auch mehr Mitarbeiter angestellt.
4.5. Umfeldfaktoren
Die Umfeldfaktoren sind lokale Bedingungen einer Region. Unter ihrer Wirkung verändert
sich quantitativ und qualitativ die Beschäftigung im Agrartourismus. Zu solchen
Umfeldfaktoren in einer Region zählen:

Landwirtschaftliche Infrastruktur der Region

Umweltsicherheit

Touristische Infrastruktur.
4.5.1. Landwirtschaftliche Infrastruktur der Region
Art der Landnutzung und Wirtschaftsaktivitäten sind für den ländlichen Tourismus ein
entscheidendes Merkmal. Der Grund dafür ist, dass die Landnutzung und deren Diversität
sowie Intensität hier die potenzielle Entwicklung des ländlichen Tourismus beeinflussen
können. „Intensively farmed areas or prosperous and diverse rural economies will have
less need to develop tourism and may be less attractive to tourists; and economically
marginal areas which depend on traditional, small-scale agrarian industries will have a
greater need for economic diversification and may be more attractive for tourists
(SHARPLEY and VASS, 2006, ROBERTS and HALL, 2001).
Von der Agrarstruktur einer Region wird vermutlich die Beschäftigung beeinflusst. Im
ländlichen Raum mit großstrukturierten Agrarbetrieben werden wahrscheinlich eher
spezifische Qualifikationen für eine Anstellung verlangt. Das ganze sieht da sehr
professionell aus, z. B. wie ein Ferienbetrieb. Im ländlichen Raum mit kleinstrukturierten
Agrarbetrieben wird wahrscheinlich keine spezifische Qualifikation verlangt – das macht
die Bäuerinnen neben bei.
Die Struktur der Landwirtschaft und die Struktur der Produktion können die Beschäftigung
im Agrartourismus in dem Sinne beeinflussen, dass sie günstigere oder ungünstigere
Bedingungen für den Agrartourismus in der Region schaffen. „Agrarbussinesses, adopting
a corporate outlook, are also less likely to accept informal and unpaid access to their lands
37
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
by the puplic for recreation than was the traditionl landowner, who probably had to deal
with far fewer, and less impacting visitors“ (ROBERTS and HALL, 2001)
Durch die Monokulturisierung der Landwirtschaft haben die ländlichen Änderungen (rural
change) zum Nachteil „loss of wildlife variety and habitat of the diminution of access in
rural areas through the removal of long-established footpaths” (ROBERTS and HALL,
2001). Deshalb dürften die Regionen wo großstrukturierte Landwirtschaften mit starken
Geruchbelastungen überwiegen, für touristische Zwecke wenig attraktiv sein. „In addition,
the landscapes produced by many agribusinesses may be neither aesthetically nor
functionally appropriate for leisure activities“ (ROBERTS and HALL, 2001).
Kleinstrukturierte Landwirtschaften dagegen schaffen für die Agrartouristen eine
traditionelle Atmosphäre und sind als Spiegel des ländlichen Lebens attraktiver als
industrielle Gebiete. Der Erfolg des Urlaubs am Bauernhof wurden am Beispiel mehrerer
deutschsprachigen Regionen Europas bestätigt „because of powerful combination of small
farm-size, interesting scenery, closeness to market, traditionally town“. LANE (1994) hat
unter anderem die Frage gestellt, ob „rural tourism is farm-based or agri-tourism“ sei und
ob „diversification into tourism will „save“ the farming community“. These statements are
not universally true because the relationships between agriculture, forestry and tourism are
extremely complex ones.
Die Landschaft in der Region spielt auch eine Rolle für das Entstehen eines
agrartouristischen Betriebes, da auch landschaftliche Besonderheiten die touristischen
Ströme in die Region erhöhen können. Auch die Struktur und Art der landwirtschaftlichen
Produktion, dürfte die Beschäftigung beeinflussen. Vermutlich muss das Personal oder die
Familie zu bestimmten Zeiten einer intensiven landwirtschaftlichen Arbeit, wie Ernten in
der Hochsaison durch Extraarbeitskräfte unterstützt werden. VOLRLAUFER (2003)
formulierte folgend die Situation:
„Mit der Übernahme einer Tätigkeit im Tourismusgewerbe durch vormals im Agrarsektor
Beschäftigte erfolgt jedoch häufiger … eine innenfamiliäre Umschichtung der
Arbeitsbelastung: Frauen und Kinder müssen durch einen erhöhten Einsatz den Entzug der
männlichen Arbeitskraft kompensieren. Oft werden mit dem Lohneinkommen aus der
Landwirtschaft aber auch Lohnarbeiter beschäftigt… Die soziale Mobilität von
Arbeitskräften, das Hinüberwechseln von einem Wirtschaftssektor zum Tourismus, kann
38
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
auch positive Effekte haben. Dies trifft z.B. auf die weithin überbesetzte Agrarwirtschaft
zu; hier führt der Entzug von Arbeitskräften in der Regel nicht zu Produktionsrückgängen,
sondern zu einer Verbesserung der sozialen Lage der in der Landwirtschaft verbliebenen
Erwerbspersonen infolge der Entlastungseffekte. In der touristischen Nebensaison kann,
wenn nicht ohnehin die Arbeit im Tourismusgewerbe gänzlich eingestellt wird (saisonale
Betriebsschließung), z.B. in vielen Ländern auch der tariflich festgelegter Jahresurlaub
genommen und dann der eigene landwirtschaftliche Betrieb bewirtschaftet werden.“ Diese
Aussage trifft vor allem auf die ländliche Entwicklung der Länder zu. Wie genau
Tourismus- und Landwirtschaftsbeschäftigung kombinierbar sind, ist von raum-, klima-,
wirtschaftsstrukturbezogenen Faktoren abhängig. Die Landwirte können auch klarerweise
den Touristen ihre Produkten verkaufen. Die Direktvermarktung beeinflusst die
Beschäftigung und Einkommen der Landwirte und wird als dazugehörige Tätigkeit für den
Agrartourismus betrachtet.
4.5.2. Die ökologische Situation
Die intakte Umwelt ist u.a. eine Voraussetzung
für den Tourismus und für seinen
wirtschaftlichen Nutzen, häufig sogar das Instrument der Ressourcensicherung
(VORLAUFER, 2003). „Der Umweltsicherung, dem Natur-, Landschafts- und Artenschutz
kommt auch aus übergreifenden ökologischen, ethischen und kulturellen Gründen ein
Eigenwert zu. In wirtschaftlicher Hinsicht
legitimieren häufig erst die touristischen
Einnahmen den Umweltschutz, die Verhinderung oder Minimierung der Nutzung
touristischer Ressourcen auch durch andere Wirtschaftszweige“ (VORLAUFER, 2003).
Vermutlich sind Informationen über den ökologischen Zustand des Gebietes im Umfeld
des Betriebes für Agrartouristen wichtig, weil sie die Umwelt sowie eigene Gesundheit
erhalten bzw. fördern möchten. Das Umweltbewusstsein der Touristen dürfte neue
Herausforderungen an die agrartouristischen Unternehmen stellen. Angenommen wird,
dass umweltbewusste, umweltfreundliche Menschen bio- und regionale Produkte kaufen,
sich um ihre Gesundheit beim Urlaub kümmern und tendenziell ihren Urlaub am
Bauernhof verbringen. „In der letzten Zeit ist aber vor allem die ökologische Sphäre auch
im Tourismus stärker in dem Vordergrund getreten. Mit Recht wurde darauf hingewiesen
dass die Landschaft ein wesentliches Angebotselement darstellt und die Gefahr besteht,
dass der Tourismus selbst diese Grundlage zerstört... Überall spielt die ökologische Sphäre
39
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
eine gewichtige Rolle“ (KASPAR, 1990). Mit den Effekten der Umwelt auf die
Beschäftigung setzt man sich deshalb auseinander, weil „die ökologischen Folgen der
vielerorts ungehemmten Tourismusentwicklung für viele sicht- und spürbar wurden“. Die
ökologische Situation übt vermutlich in der Region einen Einfluss auf die
Beschäftigungssituation aus, denn „die Beziehungen zwischen Tourismus und Umwelt“
(MÜLLER, 2002) sind wechselseitig. Wobei „der Tourismus profitiert weit mehr von der
natürlichen Umwelt als umgekehrt. Als Folge der Beschäftigung bei der UmweltBelastung wie zum Beispiel „Bautätigkeit, Zersiedelung und Technisierung der
Landwirtschaft, architektonische Landschaftszerstörung“ (MÜLLER, 2002) braucht das
touristische Umfeld gewisse Umwelt-Erhaltung. Umwelt-erhaltende Beschäftigung
entstehent beispielweise von der „Koexistenz von Landwirtschaft (Landschaftspflege) und
Tourismus (Nebenerwerbsmöglichkeit), Schutz von Natur- und Kulturdenkmalen im
Interesse
des
Tourismus,
Umweltsensibilisierung
bei
Touristen,
Bereisten
und
Tourismusanbietern“ (MÜLLER, 2002).
Hochfrequentierte Flächen, welche Touristen öfter besuchen, würden das Personal für die
„Umwelterhaltung“ benötigen. Bestimmte Fläche wie Wald, Flussufer. müssten für die
Agrartourismuszwecke
sauber
erhalten
bzw.
saniert
werden.
Nah
zum
Agrartourismusbetrieb liegende Abfälle müssten vom Betrieb selbst oder durch spezielle
Dienste geräumt werden. Dadurch ergeben sich indirekte Beschäftigungseffekte des
Agrartourismus in der Region. Für die umweltverschmutzte Fläche wie Abfalldeponie
dürften die Beschäftigungseffekte im Agrartourismus, angenommen, gering werden, da der
Agrartourismus lieber auf nicht verschmutzten Flächen ansiedelt. Als ein anderer
indirekter Beschäftigungseffekt dürfte die Umweltsituation einer Region qualifizierte
Arbeitskräfte
benötigen,
zum
Beispiel
einen
Zertifizierungsservices.
Die
Zertifizierungsservices sind wieder von dem konkreten Land anhängig, sodass die
Beschäftigungseffekte in verschiedenen Hinsichten verursacht werden können.
4.5.3. Die Tourismusinfrastruktur
„Jegliche zukünftige Entwicklung des Fremdenverkehrs geschieht auf der Grundlage der
historisch
gewachsenen
Produktionsstrukturen
im
–
die
Sinne
diese
Raumstruktur
weitesten
Siedlungsstrukturen
und
Begriffe
der
einschließlich
Fremdenverkehrseinrichtungen und ihrer räumlichen Verteilung. Diese Strukturen werden
40
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
durch technologische und wirtschaftliche, institutionelle und politische, gesellschaftliche
und psychologische Entwicklungsprozesse laufend verändert – in manchen Zeiten
langsamer, zu anderen Zeiten schneller und mit unterschiedlichen Wirkungen auf den
Fremdenverkehr.“ (BÖVENTER, 1989).
„Unter die touristische Infrastruktur fällt vorerst
jene durch den Tourismus bedingte
zusätzliche, d.h. über das Richtmaß für einheimische hinausgehende allgemeine
Infrastruktur… Zur touristischen Suprastruktur werden ganz allgemein sämtliche
Beherbergungs- und Verpflegungsbetriebe (Hotels, Gasthöfe, Pensionen, Ferienhäuser,
Campingplätze, Massenunterkünfte, Restaurants, Tea-Rooms, Bars. usw.) gezählt“
(MÜLLER, 2002). MÜLLER weist darauf hin, dass die Begriffe die touristische
Infrastruktur und die Suprastruktur in der Literatur nicht einheitlich benutzt werden und
dazu gehören auch noch verschiedene touristische Events. Deshalb werden die Begriffe der
touristischen Infrastruktur, Suprastruktur und touristische Events für das Kapitel als
touristische Infrastruktur verwendet.
Touristische Infrastrukturen beeinflussen wohl auch die Beschäftigungssituation im
Agrartourismus. Es wird vermutlich zumindest von manchen Agrartouristen erwartet, dass
ein Angebot an touristischer Infrastruktur in der Region existiert. Und die Rolle der
Infrastruktur besser zu verstehen, sind die Konzepte „local rural multiplicity“ sowie
„puplic
magnets“
hilfreich.
Beide
Konzepte
richten
sich
auf
sogenannte
Anziehungsfaktoren, „ i.e. the emphasis is on tourism products and the subcomponents of
the tourism industry and what can be done on the basis of these to improve the
attractiveness of an area.”Local touristic multiplicity” bedeutet:

“A comprehensive range of attractions and activities…

A developed infrastructure in the area including an effective network of
communications both within and to an area.

A wide range of eating houses and accommodation.

A comprehensive range of services…
Areas vary in attractiveness. Some areas are so unique that tourists visit them even through
little is done to market them. Even if there is a touristic multiplicity, this does not
necessary mean that large numbers of tourists will be automatically attracted. Areas
without any special conditions may need a public magnet to provide a viable basis for the
41
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
tourist industry. Public magnet is the term used for a special activity that will enhance the
attractiveness of an area. It may also raise the level of the local multiplicity of tourist
activities”
(BRAMWELL
and
INTERNATIONAL
SCHOOL
ON
RURAL
DEVELOPMENT, 1994).
Unter Berücksichtigung dieser Konzepte wird klar, dass nur für wenige Abenteuergäste,
die vermutlich auf der Suche nach einem ruhigen Ort sind, im Vergleich zu anderen
Gästen, dürfte das Fehlen der Infrastruktur einen Reiz für diese ausüben. Logisch wäre zu
vermuten, dass in den Regionen mit fehlender touristischer Infrastruktur, die
Beschäftigung im Agrartourismus nicht bedeutend wird. Vermutlich, wenn die notwenige
Infrastruktur in der Region da ist, wie zum Beispiel Gastronomie, Transportinfrastruktur,
Museen, könnte das Personal von dem Agrartourismusbetrieb sich mit weiteren
Freizeitaktivitäten für die Gäste beschäftigen. Unter solcher Freizeitgestaltung werden
gemeinsame (Betriebsmitarbeiter und Tourist) ethnographische Ausflüge, Grill- und
Essensvorbereitungen, Jagd, Angeln, Begleitung bei Ausritten, Wanderungen usw.
gemeint. „Infrastructure enhancement may be very important to employment in remote
areas with substantial tourism potential… where infrastructure may be rapidly recovered
though expanded tourist attraction” (OECD, 1996). In der Region mit gut funktionierender
vielfältiger Tourismusinfrastruktur ist der Multiplikatoreffekt im Vergleich zur
unentwickelten oder gering entwickelten Infrastruktur größer. Der Multiplikatoreffekt des
Agrartourismus in einer Region dürfte vermutlich die Beschäftigung erhöhen.
4.6. Tourismus- und Regionalentwicklungsstrategien
„In zahlreichen vormals peripheren und unterentwickelten Regionen konnte der
Fremdenverkehr ein z.T. stürmisches Wachstum verzeichnen“ (VORLAUFER, 2003).
Außer
den
schon
oben
betrachteten
Faktoren
dürfen
die
Regional-
und
Enzwicklungsstrategien insbesondere in einem Einklang mit den anderen Einflussfakturen
die Beschäftigungseffekte in
einer Region
verursachen.
LANE,
(1994) weist
beispielsweise darauf hin, dass der Agrartourismus in deutschsprachige Teilen Europas
gemeinsam mit passender kleistrukturierten Landwirtschaft auch deshalb seine Potenziale
42
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
gezeigt hat, weil er viel Aufmerksamkeit von Regierungen, Akademikers, Politik
bekommt.
Regionalentwicklungsstrategien geben vermutlich Impulse für die Entwicklung des
Agrartourismus und fördern ländliche Beschäftigung. Zu vermuten wäre, dass regionale
Entwicklungsstrategien eine Erhöhung der Jugendbeschäftigung zum Ziel hätten. Eine
solche Beschäftigungsquelle in ländlichen Räumen ist vermutlich der Agrartourismus.
Samt den regionalen Entwicklungsstrategien könnte der Tourismus zu einem der
wichtigsten Arbeitgeber in der Region werden (KRAMMER, 2006). Regionale
Vermarktungsstrategien schaffen ein bestimmtes Image für die Region (Genuss-, Wein,
Kräuterregion). Innerhalb einer Strategie könnten auch im Agrartourismus die Betriebe in
der Beschäftigung sich gegenseitig unterstützen. Bestimmte dürften zwischen mehreren
Betrieben geteilt werden, wie zum Beispiel Werbung oder Unterbringung, aber auch neue
Mitarbeiter dürften angestellt werden. Demgegenüber wird angenommen, dass
industriefördernde regionale Strategien agrartouristischer Beschäftigung schaden würden.
Denn vermutlich sind Industriegebiete für Agrartourismus nicht anziehend. Eine Region, in
der es keine Regionalentwicklungsstrategien und Programme gibt, wird angenommen
ungünstige Bedingungen für Tourismuszwecke haben. Wenn aber in einem globalen
Umfeld regionale Entwicklungsstrategien zu Verfügung stünden, dürften dann die
Voraussetzungen für die Beschäftigung im Agrartourismus in der Teilregion aller
Wahrscheinlichkeit nach nicht schlecht sein. SEROVA (2004) schrieb, dass Maßnahmen
innerhalb von Entwicklungsstrategien, für das Generieren alternativer Beschäftigung in
ländlichen Räumen besonders effektiv wären. In einer Tourismusvermarktungsstrategie
involviert, hat der Betrieb vermutlich mehr Chancen das Personal weiterzubilden und sich
qualitativ zu stärken.
4.7. Politik und Rechtsvorschriften
Rechtsvorschriften für den Agrartourismus regulieren die Tätigkeit der Betriebe und
schaffen für derer Arbeit bestimmte Rahmenbedienungen. Klarerweise unterscheiden sich
die rechtlichen Vorschriften von einem Land zu einem anderen. Es ist für Russland so,
dass eine spezielle Rechtsvorschrift für den Agrartourismus existiert. Tourismustätigkeit
wird hauptsächlich durch das Tourismusgesetz, Zivilkodex und Verfassung der Russischen
43
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
Föderation gesteuert. Weiters gibt es in Russland ca. 30 Rechtsvorschriften, an welche sich
der Agrartourismuslandwirt halten soll (MERZLOV, 2012).
Es
dürfte
vor
allem
Buchführungs-
und
Besteuerungsvorschriften
auf
die
Beschäftigungssituation einen Einfluss ausüben. Beispielsweise darf man in Russland ein
sogenanntes vereinfachtes Buchführungs- und Besteuerungssystem verwenden, bis die
Mitarbeiterzahl 30 erreicht Ein Kleinbetrieb dürfte somit an Mitarbeiterzahl limitiert
werden. Es könnte im Rahmen einer pauschalierten Buchführung für einen
agrartouristischen Betrieb die Anzahl der Betten begrenzt sein, das ist zum Beispiel in
Österreich der Fall. In seinem Artikel weist Lane auf limitierte Bettenkapazität eines
Kleinbetriebes (zehn Betten). (BRAMWELL and INTERNATIONAL SCHOOL ON
RURAL DEVELOPMENT, 1994). Ein weiteres Wachstum eines kleinen Betriebes könnte
meistens eine im Vergleich zu Pauschalierten höhere Besteuerung, Verluste sowie eine
aufwendige doppelte Buchführung zur Folge haben. Es besteht Anlass zur Vermutung,
dass je umfangreicher die Besteuerung und Buchführung für einen agrartouristischen
Betrieb sein sollte, desto weniger Bedeutung wird der Agrartourismus in der
Regionalbeschäftigungssituation haben. Ein einfaches Besteuerungssystem wird die
Beschäftigung im Agrartourismus vermutlich begünstigen.
4.8. Wirtschaftslage
Aus der Definition von Beschäftigungseffekten folgt, dass die Beschäftigungseffekte stark
von Reiseausgeben bzw. Umsätzen anhängig sind. Durch die in der Region verbleibenden
touristischen Geldströme werden zusätzliche Arbeitsplätze geschafft. Dies weist auf die
Gesamtausgaben der Touristen und somit auf wirtschaftliche Lage der Region hin. Die
Reiseausgaben werden vermutlich „mit im Trend abnehmenden Wachstumsraten“
wachsen, wobei der positive Trend von zwei großen Gruppen von Einflussfaktoren
abhängig ist. Zu der ersten Gruppe zählt das Wirtschaftswachstum mit Pro-KopfEinkommen und Reise-Angeboten. Zu zweiter Gruppe gehören Veränderungen der
Sozialstruktur, der Siedlungsstruktur und demographischer Faktoren (BÖVENTER, 1989).
Die Wirtschaftslage einer Region wird mittels einer Reihe von Wirtschaftsgrößen
beschrieben. Eine davon ist das BIP der Region oder pro Kopf Einkommen. Wachsender
Wohlstand der Gesellschaft lässt zuerst die Grundbedürfnisse und anschließend
44
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
hochwertige Bedürfnisse befriedigen. „Nach der Sättigung mit den Grundbedürfnissen und
mit dauerhaften Konsumgütern verbleibt im Wachstumsprozess mehr Kaufkraft für
(touristische) Dienstleistungen“ (WEIERMAIR and BIEGER, 2008). Weiters weist
BOVENTER (1989) darauf hin, dass die Reiseintensität weiter zunehmen wird und sich
einer Sättigungsgrenze nähern wird. „Die Bedürfnisse der Menschen sind einem zeitlichen
Wandel unterworfen. Maslow hat indessen nachgewiesen, dass eine gewisse prioritäre
Bedürfnis-Struktur besteht“ (KASPAR, 1990). Das Reisen befindet sich laut Maslows
Bedürfnispyramide nach der Befriedigung der Grundbedürfnisse und des Existenzbedarfs.
„Auf den höchsten Ebenen bedeutet Reisen vor allem Prestige, Anerkennung und danach
Selbstverwirklichung und Glück. So ist die heutige Form des (Urlaubs-) Tourismus
weitergehend
einzustufen:
Reisen
dienen
vorwiegend
dem
Vergnügen,
der
Selbstverwirklichung“ (FREYER, 2006).
„Erlebniskonsum ist nicht umsonst zu haben. Es bedeutet Verzicht auf Mittelmaß: Sich
Qualität und Luxus leisten zu können, aber dafür auch in anderen Bereichen Billigwaren
und Opferkäufe nehmen zu müssen. Billig und teuer schließen sich nicht mehr gegenseitig
aus… Der Verbraucher wird zur gespaltenen Persönlichkeit, der das Einsparen ebenso
beherrscht wie das Verschwenden“ (OPASCHOWSKI, 1997). Trotz dem gespaltenen
Konsumverhalten besteht Anlass zu vermuten, dass die Größe der touristischen Ausgaben
von der Einkommenshöhe abhängig ist. Durch die Einkommenshöhe wird ein Preis der
Arbeitskräfte im Agrartourismus sowie eine effektive Nachfrage determiniert. In einem
Haushalt wird vermutlich ein bestimmter Teil des Einkommens als Urlaubsgeld geplant.
Der Nachfrage im Agrartourismus wird zum Teil auch durch das Einkommen erklärt. Die
Höhe des Einkommens bestimmt die Bereitschaft, das Geld für einen Urlaub auszugeben.
Die zweite Wirtschaftsgröße ist der Kapitalzins. In den Entscheidungsebenen einer
touristischen Destination wird nach Freyer unter anderem die Frage „Wie teuer?“ für eine
Reiseentscheidung gestellt. In der Theorie beeinflusst das Einkommen touristische
Ausgaben: zum Beispiel „auf den Transport entfällt, abhängig vomVerkehrsmittel und der
Entfernung, in der Regel ein Großteil der Reiseausgaben“ (KLIEM, 2003). „Private
Haushalte verwenden mit steigendem Einkommensniveau ihr zusätzliches Einkommen
vorrangig für Dienstleistungseinkäufe.“ Anders ausgedrückt, kann erwartet werden, dass
(touristische) Dienstleistungen im Allgemeinen eine Einkommenselastizität über 1
aufweisen, so dass mit wachsendem Pro-Kopf-Einkommen die reale Pro-Kopf-Nachfrage
45
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
nach (touristischen) Dienstleistungen überproportional steigt. Daher steigt langfristig auch
der Anteil der (touristischen) Dienstleistungen in der Gesamtwirtschaft und (cet. pat.) an
der Gesamtbeschäftigung“ (WEIERMAIR and BIEGER, 2008).
Personen mit einem sehr knappen Einkommen leisten sich oftmals keinen Urlaub. Ab
einem bestimmten Einkommen entsteht eine Nachfrage nach Reisen, welche auch durch
Urlaub am Bauernhof realisierbar ist. Bei weiterem Einkommenswachstum der
Bevölkerung würde das Reiseziel Urlaub am Bauernhof an Atraktivität verlieren und sich
vermutlich Richtung einer Fernreise ändern. Eine Fernreise würde bedeuten, dass der
Tourist dem agrartouristischen Segment nicht zur Verfügung steht. D.h. bei weiterem
Wachstum des Einkommens sinkt vermutlich die Anzahl der Agrartouristen. Dieses
Verhalten stellt Abbildung 4 dar. Zuerst ist die Anzahl der Reisenden Null, weil die Leute
zu wenig Einkommen haben. Mit einer Steigerung des Einkommens können mehrere Leute
auf einen Urlaub fahren, somit steigt auch die Nachfrage für Urlaub am Bauernhof. Und
immer weniger Touristen werden ab einem Spitzeneinkommen hinkommen und immer
Anzahl agrartouristischer Reisen
mehr Touristen werden dem Agrartourismussektor wegbleiben.
Pro Kopf Einkommen der Bevölkerung
Abbildung 4: Einkommensverteilung (eigene Darstellung)
Die Keynesianische Beschäftigungsfunktion erklärt, dass jeder Effektivnachfrage eine
strikte Produktverteilung verschiedener Industrien entspricht (KEYNES, 2009). Aber in
46
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
der
Realität
ändert
sich
die
Kostenstruktur
nicht
proportional:
mit
einer
Einkommenssteigerung kauft ein Individuum nicht mehr vom jedem Gut - unter anderem
auch, weil die Preise in unterschiedlichem Maße auf den Anstieg der Kosten reagieren.
Das dürfte auch für den Agrartourismus relevant sein. Man fährt nicht öfter in Urlaub, als
es die eigene Freizeit erlaubt. Einkommensgrößen sind vermutlich nicht irrelevant für die
Beschäftigung, auch wenn sie nicht beeinflussbar sind. Eine negative Korrelation darf
vermutlich zwischen Reisekosten und Anzahl der Besucher angenommen werden. Je
kostenintensiver es ist, zur Erholungsanlage zu kommen, umso geringer wird die
Besucherhäufigkeit ausfallen (ECKEY and STOCK, 2000). Angenommen wird, dass dies
auch im Agrartourismus gilt. Bezüglich des Einkommens lässt sich für die Beschäftigung
folgendes vermuten: ein niedriges regionales Lohnniveau dürfte für den Agrartourismus
günstigere Voraussetzungen bringen. Genauer, sind die Löhne/Einkommen in der
Teilregion niedrig, so dürften auch die Preise für Arbeitskräfte im Vergleich zum globalen
Umfeld niedriger sein, was das Angebot an Arbeitskräften für den Agrartourismus
vergleichsweise günstig machen könnte. Aus. Abbildung 5 wird ersichtlich, wie im
globalen und regionalen Umfeld das Lohnniveau die agrartouristische Beschäftigung
beeinflussen könnte.
hoch
hoch
niedrig
Leistungen im Tourismus im
teuren/Luxussegment
Touristenströme für den Agrartourismus
Leistungen im Agrartourismus
Schechte Wirtschaftskonjunktur für
Tourismus
niedrig
Umfeldes
Lohnniveau des globalen
Lohnniveau des regionalen Umfeldes
Abbildung 5: Lohn und Beschäftigung im Agrartourismus in einer Teilregion und im globalen Umfeld (Quelle
Die
Kapitalgröße
eigene
Darstellung) bestimmt die Wirtschaftslage einer Region durch die Zinsen. Teureres
47
Effekte des Agrartourismus auf die Beschäftigungssituation einer Region
Es lässt sich auch vermuten, dass der Agrartourismus am meisten für diejenigen Personen
geeignet ist, die sich mehr an Budgetreisen und weniger an Luxusreisen orientieren. In
diesem Segment liegt auch das Bedürfnis, die Arbeitsplätze des Agrartourismus zu
erfüllen.
In diesem Abschnitt ist es um die verschiedene Einflussfaktoren gegangen, welche im
Agrartourismus Beschäftigungseffekte verursachen, Das Ziel des Kapitel war es, zu
beantworten, welche Einflussfaktoren es im Bereich des Agrartourismus in einer Region
gibt und wie sich diese Einflussfaktoren auswirken. Die Auseinandersetzung mit diesen
Einflussfaktoren dient als Basis für die Beantwortung der Forschungsfrage dieser Arbeit.
Die auf Literatur und eigene Überlegungen gestützenden theorethischen Annahmen über
die Beschäftigungseffekte des Agrartourismus bedürfen eine empirischen Überprüfung,
wie diese Methode abgewickelt wurde, stelllt das nachfolgede Kapitel dar.
48
Material und Methoden
5. MATERIAL UND METHODEN
5.1. Vorgehensweise zurGewinnung statistischer Daten über Tourismus
Zur
Beantwortung
der
Forschungsfrage
der
vorliegenden
Arbeit
–
welche
Beschäftigungseffekte aufgrund des Agrartourismus in der Region Kaschin entstehen werden fachspezifische Daten benötigt. Statistische Daten u.a. der Tourismuswirtschaft
sind in Russland in folgenden Quellen zu erwerben: Federal State Statistics Service
ROSSTATISTIKA/GKS
(Федеральная
служба
государственной
статистики
Росстатистика), Unified Interdepartmental Statistical Information System UniSIS
(Единая межведомственная информационно – статистическая система -ЕМИСС ),
Federal Agency for Tourism ROSTURISM (Федеральное Агентство по Туризму –
Ростуризм), Ministry for Culture of the Russian Federation.
Über die Webseite (www.gks.ru) des ROSSTATISTIKA kommt man zu den Datenbasen
UniSIS,
zur
zentralen
statistischen
Datenbank
CSDB
(Центральная
база
статистических данных - ЦБСД) und zur Datenbank für Gemeindekennzahlen (База
данных показателей муниципальных образований).
UniSIS hat den Status einer integrierten statistischen Ressource und verlinkt/beinhaltet
insgesamt die statistischen Daten aus 65 Departments. Ausgewählte Beispiele sind in der
folgenden Übersicht dargestellt.
49
Material und Methoden
Übersicht 1: Federal State Statistics Service, several types and levels of subdivisions of
Russia
Logo
Name
Federal State Statistics Service
Site
http://www.gks.ru
Federal Service For Employment And
http://www.rostrud.info/
Labor Relations
Ministry Of Regional Development
http://www.minregion.ru/
Ministry Of Agriculture
http://www.mcx.ru
Ministry Of Sport, Tourism And
http://minstm.gov.ru/
Youth Policy
Federal Agency For Tourism
http://www.russiatourism.ru
Ministry Of Natural Resources And
http://www.mnr.gov.ru
Ecology
Federal Service For Supervision Of
http://control.mnr.gov.ru
Nature Resources
Ministry Of Economic Development
http://www.economy.gov.ru
(Quelle: UniSIS, eigene Darstellung, 2014)
Gibt man als Schlagwort „Tourism“ im Suchfenster ein, so bekommt man 43 Treffer,
„Tourism effect“ – 55 Treffer, „employment effect“ 63 Treffer. UniSIS dient deshalb als
50
Material und Methoden
Suchmaschine - http://www.fedstat.ru/indicators/search.do. Durch erweiterte Suche besteht
für den Benutzer eine Option, die Daten nach Thema und Quelle einzugrenzen. Dieser
Dienst ist dann hilfreich, wenn man einen groben Überblick über die Informationen aus
ganz Russland braucht. Folgende Abbildung 6 stellt die Suchmaschine des UniSIS auf dem
Screenshot dar.
Abbildung 6: Suchmaschine des UniSIS (UniSIS, 2014)
Beispielsweise, wie viele Tourismusunternehmen in Russland tätig sind, wird durch die
UniSIS wie folgend dargestellt. Die Tourismusart kann nicht weiter, zum Beispiel als
„ländlich“, „Ökotourismus“, „Urlaub am Bauernhof“ eingegrenzt werden.
Tabelle 1: Reiseveranstalter in der Russischen Föderation
Jahr
Anzahl der
Reiseveranstalter
in Russischer
Föderation, Anzahl
der Unternehmen
In-coming
Tourismus,
Anzahl der
Unternehmen
Internationaler Incoming und
outgoing
Tourismus,
Anzahl der
Unternehmen
Internationaler incoming –
Tourismus,
Anzahl der
Unternehmen
2010
4593
1858
2169
566
2011
4718
1833
2885
656
2012
4685
1889
2796
580
2013
4608
2421
2187
225
(Quelle: UniSIS, 2014, leicht verändert)
CBSD (ЦБСД) ist eine interaktive Matrix des ROSSTATISTIKA. Sie dient dazu,
analytische Graphiken, Tabellen, Diagramme, zu generieren, http://cbsd.gks.ru. Die
Datensuchmöglichkeiten sind äußerst umfangreich, deshalb wurde für die vorliegende
Arbeit versucht, die Daten über Löhne und Beschäftigung auszuheben. Die Ressource ist
51
Material und Methoden
aber neu und noch nicht vollständig mit Daten gefüllt. Folgende Abbildung
veranschaulicht das Interface von CSBD des GKS.
Abbildung 7: Interface von CSBD des GKS (Quelle: CBSD ROSSTATISTIKA, 2014)
52
Material und Methoden
Über die Datenbank für Gemeindekennzahlen - http://www.gks.ru/dbscripts/munst bekommt ein Systembenutzer Informationen innerhalb der kleinsten administrativen
Einheit – ländliche Siedlung, Stadt, eine Gruppe von Siedlungen innerhalb einer Gemeinde
laut administrativer Struktur der Russischen Föderation. Ein Nachteil ist, dass die
Datensätze nicht einheitlich und nicht lückenfrei sind, was klarerweise einen Vergleich, ein
Zusammenrechnen verkompliziert oder gar unmöglich macht. Für eine Datenabfrage aus
dieser Ressource ist als erstes die Auswahl der Region, danach Indikatoren (Territorien,
Bevölkerung, Bildung, Sport, etc.) zu bestimmem. Abschließend wird eine Tabelle
gestaltet.
Abbildung 8: Gestaltung einer statistischen Tabelle für eine ausgewählte Kleinregion online (Quelle: GKS,
2014)
Selbst die Webseite des GKS bietet zu verschiedenen Bereichen digitale Statistiken –

Bevölkerung

Arbeit

Lebensqualität
53
Material und Methoden

Landwirtschaft

Investitionen, etc.
Publikationen des GKS sind zum Teil im Publikationskatalog verlinkt und online
verfügbar:
http://www.gks.ru/wps/wcm/connect/rosstat_main/rosstat/ru/statistics/publications/plan
Die touristische Beschäftigung bzw. nähere Informationen zum Tourismus in Russland
sind via ROSTURISM (Federal Agency for Tourism, Ministry for Culture of the Russian
Federation) zu finden. Die Webseite ist wiederum mit UniSIS verbunden, beinhaltet aber
auch einige eigene statistische Informationen, wie etwa Zahlen der Ein- und Ausreisen. Ein
Überblick und kurze Definitionen von verschiedenen Tourismusarten u.a. Ökotourismus
und ländlicher Tourismus auf dieser Seite publiziert.
Für die vorliegende Arbeit werden Statistiken dazu benutzt einen Überblick zu geben. Da
die Zahlen der Ein- und Ausreisen keine Auskunft über bestimmte Regionen und
Tourismusarten geben, ist es nicht möglich, anhand dieser vorhandenen Daten
Beschäftigungseffekte in VZÄ zu bekommen. Es gibt keine konkreten Daten über
Agrartourismus, weil der Agrartourismus in der Statistik nicht separat erfasst wird.
Für die Forschungsfragen sind Daten erforderlich, die über die Beschäftigungseffekte des
Agrartourismus in der jeweiligen Region eine Auskunft geben. Das sind Zahlen der
Beschäftigung, der Touristen sowie deren Ausgaben usw. in der Region. Wenn Daten in
den Datenquellen der amtlichen Statistik nicht öffentlich zugänglich sind, besteht eine
Möglichkeit, manche Daten bei GKS auf Anfrage zu bekommen.
5.2. Qualitative Methoden und Case Study Approach
Da diese Arbeit sich mit Beschäftigungseffekten des Agrartourismus beschäftigt, welcher
in der Statistik nicht erfasst wird, stehen nicht ausreichend statistische Daten zur
Verfügung. Es besteht zumindest telefonisch die Möglichkeit, mit Leuten, die im
Agrartourismus arbeiten, Experten aus der Region, zu sprechen und somit von innen einen
Überblick der agrartouristischen Beschäftigung.
Zur Beantwortung der Forschungsfrage wird eine Methode qualitativer Sozialforschung
benutzt. Qualitative Sozialforschung bedient sich qualitativer Daten, vor allem
„verbalisierter oder verschriftlichter Daten oder Texte“ (HEINZE, 2001). Die qualitativen
54
Material und Methoden
Daten werden mit Hilfe der qualitativen Methode erstellt und werden zur qualitativen
„Analyse, die interpretativ/hermeneutisch ist“, verwendet.
Die qualitativen Methoden erlauben „inhaltliche Erwartungen und Erfahrungen zu
rekonstruieren,
Bedürfnisse
und
Motive
zu
artikulieren,
Lebensvollzüge
und
Interaktionsformen mitzuteilen“ (HEINZE, 1987). Dadurch, dass Leute, die im
Agrartourismus arbeiten, jeden Tag in diesem Bereich Erfahrungen sammeln und
Veränderungen beobachten, sind sie auch für diese Arbeit eine wertvolle Wissensquelle.
Diese Leute können ihre Erfahrungen erzählen und somit das Material für die vorliegende
Arbeit liefern. Daraus werden Einzelfallstudien entstehen. HEINZE (1987) weist darauf
hin, dass „die Einzelfallanalysen der schrittweisen Entdeckung allgemeiner Strukturen
sozialen Handelns dienen, während der Einzelfall selbst – so Soeffner – als historischkonkrete Antwort auf eine konkret-historische Situation und Strukturerfordernis
interpretiert werde“. Die Einzelfallstudie ermöglicht, tiefere und breitere Informationen im
Vergleich
zu
sekundärstatistischen
Daten
sowie
Primärdatenerhebungen
mit
standardisierten Fragebogen zu bekommen.
Der Case Study Approach eignet sich u.a. als qualitative Methode der Sozialforschung.
Zuerst wird auf die Prinzipien des Case Study Designs eingegangen, um eine für diese
Arbeit passende Einzelfallstudie zu gestalten. Der Grund für eine eigene Datenerhebung im
Rahmen der Einzelfallstudien ist die kleine Anzahl der untersuchten Betriebe in der Region
(die Auswahl der Forschungsregion und Betriebe siehe Kapitel 6.). Case study “allows the
researcher to explore individuals or organizations” (YIN, 2000) and supports the
deconstruction and the subsequent reconstruction of various phenomena (BAXTER and
JACK, 2008, MOALOSI et al., 2012).
„Case studies are [an] appropriate research method when you are trying to attribute casual
relationships - and not only wanting to explore or describe a situation… Multiple-case
studies should follow a replication, not sampling logic. This means that two or more case
studies should be included within the same study precisely because the investigator
predicts that similar results (replications) will be found… The correct specification of a
theory will provide you with a predicted pattern of events…Case study research should be
used to expand our understanding of theoretical propositions and hypothesizes in those
situations where
55
Material und Methoden
a) the content is important and
b) events can not be manipulated “ (YIN, 2000).
Eine Case Study oder Einzelfallstudie hat unter anderem zum Ziel, die benötigten
Informationen über die Beschäftigungseffekte des Agrartourismus in Kaschin darzustellen.
Dafür ist ein Plan für die Recherche bzw. Case Study Design notwendig (YIN, 2002). Da
in der Region drei Betriebe für die Analyse zur Verfügung stehen, wird hier die multiplecase study method verwendet. Die Umsetzung der multiple-case study Methode wird nach
YIN (2002) in der Abbildung 9 skizziert. Die Case study Methode bietet eine logische
Recherchestrategie an. Die Technische Definition der case study bezeichnet „an empirical
inquiry that

Investigates a contemporary phenomenon within its real-life context, especially
when

The boundaries between phenomenon and context are not clearly evident (YIN,
2002, YIN, 1994)”.
Der zweite Teil dieser Definition ist „The case study inquiry… relies on multiple sources
of evidence, with data needing to converge in a triangulating fashion, and as another result
benefits from the prior development of theoretical propositions to guide data collection and
analysis” (YIN, 1994).
Das theoretische Wissen zum Forschungsbereich ist bereits im Modell gesammelt worden.
Darüber hinaus wird entschieden, wie und welche Informationen zu erheben sind und
welche Einzelfälle zu Verfügung stehen. Die Fälle sowie die Datenerhebungsmethode
(design
data
collection
protocol)
werden
selektiert/ausgewählt.
Diese
Entscheidungsprozesse werden in einem Protokoll aufgenommen/fixiert. Anschließend
erfolgt die Durchführung der Einzelfallstudien. Das Minimum von Fällen/Cases für eine
multiple-case study beträgt zwei. Die multiple-case study der vorliegenden Arbeit besteht
aus drei individuellen Einzelfallstudien. Die Daten werden durch Interviews erhoben.
Zusätzlich werden Literaturrecherche, Webrecherchen und statistische Nachfragen
durchgeführt, denn „case studies can include, even be limited to, quantitative
evidence“(YIN, 1994). Aus diesen werden die Beschäftigungseffekte abgeleitet und
zusammengefasst. Jede Einzelfallstudie besteht aus „[a] whole study, in which convergent
56
Material und Methoden
evidence is sought regarding the facts and conclusions for the case; each case’s
conclusions are then considered to be the information needing replication by other[s]
individual
cases“
(YIN,
2002).
Jedes
Einzelfallresultat
gehört
zu
einem
zusammenfassenden Bericht. Folgende Abbildung gibt die Vorgehensweise für die
multiple case study graphisch an.
Abbildung 9: Multiple-case study Methode (Quelle: YIN, 2002)
Die Technik der qualitativen Inhaltsanalyse kann „anhand testtheoretischer Gütekriterien
(Objektivität, Reliabilität, Validität)“ des Interviews bewertet werden“ (KONRAD, 2011).
“Because a research design is supposed to represent a logical set of statements, you can
also judge the quality of any given design according to certain logical tests… There are
four widely used tests and … recommended case study tactics” (YIN, 1994). In Übersicht
5 sind die Tests vorgestellt.
57
Material und Methoden
Übersicht 2: case study tactics recommended tests
tests
case study tactic
phase of research
in which tactic occurs
construct validity
internal validity
 use multiple sources of evidence
data collection
 establish chain of evidence
data collection
 have key informants review draft case study report
composition
 do pattern-matching
data analysis
 do explanation-building
data analysis
 do time-series analysis
data analysis
external validity
 use replication logic in multiple case studies
research design
reliability
 use case study protocol
data collection
 develop case study data base
collection
(Quelle: (YIN, 1994)

“Construct Validity: establishing correct operational measures for the concepts
being studied

Internal Validity (for explanatory or causal studies only, and not for the descriptive
or exploratory studies): establishing a causal relationship, whereby certain conditions are
shown to lead other conditions, as distinguished from spurious relationships” (YIN, 1994).
Zur inneren Validität können die ethnographischen Daten beitragen (GLÄSER, 2009). Als
weitere Analysetechnik nennt YIN (2003) Pattern-matching-logic für die Case Study als
sehr erwünscht. Pattern Matching Technik “compares an empirically based pattern with a
predicted one (or with several alternative predictions)”. Wenn die „patterns“
übereinstimmen, engt sich die innere Validität ein.

„External Validity: establishing the domain to which a study’s findings can be
generalized

Reliability: demonstrating that the operations of a study – such as the data
collection procedures can be repeated, with the same results “ (YIN, 1994)
58
Material und Methoden
Die drei Einzelfallstudien, die im Rahmen der Arbeit durchgeführt werden, erlauben mehr
Reliabilität im Vergleich zu nur einer Einzelfallstudie darzustellen. Bei mehreren Studien
wird überprüft, ob die Forschungsoperation zu ähnlichen Ergebnissen führt (MAYRING,
2010). Beispielsweise, ob die Saisonalität in Wintermonaten begrenzend auf die
Beschäftigung wirkt. Falls die interviewten Personen auf dieselbe Einflussfaktoren in
verschiedenen Fallstudien eingehen, werden die Auswirkungen ersichtlich.
Im nächsten Abschnitt wird darauf eingegangen, dass empirische Daten durch qualitative
Interviews für die Arbeit erhoben werden. Innerhalb jeder Einzelfallstudie werden
telephonisch narrative Interviews sowie Experteninterviews durchgeführt. Bei narrativen
Interviews wird am Ende der Narration detailliert nachgefragt, falls die interviewte Person
nur kurz auf die im theorethischen Modell beschriebenen Einflussfaktoren eingeht.
5.3. Das qualitative narrative Interview als Datenerhebungsmethode
Das
narrative
Interview
ist
von
Fritz
Schütze
als
„sozialwissenschaftliches
Erhebungsverfahren, das den Interviewten durch eine erzählgenerative Anfangsfrage zu
einer
Erzählung
persönlicher
Erlebnisse
veranlasst“
(HEINZE,
1987)
für
die
bibliographische Forschung erfunden. Die Grundannahme von Schütze ist, dass die Erzählund Erlebnisstrukturen homolog sind. So ist es möglich, durch die Analyse von
Erzählmaterial elementare Prozessstrukturen, deren Mechanismen und grundlegende
Kombinationsvarianten zu identifizieren“ (HEINZE, 1987). Das qualitative narrative
Interview, Experteninterview ist die Datenerhebungsmethode in dieser Arbeit.
„Narrative Interviews dann zu gebrauchen, wenn es für die gewählte Fragestellung auf
subjektive Erfahrungen und erzählenswerte Ereignisse ankommt“ (HOLTGREWE, 2009).
Schütze strukturiert das narrative Interview in drei Hauptteile: erster Hauptteil ist das
Interview, das ununterbrochen sein soll, zweiter Hauptteil ist das Nachfragen und ein
dritter Teil dient für anschließende Erklärungen (HEINZE, 1987). Rosenthal charakterisiert
vier folgende Phasen: Erzählungsaufforderung, Haupterzählung, erzählungsgenerierendes
Nachfragen und Interviewabschluss (HOPF, 2004).
59
Material und Methoden
LAMNEK (1995) beschreibt fünf Phasen der narrativen Interviews. Als erste kommt die
Erklärungsphase, wo der Interviewte „über Besonderheiten und die Funktion des
narrativen Interviews informiert werden“ sollte. In diesem Zusammenhang werden die
Aufzeichnung des Gesprächs und Transkription thematisiert, was auch zur offenen
Atmosphäre dienen sollte. Die Erklärungsphase folgt die Einleitungsphase, in der man zu
klären versucht, „unter welchen Aspekten selbst erlebte Ereignisse erzählt werden sollen“,
und die Erzählungsphase. Während der Erzählungsphase des narrativen Interviews reagiert
der Interviewpartner mit einer längeren Erzählung. „Im narrativen Interview wird der zu
Befragende aufgefordert, etwas über den im Gespräch benannten Gegenstand zu erzählen,
was natürlich voraussetzt, dass der Befragte eine entsprechende Kompetenz besitzt“
(LAMNEK, 1995). Im narrativen Interview besteht die Möglichkeit für den Interviewer,
sobald die Erzählung beendet ist, „unklar gebliebene Fragen oder Widersprüchlichkeiten in
der Erzählung“ (LAMNEK, 1995) in Phase vier zu klären. Die Nachfragen können die
Erzählung weiterlaufen lassen, was bei unberührten Themenbereichen hilfreich sein wird.
„Besonders an dieser Stelle wird wieder auf die narrative Kompetenz des Befragten
zurückgegriffen“ (LAMNEK, 1995). Wünschenswert für die vorliegende Arbeit ist, dass
möglichst alle im Modell ausgearbeiteten Einflussfaktoren durch Aussagen der
interviewten Personen abgedeckt sind. Deshalb wird das narrative Interview in dieser
Arbeit
nicht
als
rein
narratives
angewendet,
sondern
mit
Elementen
des
Leitfadeninterviews. Das Leitfadeninterview „zeichnet sich dadurch aus, dass sich der
Gesprächsverlauf an einem Leitfaden orientiert, welcher eine dezidierte Steuerung des
Gesprächsverlaufs begünstigt und die Fokussierung auf relevante Themenbereiche
sicherstellt. Auf diese Weise ist es möglich, breit gefächerte, explorative Informationen zu
gewinnen und zugleich die Konzentration auf das Forschungsinteresse beizubehalten“
(KAUNE, 2010). Das Einflussfaktorenmodell ist de facto Leitfaden für den Interviewer.
Während der Narration wird durch die kleine Anzahl der modellbezogenen Faktoren leicht
bemerkbar, auf welche Einflussfaktoren gar nicht oder nur bedingt eingegangen wird. „Das
Leitfadeninterview bietet durch die spezifische Form der Vorbereitung (der Leitfaden)
hinreichend Möglichkeiten, theoretische Vorüberlegungen in der Erhebung
zu
berücksichtigen“ (ATTESLANDER, 2010) „Der Leitfaden dient entsprechend als Gerüst
für
die
Datenerhebung
und
ermöglicht
die
Vergleichbarkeit
der
Ergebnisse
unterschiedlicher Interviews“ (KAUNE, 2010). „Dem Prinzip der Offenheit wird dadurch
60
Material und Methoden
Rechnung getragen, dass die Fragen so formuliert werden, dass sie dem Interviewten die
Möglichkeit geben, seinem Wissen und seinen Interessen entsprechend zu antworten“
(ATTESLANDER, 2010). Die fünfte Phase laut Lamnek ist die sogenannte
Bilanzierungsphase – am Schluss können „direkte Fragen nach der Motivation und der
Intention gestellt werden. Dieser Abschnitt zielt darauf ab, eine Bilanz der Geschichte, den
Sinn des Ganzen gemeinsam mit dem Befragten zu erörtern und zu entwickeln“
(LAMNEK, 1995).
Was die Form der Kommunikation betrifft, ist es nicht üblich, bei den narrativen
Interviews ein telefonisches Gespräch durchzuführen (ATTESLANDER, 2010). Trotz des
Nachteils, dass die Körpersprache dabei nicht aufgenommen wird, werden die Interviews
am Telefon durchgeführt. Anzumerken ist aber, dass eine Hinfahrt in die Forschungsregion
Zeit- und Geldaufwand verursacht, der im Rahmen der vorliegenden Masterarbeit nicht
gedeckt werden kann. Deswegen wird eine Fernbefragung mittels eines narrativen
qualitativen Interviews via Telefon durchgeführt. Im Rahmen dieser Arbeit kommunizieren
die befragte Person und der Interviewer per Telefon und nicht durch eine Videoaufnahme,
z.B, durch Skype, weil der Videoaufnahme in der Untersuchungsregion technisch
kompliziert oder kaum möglich ist. Aufgrund der Qualität des Internets in der
Forschungsregion wird die Möglichkeit einer Skype/Videokonferenz in Frage gestellt. Oft
ist der Empfang schwach und erlaubt, nur ohne Video zu sprechen. Das Telefon ist somit
die sicherste Art der Kommunikation. Gleichzeitig wird ein Diktiergerät benutzt. Die
Gespräche werden nach dem Einverständnis der interviewten Person auf Tonband
aufgenommen. Für das narrative Telefoninterview wird die befragte Person gebeten, über
die Beschäftigungssituation im Betrieb zu sprechen. Abschließend werden die Interviews
transkribiert und die Texte mit Hilfe der qualitativen Inhaltsanalyse nach Mayring
ausgewertet.
5.4. Die Inhaltsanalyse als Auswertungsmethode
Sobald die narrativen Interviews durchgeführt und die Aufnahmen transkribiert sind,
werden die daraus entstehenden Texte mit der Inhaltsanalyse ausgewertet. Die Methode
der qualitativen Inhaltsanalyse wird hier konsequent und schrittweise beschrieben.
61
Material und Methoden
Nach GLÄSER (2009) ist „die qualitative Inhaltsanalyse umso besser anwendbar, je
genauer man weiß, wonach man sucht“. MAYRING (1997) differenziert drei Grundformen
des Interpretierens: Zusammenfassung, Explikation, Strukturierung. Grundsätzlich sind die
Grundformen noch weiter differenzierbar, möglich sind auch verschiedene Mischformen.
Zuerst wird das Material der Interviews bzw. Interviewteile zusammengefasst und
nachfolgend Zeile für Zeile expliziert und strukturiert. Diese Schritte werden in russischer
Sprache gemacht, weil alle Interviews in russischer Sprache geführt werden. Abschließend
werden für das Forschungsthema relevante Textteile zusammengefasst und in die deutsche
Sprache übersetzt.
Die Zusammenfassung ist die qualitative Technik, mit welcher das Material zu
transformieren ist. Sie bereitet den Text für eine weitere Analyse vor. „Die
Zusammenfassung wird immer abstrakter“ (MAYRING, 1997). Die analysierten Texte
oder Analyseeinheiten werden in eine knappe und beschränkte Form paraphrasiert. Als
eine Analyseeinheit dient eine Textpassage, welche von einem kleinen Thema handelt.
Um zu verdeutlichen, was eine Analyseeinheit ist, wird hier ein Beispiel angeführt:
«Мы освоили определенный фольклорный класс и могли исполнять русские народные
песни под баян, бубен и балалайку, это определенная песенная традиция, у нас
появился свой кукольный театр, мы стали проводить ээ мм анимацию еще с
куклами, у нас появились свои ростовые куклы, каждая программа наша проходит
еще в форме мастер класса, то есть мы еще проводим по развитию ремесла, ну
традиционные мастер-классы, какую-нибудь куклу из льна и бересты или
расписываем там яйца по технологии, которой уже три тысячи лет…» / Wir haben
ein bestimmtes musikalisches Niveau gemeistert und konnten schon Volkslieder mit
verschiedenen Musikinstrumenten wie Akkordeon, Schellentrommel und Balalaika gut
begleiten. Sehr traditionelle Lieder eben. Als unser Puppentheater das Licht der Welt
erblickt hat, haben wir auch eine Animation mit Puppen für die Touristen gemacht, unsere
Maskottchen haben wir bekommen. Jedes unserer Programme dient dazu, den Touristen
etwas durch praktische Anwendung (Meisterklassen) zu lehren. Das Fertigen einer Puppe
aus Birkenrinde und Flachs oder wir malen nach einer dreitausendjährigen Technologie
Eier an.“
Der Abschnitt wird wie folgend verstanden, paraphrasiert und in kurzer Form
wiedergegeben:
62
Material und Methoden
Die Programme für Touristen haben in Abhängigkeit von den Wünschen der Touristen und
nach
Absprache
mit
dem
Reiseveranstalter
einige
Variationen.
Der
Unterhaltungsprogramminhalt beeinflusst natürlich die Form der Beschäftigung, Art der
Tätigkeit und die Zahl der beschäftigten Personen. Inhaltlich wechseln die Programme je
nach Thema, wie zum Beispiel Meisterklassen für Brotbacken oder das Herstellen von
Volks-Spielzeug, ab. Die Gruppe singt und spielt Musikinstrumente, es gibt ein
Puppentheater.
Im weiteren Verlauf werden die Paraphrasen verallgemeinert bzw. generalisiert. Für die
Klärung von Generalisierungen werden vor allem folgende Strategien angewendet
(DEPPERMANN, 2008):

Systematische Metaphern/Wortvergleiche im Text, zum Beispiel: у нас появился свой
кукольный театр, мы стали проводить мм анимацию еще с куклами, у нас
появились свои ростовые куклы / Als unser Puppentheater das Licht der Welt erblickt
hat, haben wir auch eine Animation mit Puppen für die Touristen gemacht, unsere
Maskottchen haben wir bekommen. Die Begriffe „Puppentheater“, „Animation mit
Puppen“ und der Spezialbegriff „Maskottchen“ wird als Puppentheater für die
Auswertung bezeichnet.

Darstellung von Merkmalen der Gesprächssituationen, beispielsweise ein Interviewter mit seinem Enthusiasmus war Ljoscha Stoljarov der Erste mit der Bitte in einem
Interview über die Beschäftigungssituation in seinem Unternehmen sprechen zu dürfen.
Er sprach schnell, konsequent und begeistert. Seinen Atem hat nichts aus dem Takt
gebracht und nicht einmal die Hintergrundgeräusche – Kinderstimme auf der
Aufnahme – haben seine Aufmerksamkeit abgelenkt.

Theoretische und (konstrukt)-logische Argumentationen, zum Beispiel weist Ljoscha
in den Zeilen sechs bis elf des Transkripts darauf hin, dass die Idee des touristischen
Business mit befreundeten Nachbarn im Dorf geboren worden sei, wo zuerst eine
Datscha gekauft wurde. Hier braucht vermutlich der Leser einen Bezug, was eine
Datscha sein soll. Eine Datscha zu haben ist in Russland sehr typisch. Rund 80% der
Bevölkerung (Expertenschätzung) aus den Städten haben ein Ferienhaus „in the
country“/ „out of the town“, wo sie ihre Wochenenden oder Ferien verbringen, grillen,
vielleicht ein wenig Obst und Gemüse anbauen oder einen Garten pflegen.
63
Material und Methoden
Wie aus dem Beispiel ersichtlich ist, „manchmal müssen Zusatzdaten zur Stützung und
Prüfung herangezogen werden“ (DEPPERMANN, 2008).
Mayring
unterscheidet
im
Rahmen
seiner
Inhaltsanalyse
drei
qualitative
Interpetationstechniken: die Zusammenfassung, die Explikation und die Strukturierung.
Das Ziel der Analysetechnik Zusammenfassung ist durch eine Schrittweise Verdichtung
des Materials auf seine wesentlichen Inhalte, ein überschaubares Abbild des
Ausgangsmaterials zu schaffen“ (KAUNE, 2010). „Es geht um eine Zusammenfassung
eines Textes, die aus dem in den Texten enthaltenen Sinn in so genannten Kategorien
darstellt. Dabei sind die Kategorien ihrerseits in einem System organisiert. Das
Kategoriensystem
mit
Kategorien,
Unterkategorien,
Kategoriendefinitionen
und
Ankerbeispielen stellt den in den ausgewerteten Texten enthaltenen latenten Sinn dar… Es
dient als Ausgangspunkt für die Interpretation des Textes und ist ein Herzstuck der
Analyse“ (RAMSENTHALER, 2013). Oft, über das Material verstreute Paraphrasen
werden zusammengefasst und durch eine neue Aussage wiedergegeben“ (MAYRING,
1997)
Durch
den
Paraphrasierungsprozess
entstehen
inhaltsgleiche
Einheiten
(Paraphrasen). Sich wiederholende, sowie unwichtige und nichtssagende Paraphrasen
werden weggelassen. Nach dieser Materialreduktion wird überprüft, ob der verbleibende
Teil das Ausgangsmaterial ausreichend repräsentiert. Ist eine weitere Abstraktion
notwendig, wird der Text erneut zusammengefasst (reduziert) (MAYRING, 1997).
Im Gegensatz zur zusammenfassenden Inhaltsanalyse, deren Ziel grundsätzlich die
Reduktion des Materials ist, wird in der Explikation zusätzliches Material zu
„interpretationsbedürftigen Textteilen“ herangetragen. Der Hauptgedanke der Explikation
als „qualitative inhaltsanalytische Technik“ ist, Textstellen zu erläutern und verständlicher
zu machen.
„Am Anfang der Explikation steht die genaue Definition der Textstelle, die expliziert
werden soll. Sie stellt die Auswertungseinheit dar… Im zweiten Schritt wird überprüft, ob
aufgrund der lexikalischen Bedeutung die Textstelle erklärbar ist.“ Anzumerken ist, dass
die Auswahl des zusätzlichen Materials die Güte der Explikation beeinflusst. Eine
allgemeine … Definition bedeutender Textteile ist ebenso für die Inhaltsanalyse wichtig“
(DEPPERMANN, 2008). Auf den Kontext wird im Folgenden eingegangen. Aufgrund der
Kontextanalyse wird eine Formulierung zusammengestellt, die „eine Aufschlüsselung, eine
Interpretation der Textstelle leistet.“ Je nach der Möglichkeit, den Kontext zu erfassen,
64
Material und Methoden
werden nach kleinraumtextologischen und großraumtextologischen Techniken oder nach
enger und weiter Kontextanalyse unterschieden. Der Interpret geht normalerweise vom
„engsten Kontext zum immer weiteren Umfeld“. Bei der engen Kontextanalyse werden die
Textteile in direktem Bezug erklärt, ausgeschmückt und modifiziert. In der weiteren
Kontextanalyse wird auch Material gesammelt, welches „über den eigentlichen Text
hinausgeht“ (MAYRING, 1997). Hier werden die Informationen über den Interviewer, die
Entstehungsbedingungen des Textes, sowie theoretisches Vorverständnis herangezogen.
Auch freie Assoziationen der Interpreten sind in der Kontextanalyse relevant, wobei „der
Bezug zur Textstelle genau begründet werden“ (MAYRING, 1997) muss.
Ein weiterer Schritt in der Kontextanalyse ist, fragliche Textteile durch eine neue
Formulierung sowie Paraphrasen zu erläutern. Im Gesamtzusammenhang wird dann
überprüft, ob der Text sinnvoll expliziert wurde oder ob ein neuer Durchgang notwendig
ist (vgl. MAYRING, 1997).
Strukturierung ist die „zentralste Inhaltsanalysetechnik“ (MAYRING, 1997). Hier werden
Textbestandteile nach einem bestimmten Kategorisierungssystem strukturiert. Die Technik
der Strukturierung dient dazu, die bestimmet Struktur aus dem Material herauszufiltern,
welche in Form eines Kategoriensystems an das Material herangetragen wird. KRAUNE
Der transkribierte Text wird dann aus dem Material systematisch extrahiert. Welche
Materialbestandteile unter die angesprochenen Kategorien fallen, wird in folgenden drei
Schritten definiert:
1.
Definition der Kategorien
Hier richtet sich eine Kategorie nach dem theoretischen Modell.Die dort beschriebene
Einflussfaktoren dienen als entsprechende Kategorien für die Auswertung. Beispielsweise,
sollte der Erzähler über Saisonalität sprechen, dann wird diese unter die Kategorie
„Erreichbarkeit“ fallen, weil im theorethischen Modell sowohl die Saisonalität als auch die
Wetterbedingungen die Erreichbarkeit beeinflusst. Hier sind die Kategorien vorgestellt:
 Arbeitsmarktlage inklusive Ausbildung
 Soziale Einflüsse
 Erreichbarkeit
 Umfeldsituation
 Tourismus- und Regionalentwicklungsstrategien
65
Material und Methoden
 Politik und Rechtsvorschriften
 Wirtschaftslage
2.
Ankerbeispiele
In der folgenden Übersicht werden Textbeispiele für jede Kategorie vorgegeben.
Übersicht 3: Kategorien für die Auswertung und Beispiele aus transkribierten Texten
Kategorie
Textbeispiele
«И еще один проект тоже связанный с туристическими нашими делами, это
центр ремесел Славич, это московский дом ремесел на кропоткинской, где
работает порядка 15 мастеров и вот я там как бы «щас» администрирую
этот центр» / „und noch ein Projekt ist mit unseren touristischen
Angelegenheiten verbunden. Das Zentrum für Gewerbe in Slavitsch, ein Moskauer
Arbeitsmarktlage
Zentrum für Gewerbe neben der Station Kropotkinskaja. Dort sind rund 15 Meister
inklusive Ausbildung
beschäftigt, nun bin ich im Zentrum administrativ tätig“.
Потому что на группу сорок человек в среднем нужно человека четыре всего
народу чтобы эту группу вести. В программе, если человек двести, то нужно
уже десять человек» / für ein Gruppe bestehend aus 40 Personen brauchen wir
üblicherweise vier Personen für die ganze Führung. Bei einem Programm mit 200
Personen brauchen wir schon 10 Personen für die Programmbegleitung.
«относится к сотым людям как к первым, что очень сложно, но нужно
Soziale Einflüsse
делать именно так» / "dass man sich bei der hundertsten Person genauso
verhalten soll wie bei der ersten. Auch wenn es schwierig ist, sollte man es tun."
«200 человек, это немного, но для Кашина много даже это. Вот приняли
двести, хотя должно было быть 400, из за аномалий в погоде половина людей
отказалась ехать и туроператоры сняли свою бронь в программе. 400
человек в принципе это уже неплохая цифра для масленичной программы» /
Erreichbarkeit
200 Menschen sind nicht viel, aber für Kaschin ist auch das schon viel. Wir haben
200 aufgenommen, sollten aber 400 aufnehmen, alles wegen den anomalen
Wetterveränderungen, die Hälfte der Leute haben ihre Reise abgesagt und der
Reiseveranstalter hat seine Reservierungen für das Programm zurückgezogen. 400
ist grundsätzlich schon eine gute Zahl für das Maslenitsa-Fest".
Umfeldsituation
сейчас у нас есть еще небольшая полянка, на которой у нас летом
помещаются детские и взрослые лагеря /zurzeit haben wir auch einen
66
Material und Methoden
Kategorie
Textbeispiele
Campingplatz
freigemacht,
welchen
wir
im
Sommer
als
Kinder-
und
Erwachsenenlager anbieten können
«потому что до этого это было такое провальное направление, а щас
губернатор тверской области требует развивать туризм.. Требует
развивать интерактивные площадки, еще что-то делать» / weil es zuvor so
eine katastrophale Richtung war, und jetzt fordert der Gouverneur von Tver den
Tourismus zu entwickeln... Er fordert interaktive Plattformen, noch mehr tun..."
«мы и сами получили от этого результат, просто потому что мы завязали
новые контакты, новых партнеров нашли, людей, которые хотят ездить в
Кашин и возить сюда туристов, да, но и плюс администрация закрыла у себя
брешь, то есть Кашин на фоне тверской области выглядел действительно
Tourismus- und
лучше в этот раз, то есть мы выглядели не хуже области, а то и лучше
Regionalentwicklungs-
области». / wir haben also selbst auch davon profitiert [von der Messe], einfach
strategien
deswegen, weil wir neue Kontakte geknüpft haben, neue Geschäftspartner gefunden
haben - Leute, die daran interessiert sind Touristen nach Kaschin zu bringen, und
ja, weiters hat die Verwaltung ihre Lücken im Regionalentwicklungsprogramm
aufgefüllt, also die Region Kaschin war diesmal im Gebiet Tver tatsächlich besser,
also wir sahen diesmal nicht schlechter aus als der Gebietsdurchschnitt, aber
vielleicht sogar besser„.
«Сейчас мы делаем для тверской области большой проект на два города,
золотое сердце России он называется, это Кашин-Бежецк» /“jetzt machen wir
für die Gebiete ein großes gemeinsames Projekt auf zwei Städte bezogen, goldenes
Herz Russlands heißt es, Kashin-Bezhetsk“
«офисом даже в Москве…ну по крайней мере неким клубом, через который
Politik und
можно набирать тоже людей.., фактически через него мы сейчас будем
Rechtsvorschriften
набирать группу в Кашин»)/ein Büro in Moskau…na wenigstens das ist so ein
Kulturverein, wo wir auch neue Gäste anziehen können..,
«Средства непонятно где» / “Es ist noch unklar, woher die Mittel dafür kommen
sollen“.
Wirtschaftslage
«в музей к Наталье Васильевне гостей сейчас возим только мы, только мы и
Кашинский курорт, то есть два, две организации которые вообще кого либо
приводят» / "ins Museum, zu Natalja Vasilevna bringen nur wir die Touristen und
das Sanatorium von Kurort Kashin. Es sind also nur die zwei Organisationen, die
67
Material und Methoden
Kategorie
Textbeispiele
überhaupt jemanden bringen“.
(Quelle: eigene Darstellung, 2014)
3.
Kodierregeln werden als einen theoretischer Punkt hier zwar angedeutet, aber in der
Arbeit wird keine inhaltsanalytische Software verwendet. Alle Überlegungen sind
analytisch „manuell“ d.h. ohne Software ausgewertet. Das bedeuten auch, dass zur
Abgrenzung zwischen Kategorien die logischen Regeln für die eindeutige Zuordnung
benutzt werden.
Die Beschreibung der grundlegenden, strukturierenden Inhaltsanalyse wird in Abbildung
10 dargestellt. Es geht darum, „die Kategorien überhaupt zu greifen“ und „eine eindeutige
Zuordnung anhand der Definitionen, Ankerbeispiele und Kodierregeln“ zu ermöglichen
(Mayring, 2010). Für diesen Prozess werden zwei Schritte unterschieden. Zuerst werden
sogenannte „Fundstellen“ bezeichnet – die Textstellen im Material, wo die Kategorien,
z.B. durch eine Unterstreichung mit verschiedenen Farben, angesprochen werden. Im
zweiten Schritt werden solche angesprochenen Textteile herausgeschrieben und je nach
Strukturierungsziel bearbeitet. „In aller Regel ergibt dieser Probedurchlauf eine
Überarbeitung, eine teilweise Neufassung vom Kategoriensystem und seinen Definitionen“
(MAYRING, 2010). Schließlich werden die Fundstellen bearbeitet und extrahiert. Unter
anderen wird berücksichtigt, dass Äußerungen keine isolierten Sätze sind und im Zuge des
Interaktionsprozess betrachten werden. „Zu Rekonstruktion von Äußerungen ist es fast
immer
notwendig,
ien
vergangenen
Interaktionsverlauf
zu
berücksichtigen“
(DEPPERMANN, 2008)
68
Material und Methoden
Abbildung 10: Ablaufmodell der strukturierenden Inhaltsanalyse (allgemein) (Quelle: Mayring,1997)
Für die vorliegende Arbeit sieht das Ablaufmodell der strukturierenden Inhaltsanalyse wie
folgend aus:
69
Material und Methoden
1. Schritt
Bestimmung von Teilen der Transkripte für die
Analyse
2. Schritt
Festlegung der Strukturierungsdimension
(Modellgeleitend)
3. Schritt
Bestimmung der Ausprägungen unter den Kategorien
4. Schritt
7. Schritt
Überarbeitung.
gegebenenfalls Revision von
Kategoriensystem
Formulierung von Definitionen,
Ankerbeispielen zu den einzelnen Kategorien
5. Schritt
Transkriptdurchlauf, Fundstellen
6. Schritt
Materialdurchlauf, Bearbeitung und Extraktion der
Fundstellen
8. Schritt
Ergebnissaufbereitung
Abbildung 11: Ablaufmodell der strukturierenden Inhaltsanalyse anhand des Analysematerials (Quelle:
eigene Darstellung nach Mayring, 2014)
Die vier Formen der strukturierenden Inhaltsanalyse unterscheiden sich zielabhängig.
Diese sind formale, inhaltliche, typisierende und skalierende Strukturierungstechniken.
70
Material und Methoden
Unter formaler Strukturierung werden vier Kriterien vorausgesetzt: syntaktisches,
thematisches, semantisches und dialogisches. Eine inhaltliche Strukturierung lässt
„bestimmte
Themen,
Inhalte,
Aspekte
aus
dem
Material
herausfinden
und
zusammenfassen“. Insbesondere für die Forschungsfrage bedeutende Textteile zu finden
und diese genauer zu beschreiben, hilft die sogenannte typisierende Strukturierung. Es
wird bestimmt, welche Redewendungen aus dem Material als besondere oder als typische
dienen. Anschließend kommt die skalierende Strukturierung, welche, wie es im Namen
bereits angedeutet wird, bestimmte „Materialteile auf einer Skala (in der Regel
Ordinalskala) bringt“ (MAYRING, 1997). Zum Beispiel, die Erreichbarkeit kann von nicht
erreichbaren Orten zu saisonabhängig erreichbaren Orten, bis immer gut erreichbaren
Orten, skaliert werden.
Jetzt gilt es zu überprüfen, ob eine Wirkung auch in der Realität besteht, oder ob diese
auch durch neue Angaben zu ergänzen ist. Aus den drei Einzelfallstudien wird
abschließend ein Bericht zusammengefasst, welcher die Ergebnisse der Arbeit darstellt.
Anhand der ausgearbeiteten Methode wird die Untersuchung in der Region Kaschin
durchgeführt und ausgewertet.
71
Untersuchungsregion Kashin
6. UNTERSUCHUNGSREGION KASHIN
Die Region Kaschin wurde als Untersuchungsgebiet deshalb ausgewählt, weil sie eine
Kurstadt ist und als Touristenziel in Russland überregional bekannt ist. Außerdem ist die
Region Kaschin aufgrund ihrer geographischen Lage und dem reichen kulturhistorischen
Hintergrund zur Beantwortung der vorliegenden Forschungsfrage herangezogen worden.
Sie befindet sich 200 km nördlich von Moskau, der größten Stadt Russlands, entfernt, hat
eine direkte Eisenbahnverbindung nach Sankt-Petersburg und ist über den Fluss Kaschinka
mit dem längsten und wasserreichsten Fluss Europas, der Wolga, verbunden. Es ist
interessant zu sehen, ob der Agrartourismus seine Potenziale sowie Auswirkungen auf die
Beschäftigung unter diesen günstigen Bedingungen gezeigt hat.
6.1. Geographische Lage der Region Kaschin
Die Untersuchungsregion Kaschin liegt nördlich von Moskau und ist eine kleine Provinz
im Osten des Gebiets Tver, an der Grenze zum Gebiet Jaroslawl. Vom Osten und Norden
grenzt die Region Kaschin an das restliche Gebiet Tver. Tver gehört zum zentralen
föderalen Distrikt, wo es 17 der 122 Objekte ökologischer Ausbildung und touristischer
Tätigkeit (эколого-просветительской и туристической деятельности) gibt. Darunter
werden beispielsweise Naturparks, Museen verstanden. Die 17 Objekte haben im Jahr
2013 über 86 Tsd. Personen besichtigt (UnSiS, 2014).
Auf der folgenden Karte ist das Gebiet Tver mit der Region Kaschin dargestellt. Um dem
Leser die Dimensionen näher zu bringen, wird ein Vergleich dargestellt: Die Fläche der
Region Tver ist circa so groß wie Ungarn. Die Region Kaschin ist rot markiert.
72
Untersuchungsregion Kashin
Abbildung 12: Karte des Gebiets Tver (Quelle: Karte, 2013 UnSiS)
Die folgende Karte (Abbildung 13) stellt einen Bezug zur regionalen Entwicklung der
ländlichen Räume in Russland her. Auf der Karte sind Typen von ländlichen Räumen in
Russland unterschieden. Das Gebiet Tver befindet sich in einer Zone, die sehr ungünstig
für die
ländliche
Entwicklung ist.
Dennoch
sind
die
Bedingungen
für
die
Untersuchungsregion Kaschin verhältnismäßig günstig, da die Region Kaschin an der
Grenze bzw. nah zum Moskauer Gebiet liegt.
73
Untersuchungsregion Kashin
Abbildung 13: Rural Development Challenges of Russian Regions and Present Policy Solutions (Quelle:
Alexandre Merzlov, Vortrag an der Herbstakademie, Stuttgart 2012)
Die Region befindet sich im 200 km Radius um die Hauptstadt und ist in nur drei bis vier
Fahrstunden von Moskau erreichbar. Drei bis vier Stunden und bis zu 250 km Entfernung
ist eine gute Erreichbarkeit für russische Verhältnisse. Weiters liegt die Region zwischen
den zwei größten Städten Russlands: Moskau und Sankt-Petersburg. Die erste
Eisenbahnstrecke in Russland zwischen Moskau und Sankt-Petersburg wurde im 19.
Jahrhundert erbaut und verlief durch Kaschin. Es gibt heutzutage eine direkte
Zugverbindung zwischen Kaschin und Sankt-Petersburg. Die Fahrt mit einem Nachtzug
dauert 12 Stunden. Zwischen Moskau und Kaschin gibt es auch eine Eisenbahnverbindung,
die leider im Vergleich zur Busverbindung zu lange dauert, sieben Stunden gegen vier.
Zusammengefasst ist die Region Kaschin reich an Natur und Kultur, liegt aber an der
Grenze der Gebiete mit günstigen Entwicklungsbedingungen und guter Erreichbarkeit.
74
Untersuchungsregion Kashin
Da der Agrartourismus auf zwei Disziplinen, auf den Tourismus und auf
die
Landwirtschaft, stützt, wird anschließend auf Daten aus den beiden Wirtschaftsbereichen
der Region Kaschin näher eingegangen.
6.2. Landwirtschaft in der Region Kaschin
In diesem Abschnitt werden Informationen präsentiert, welche die Landwirtschaft in der
Region Kaschin charakterisieren. Die Landwirtschaft in der Region wird vor allem durch
Großunternehmen betrieben. Die Größe der Betriebe variiert von 2000 bis 6000 Hektar.
Solche Betriebe werden ab und zu besichtigt (Interessierte wie z.B. ausländische
Delegationen oder Landwirtschaftsorganisationen,, aber sind eher leistungsorientiert und
interessieren sich generell nicht für Urlaub am Bauernhof. Deshalb sind sie für den
ländlichen
Tourismus
von
keinem
großen
Interesse.
Diese
Großunternehmen/
landwirtschaftliche Unternehmen sind sich stetig entwickelnde Unternehmen, die durch
eine relativ konstante Anzahl von Mitarbeitern bedient und verwaltet werden. Nach der
Metodik des ROSSTATISTIKA gibt es in der Region auch bäuerliche Betriebe (Farmen)
(Крестьянские (фермерские) хозяйства) und Betriebe der Bevölkerung. Die Betriebe
der Bevölkerung produzieren überwiegend für den eigenen Bedarf (личных подсобных
хозяйств (ЛПХ). und der Landbevölkerung der Region sind derzeit nur wenige Haushalte
im ländlichen Tourismus engagiert.
Wie aus der Tabelle 2. ersichtlich, ist der Unterschied zwischen Flächen von privaten bzw.
kleinbetrieblichen Landwirtschaften und landwirtschaftlichen Unternehmen riesig. Über 41
Tsd. Hektar stehen der Landwirtschaft in der Region Kaschin zur Verfügung. Die meiste
Fläche ist im Eigentum von Großunternehmen, 40-mal weniger Fläche besitzen kleine
bäuerliche Betriebe und 100-mal weniger ist im Eigentum der Bevölkerung (личных
подсобных хозяйств (далее ЛПХ).
Die landwirtschaftlichen Großbetriebe/Unternehmen haben die meisten Flächen und die
kleinbäuerlichen Betriebe haben am wenigsten Land.
75
Untersuchungsregion Kashin
Tabelle 2: Fläche der Betriebe nach Unternehmensart und Eigentumsart in der Region Kaschin, ha
Art des Eigentums
Betriebe aller Kategorien
2012
2013
42131,8
41055,4
40561,8
39491,4
460,5
445,0
1109,5
1119,0
Aufgeteilt in:
Landwirtschaftliche Unternehmen
Betriebe der Bevölkerung für den
Eigenbedarf (ЛПХ)
Kleinbäuerliche Betriebe (КФХ)
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Diese Flächen sind wie folgend landwirtschaftlich genutzt. Große Betriebe haben vor allem
Getreide und Futterpflanzen angebaut. Tabelle 3. veranschaulicht die Verteilung. In der
Statistik sind vor allem die Daten aus den letzten Jahren, 2011-2013 ausführlich, aber nicht
ganz lückenfrei, angegeben. Überall, wo in den folgenden tabellen Daten fehlen, gibt es
Lücken in der Staistik.
76
Untersuchungsregion Kashin
Tabelle 3: Flächenverteilung in landwirtschaftlichen Unternehmen in der Region Kaschin im Zeitraum von
2008 bis 2013, ha
2008
2009
2010
2011
2012
2013
Fläche insgesamt
-
-
-
-
40561,8
39491,4
Aufgeteilt in:
-
-
-
-
-
-
Getreide und Hülsenfrüchte
8383
-
9050
7892
9069
9412
Winterweizen
-
-
-
-
820
946
Winterroggen
-
-
-
-
527
297
Tritikale
-
-
-
-
35
Sommerweizen
-
-
-
-
2018
2061
Hafer
-
-
-
-
5549
5951
Kartoffeln
552,5
527,8
537,8
522
521,7
474,3
Gemüse ohne Verpflanzung
-
-
-
-
16,1
39,1
Kohl
-
-
-
-
0,3
-
Gurken
-
-
-
-
0,2
-
Rote Rüben
-
-
-
-
5,2
-
Karotten
-
-
-
-
10,3
-
Zwiebel
-
-
-
-
0,1
-
Freilandgemüse
19,95
14,1
13,59
16,3
Futterpflanzen
-
-
-
-
30735
29426
Einjährige Futterpflanzen
-
-
-
-
3276
3278
Mehrjährige Futterpflanzen
-
-
-
-
1061
1221
-
-
-
Obst und Beeren
2,9
-
-
--
-
-
- keine Angaben in der Statistik
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
77
Untersuchungsregion Kashin
Die bäuerlichen Betriebe haben folgende Flächenverteilung: Getreide und Hülsenfrüchte,
gefolgt von Sommerweizen, Futterpflanzen und Kartoffeln, wie die Tabelle 4. zeigt.
Tabelle 4: Bäuerliche Betriebe (Farmen) und deren Flächenverteilung 2008-2013, ha
2008
Fläche insgesamt
2009
2010
2011
2012
2013
-
-
-
-
1109,5
1119
548
-
585
647
537
585
Winterweizen
-
-
-
-
-
40
Winterroggen
-
-
-
-
40
-
Sommerweizen
-
-
-
-
275
360
Hafer
-
-
-
-
222
185
102
135
159
161
161
125
Gemüse ohne Verpflanzung
-
-
-
-
50,5
64
Futterpflanzen
-
-
-
-
361
345
Getreide und Hülsenfrüchte
Kartoffeln
- keine Angaben in der Statistik
(Quelle: CSDB des GKS, eigene Darstellung, 2014)
In den Betrieben für den Eigenbedarf der Bevölkerung (ЛПХ) werden vor allem Kartoffeln
und anderes Gemüse angebaut. Tabelle 5 veranschaulicht diese Flächenverteilung.
Tabelle 5: Flächenverteilung in den Betrieben der Bevölkerung 2008-2013, ha
2008
2009
2010
2011
2012
2013
-
-
-
-
460,54
445
Getreide und Hülsenfrüchte
1,5
-
1,4
1,4
1,4
1,1
Kartoffeln
370
370
370
370
370
359
-
-
-
-
69,64
65,9
Freilandgemüse
70
70
70,9
71
-
-
Obst und Beeren
42
-
-
-
-
-
Fläche insgesamt
Gemüse ohne Verpflanzung
- keine Angaben in der Statistik
78
Untersuchungsregion Kashin
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Informationen über Tierbestände in allen Eigentumskategorien sind in der folgenden
Tabelle dargestellt. Betriebe der Bevölkerung verfügen über ein Drittel der Rind- sowie ein
Viertel der Schaf- und Ziegenbestände. Bemerkenswert ist, dass das gesamte Geflügel den
Bevölkerungsbetrieben gehört.
Tabelle 6: Gesamttierbestand in Betrieben aller Kategorien 2008-2012, Stück/Tierkopf
2008
Rinder
2009
2010
2011
2012
10047
10272
10610
10342
10301
Milchkühe
4712
4469
4393
4336
4417
Schweine
1054
1019
1124
970
162
-
-
11796
10153
10210
1602
1562
1640
1543
1526
Kaninchen
-
1380
1138
1970
1814
Bienenvölker
-
1874
1787
2147
1911
2333
2775
2785
3150
2671
Geflügel
Pferde
Schafe und Ziegen
- keine Angaben in der Statistik
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Um dem Leser einen weiteren Vergleich zu ermöglichen, werden alle landwirtschaftlichen
Erzeugnisse nach Unternehmensart in vergleichbaren Preisen präsentiert.
79
Untersuchungsregion Kashin
Tabelle 7: Landwirtschaftliches Produktionsvolumen 2008-2012 in realen Preisen, umgerechnet in Euro
Eigentumsart
2008
Betriebe aller Kategorien
Landwirtschaftliche
2009
2010
2011
2012
14367,50
14745,58
14385,40
19469,76
15462,64
7157,58
7080,10
6394,94
9976,16
7812,18
6727,76
7053,28
7740,28
8241,90
6969,92
482,16
612,20
250,18
1251,70
680,54
Unternehmen
Betriebe der Bevölkerung
Bäuerliche Betriebe, Farmen
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Landwirtschaftliche Erzeugnisse unterteilen sich in tierische und pflanzliche. Die Grafiken
14 und 15 veranschaulichen diese Verteilung der Produktion. Aus beiden Grafiken wird
ersichtlich, dass für die private Produktion auch kleine Flächen für tierische Erzeugnisse
von großer Bedeutung sind. Großbetriebe haben meistens auch Tierbestände und erzeugen
sowohl pflanzliche als auch tierische landwirtschaftliche Produkte.
Produktionsvolumen in Euro
10000
8000
6000
4000
2000
0
2008
2009
Betriebe aller Kategorien
Betriebe der Bevölkerung
2010
2011
2012 Jahr
Landwirschaftliche Unternehmen
Bäuerliche Betriebe
Abbildung 14: Produktionsvolumen tierischer Erzeugnisse nach Unternehmensart, in Euro (Quelle:
Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
80
Produktionsvolumen in Euro
Untersuchungsregion Kashin
12000
10000
8000
6000
4000
2000
0
2008
2009
2010
2011
2012
Jahr
Betriebe aller Kategorien
Landwirschaftliche Unternehmen
Betriebe der Bevölkerung
Bäuerliche Betriebe
Abbildung 15: Produktionsvolumen pflanzlicher Erzeugnisse nach Unternehmensart, in Euro (Quelle:
Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Für das Produktionsvolumen der pflanzlichen Erzeugnisse spielen bäuerliche Betriebe fast
keine Rolle, denn sie produzieren vor allem billige Kartoffeln. Andererseits erzeugen
Betriebe der Bevölkerung mehr als die Hälfte des pflanzlichen Produktionsvolumens.
6.3. Tourismus der Region Kaschin
Die Schwierigkeit beim Bezug von Informationen der Tourismusstatistik besteht darin,
dass in der Region im Tourismus nur eine Firma arbeitet, die statistisch erfasst wird.
Wegen des Datenschutzes wurden auf Anfrage keine Daten zu Verfügung gestellt.
Ein Unternehmen gilt als Tourismusunternehmen, wenm der als in-coming Tourismus, outgoing Tourismus oder internationalem und nationalem Tourismus gemeldet ist. Ein
Unternehmen des in-coming Tourismus empfängt die Gäste in der Region, ein out-going
Tourismusunternehmen verkauft Reise, Reisepakete, Exkursionen in die anderen
touristischen Destinationen. Internationale Tourismusunternehmen beschäftigen sich
entweder mit in-coming oder out-going Touristenströmen.
81
Untersuchungsregion Kashin
Tabelle 8: Anzahl der Reiseveranstalter ohne Touragenten in Russland 2010-1013, Unternehmensanzahl
Russische
Föderation
insgesamt
Internationaler
In-coming und
outgoing
Tourismus,
Anzahl der
Unternehmen
Internationaler incoming –
Tourismus,
Anzahl der
Unternehmen
1858
2169
566
4718
1833
2885
656
2012
4685
1889
2796
580
2013
4608
2421
2187
225
Jahr
Anzahl der
Reiseveranstalter
in Russischer
Föderation,
insgesamt
In-coming
Tourismus,
Anzahl der
Unternehmen
2010
4593
2011
(Quelle: UniSiS 2014)
Darunter arbeiteten im Jahr 2013 im Gebiet Tver 105 Tourismusunternehmen: 86
Touragenten, 2 Reiseveranstalter, 4 Touragenten und Reiseveranstalter und 13 haben
Exkursionen veranstaltet, (UniSiS, 2014). Auf schriftliche Nachfrage bei GKS hat Herr
Nagornij bestätigt, dass Daten über den Agrartourismus nicht erforscht werden.
Zu den Tourismus Daten auf Gebietsebene in Tver, wie die Anzahl der Betriebe mit
Unterkünften, Bettenanzahl, Anzahl der Beschäftigten, Übernachtungen, hat man freien
Zugang in der Datenbank UniSIS. Für das Gebiet Tver sind folgende Daten der
Tourismusstatistik zu finden: Zimmeranzahl, Bettenanzahl. Ausgaben und Einnahmen,
Übernachtungen sowie Anzahl der Gäste in kollektiven Unterbringungseinrichtungen
(коллективные средства размещения (КСР)) (in der folgenden Tabelle und in den
Grafiken vereinfacht als Herbergen angegeben), Kurheimen und Sanatorien. Die Daten der
letzten fünf Jahre werden in Tabelle 9 vorgestellt und die zehnjährigen Entwicklungstrends
sind in grafischer Form dargestellt. Somit sind die Daten der lentzen fünf Jahre doppelt
präsentiert.
82
Untersuchungsregion Kashin
Tabelle 9: Tourismusstatistik des Gebiets Tver, 2008-2012
Kennzahl
2008
Zimmeranzahl in
Kurheimen und
Sanatorien
Bettenanzahl in
Kurheimen und
Sanatorien
Ausgaben der Kurheime
und Sanatorien
Einnahmen der
Kurheime und
Sanatorien
Übernachtungen in
Herbergen
Übernachtungen in
Kurheimen und
Sanatorien
Anzahl der Gäste in
Herbergen
Anzahl der Personen auf
Kur
2009
2010
2011
2012
2474
2622
2590
2374
1197
5672
5725
5508
5057
4865
721315,4
824506,4
795801,3
771307,9
764363,7
752423,1
679607,5
119148,8
248373,9
484430,7
2154377
2118207
2041495
1982346
1508082
907910
887966
803013
802252
749526
485992
450314
421500
394832
365880
72057
64725
63722
61318
51709
(Quelle: UniSiS, eigene Darstellung, 2014)
Aus der folgenden Grafik 16 wird ersichtlich, dass die Anzahl der Gäste in Herbergen seit
2008 kontinuierlich abgenommen hat. Nach der Erfolgssaison ist die Anzahl der Gäste um
35 Tsd. Personen im Jahr 2009 gesunken. Die Anzahl der Gäste in Hotels sank bis auf 36,5
Tsd. im Jahr 2012. Die Anzahl der Personen, welche auf Kur waren ist ebenso während des
Betrachtungszeitraums von über 75 Tsd. bis auf 51,7 Tsd. gesunken. Es gibt keine
Erklärung, warum die Gästezahlen zurückgegangen sind. Die Vermutung liegt aber nahe,
Anzahl der Gäste, 10 Tsd.
dass die Weltwirtschftskrise den Tourismus geschwächt hat.
60
50
40
30
20
10
0
2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012
Anzahl der Gäste in Herbergen
Anzahl der Personen auf Kur
83
Untersuchungsregion Kashin
Abbildung 16: Anzahl der Gäste in Herbergen und Kurbetrieben des Gebiets Tver,, 2002-2012 (Quelle:
UNISIS, eigene Darstellung, 2014)
Einen ähnlichen sinkenden Trend zeigen
die
Übernachtungszahlen in
beiden
Erholungseinrichtungen (Abbildung 17). Die Schwankung in den Übernachtungszahlen
2006 in Herbergen ist zu beobachten – weniger Leute kommen, dafür bleiben sie aber
Anzahl der Übernachtungen,
10 Tsd..
länger.
250
200
150
100
50
0
2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012
Übernahtungen Herbergen
Übernahtungen in Kurheimen und Sanatorien
Abbildung 17: Anzahl der Übernachtungen in Herbergen und in Kurbetrieben des Gebiets Tver, 2002-2012
(Quelle: UNISIS, eigene Darstellung, 2014)
Die Tourismusinfrastruktur der Region Kaschin wird für diese Arbeit auf der Basis der
Webseite der touristischen Firma Kaschingrad aus der Region Kaschin sowie des
Regionalentwicklungsprogramms der Region Tver für die Jahre 2013 bis 2020, das den
Entwicklungszustand touristischer Industrie darstellt, präsentiert. Die touristischen Ströme
in Zentralrussland sind noch gering. Die meist besuchten Gebiete sind um Moskau herum
und
gehören
zum
touristischen
Cluster
des
Goldenen
Rings.
Das
Tourismusebtwicklungsprogramm des Gebiets Tver gibt an, dass im Jahr 2011 rund 1,4
Mio. Personen das Gebiet besucht haben. Der folgende Screenshot auf Abbildung 18.
Veranschaulicht die Touristenverteilung in Zentralrussland.Das Gebiet Tver wird im roten
Kreis gezeigt.
84
Untersuchungsregion Kashin
Abbildung 18: Der Touristenströme in Zentralrussland
Tourismusentwicklungsprogramm für die Region Tver, 2011)
2011,
Tsd.
Personen
(Quelle:
Laut dem Entwicklungsprogramm im Gebiet Tver sind verschiedene Themenzonen
festgelegt, welche je nach dem Thema sich dem Programm anpassen sollten. Die Region
Kaschin ist zum Thema „Жемчужная нить“/ Perlenfaden eingeordnet. Weitere Zonen
und Karten werden im Anhang vorgestellt. Die Perlenfadenregion schließt Möglichkeiten
der kleinen Städte und der Weiten des Wolgagebiets ein. In der Region Kaschin ist unter
den potentiellen Tourismustypen kein Agrartourismus genannt. Für Kaschin haben
folgende Tourismuseinrichtungen Priorität: Kultur-, Freizeit- und Gesundheitstourismus
(культурно-познавательный, рекреационный, лечебно-оздоровительный туризм).
Kaschin ist für Mineralwasser und Heilerde (Уникальные по лечебным свойствам
Кашинские минеральные воды и лечебные грязи) bekannt.
Der Agrartourismus ist für die Region Tver zwar eine gute Perspektive aber keine Priorität,
obwohl „diese Tourismusform eine besondere soziale Bedeutung für die ländliche Räume
hat“ («агротуризм имеет особую социальную значимость для жителей сельской
местности) (TOURISMUSENTWICKLUNGSPROGRAMM, 2013). Das Programm
empfiehlt Unterstützungsprogramme für Unternehmer, Teilnahme an föderalen und
anderen non-profit Programmen in der Agrartourismussphäre (Beispiel naselo.ru),
Herausgabe eines Themenreiseführers auf Bauerhöfen des Gebiets Tver usw.: «в сфере
агротуризма:
стимулирование
жителей
сельской
местности
к
развитию
85
Untersuchungsregion Kashin
агротуризма, разработка мер поддержки предпринимателей в сфере агротуризма,
участие в федеральных и иных некоммерческих программах по развитию
агротуризма (пример: naselo.ru), издание тематического путеводителя по
агротуристским
фермам
Тверской
области
и
т.п.;“)
(TOURISMUSENTWICKLUNGSPROGRAMM, 2013).
Nach Angaben eines Monitorings für Tourismusentwicklung in dem Gebiet Tver gab es im
Jahr 2011 in der Tourismusindustrie der Region Tver 180 Unterbringungseinrichtungen
mit 18.430 Plätzen, darunter 64 Hotels, 101 Erholungsheime, 15 Kurbetriebe. Die
durchschnittliche
Auslastung
lag
bei
61%.
Unter
Berücksichtigung
der
Saisonschwankungen haben im Tourismus insgesamt 10,1 Tsd. Personen gearbeitet.
(TOURISMUSENTWICKLUNGSPROGRAMM, 2013).
Das Dienstleistungsvolumen (inklusive touristische Ausgaben für Unterbringung, Essen,
Exkursionen, Veranstaltungen, Souvenirs usw.) an Touristen im Gebiet Tver betrug im
Jahr 2011 nach Angaben der Experten des Entwicklungsprogramms 4,5 Mrd. Rubel (ca. 90
Mio.
Euro)
(TOURISMUSENTWICKLUNGSPROGRAMM,
2013).
Die
Tourismuskennzahlen veranschaulicht die Tabelle 10.
Tabelle 10: Tourismuskennzahlen des Gebiets Tver nach Angaben des Monitorings, 2011
Tourismuskennzahl
Anzahl der
Unterbringungseinrichtungen
Bettenanzahl
2005
2006
2007
2008
2009
2010
2011
145
148
158
165
170
173
180
17000
17082
17276
17680
18065
18280
18430
9,8
10
10,1
Beschäftigte im Tourismus*,
8,6
9,1
9,5
9,7
Tsd. Personen
 in Tourismusfirmen sowie in Unterbringungseinrichtungen tätige Personen
(Quelle: Tourismusentwicklungsprogramm für die Region Tver, 2011)
Eine Expertenbefragung im Rahmen des Monitorings berichtet, dass unter den Touristen
im Gebiet Tver der überwiegende Teil Russen waren. Der Ausländeranteil lag bei 3% das
entsprach rund 45 Tsd. Personen. Unter ausländischen Touristen ist das Gebiet Tver bei
Deutschen, Finnen und Franzosen beliebt.
86
Untersuchungsregion Kashin
Von den russischen Gästen, welche die Region 2011 besuchten, kommt der größte Anteil
aus Moskau und dem Moskauer Gebiet. Touristenströme aus Sankt-Petersburg machen
knapp über 35% aller Touristen aus.
In der Zone im Osten des Gebiets Tver , in einer Entfernung von 150 km von Moskau und
100 km von der Stadt Tver, befinden sich die Regionen Kimry, Kaljazin, Kaschin, welche
nahe der Wolga sind. “Die Nähe zu Moskau und die gute Transportverbindung MoskauDubna machen diese Richtung bei Moskauern beliebt“ /„Близость Москвы и хорошее
транспортное сообщение со столицей по трассе Москва – Дубна делают зону
популярной для москвичей., steht im Text des Tourismusentwicklungsprogramm
(TOURISMUSENTWICKLUNGSPROGRAMM,
2013).
Der
Tabelle
11
sind
pessimistische und optimistische Entwicklungsszenarien zu entnehmen.
Tabelle 11: Pessimistische und optimistische Erwartungen des Tourismusentwicklungsprogramms für das
Gebiet Tver für den Zeitraum 2012 -2020
2012, 2013, 2014
(Plan)
2011
(ist)
2015, 2016, 2017 (Plan)
2018, 2019, 2020 (Plan)
pessimistis
ches
Szenarium
optimistis
ches
Szenarium
pessimistis
ches
Szenarium
optimistis
ches
Szenarium
pessimistis
ches
Szenarium
optimistis
ches
Szenarium
Touristenanza
hl, Mio.
1,4
1,3
1,6
1,4
1,8
1,6
2
Anzahl
der
Beherbergungs
betrieben
180
183
188
188
195
191
207
18430
18750
19250
19120
19970
19460
21190
10,1
10,1
12,2
11
15,6
12,3
22,3
Bettenanzahl
in Hotels
Beschäftigte
im Tourismus,
Tsd. Personen
(Quelle: Tourismusentwicklungsprogramm für die Region Tver, 2011)
Das Tourismusentwicklungsprogramm ist allgemein für alle Regionen des Gebiets Tver.
Für die Regionen wurden zusätzliche Regionalprofile ausgearbeitet. Vor allem dient das
Profil dazu, die Objekte der Tourismusinfrastruktur darzustellen. An Gastronomiebetrieben
gibt es in Kaschin sechs Cafés, ein Kulturhaus, ein Nachtklub, ein privates und zwei
öffentliche Museen. In Kaschin gibt es einen Busbahnhof und eine Eisenbahnstation. Im
87
Untersuchungsregion Kashin
Herbst und Frühling werden landwirtschaftliche Märkte organisiert. Drei thematische
Exkursionen: Kaschin – Stadt des russischen Herzens («Кашин – город русского
сердца»), Legende längst vergangener Zeiten («Предания старины далекой»), SivkaBurka Veschtschij Kaurka (der Name stammt aus einer Legende über ein wahrsagendes
Pferd «Сивка-Бурка, вещий каурка»). Die erste Route, „Kaschin - Stadt des russischen
Herzens“, beinhaltet Besichtigungen der Altstadt, Kirchen, Klöster und Wasserquellen des
Kurorts Kaschin. Die zweite Route, „Legende längst vergangener Zeiten“, ist die erste
Route samt Besichtigung des Michail Kalinin Memorialmuseums. Die dritte Route SivkaBurka Veschtschij Kaurka ist die Route „Kaschin - Stadt des russischen Herzens“ mit
Besichtigung des Pferdebetriebs. Außerdem werden Tages- bis Wochenfahrten zu anderen
russischen Städten, sowie nach Minsk und Kiew organisiert. Fünf Betriebe bieten
saisonabhängig Angeln und Jagd in der Region Kaschin an. Acht große Events, vor allem
Volksfeste, dürften für Touristen interessant sein. Unter den touristischen Herbergen und
Campingplätzen
sind
der
Komplex
„Tetkovo“
und
der
Betrieb
Medveditsa
(Fallbeispielunternehmen in dieser Arbeit) genannt. Ein Objekt des Ökotourismus, der
Stausee Uglicheskoe an der Wolga (Акватория Углического водохранилища), bietet
Exkursionen auf Motorbooten an. Außerdem gibt es in der Stadt Kaschin ein Hotel und
einen Kurbetrieb mit Heilerde- und Mineralwasserbehandlungen. Ein Unternehmer stellt
Souvenirs für Touristen (Fotos, Magneten, DVDs mit Filmen über Kaschin) her.
Anzumerken ist, dass kleine Souvenirs auch von der Bevölkerung hergestellt
werden(TOURISMUSENTWICKLUNGSPROGRAMM, 2013).
Der Webseite der touristischen Firma „Kaschingrad“ sind digitale Karten der Region
(Stadt und Umgebung) zu entnehmen, wo der Besucher die Tourismusinfrastruktur
„einblenden“ kann. Der Seiteninhalt berichtet u.a. von Besonderheiten der Region Kaschin.
Die Stadt Kaschin liegt sehr zentral in der Untersuchungsregion Kaschin und ist
geographisch bekannt. Der Grund dafür ist auf Abbildung 19 des Stadtplans ersichtlich:
der Fluss Kaschinka verläuft in der Stadt herzförmig. In der Schlinge war ursprünglich die
Altstadt. Die Altstadt ist reich an kulturhistorischen Merkmalen, Abbildung 19.
88
Untersuchungsregion Kashin
Abbildung 19: Stadt Kaschin und deren Tourismusinfrastruktur (Quelle: Kaschingrad, 2014)
Auf der Abbildung 20 ist die Umgebung der Stadt Kaschin dargestellt.
Abbildung 20: Umgebung der Stadt Kaschin und Tourismusinfrastruktur (Quelle: Kaschingrad, 2014)
89
Untersuchungsregion Kashin
6.4. Beschäftigungsstatistik und Bevölkerungsstatistik
Daten der Beschäftigung, Arbeitslosigkeit und landwirtschaftlichen Produktion stammen,
wenn nicht über die Region Kaschin verfügbar, von der nächsthöheren Ebene – der Region
Tver, Zentralrussland, Russland. Die Daten der Arbeitslosigkeit, Beschäftigung und
ökonomischen Aktivitäten der russischen Bevölkerung für Kaschin werden zum Teil mit
jenen für die Region Tver, Zentralrussland und Gesamtrussland, verglichen. Im
vorliegenden Abschnitt werden frei zugängliche Daten für die Analyse benutzt.
Nach Angaben der ausgewählten Untersuchungen des ROSSTATISTIKA in der
Beschäftigung, lag die Arbeitslosigkeit im Gebiet Tver bei 9,1% im Jahr 2000 und bei
6,1% im Jahr 2011. Nach Angaben des ROSSTATISTIKA lag die Arbeitslosigkeit bei
1,2% im Jahr 2011. Die relativ große Differenz lässt sich durch verschieden angewandte
Metodiken erläutern, ausgewählten Untersuchungen haben vermutlich verdeckte
Arbeitslosigkeit mitbeücksichtigt. GKS gibt an, dass sich 5,4 Tsd. im Jahr 2000 und im
Jahr 2011 8,5 Tsd. Personen arbeitslos gemeldet haben. Die Anzahl der Arbeitslosen in der
Region
Tver
hat
sich
nach
Angaben
der
ausgewählten
Untersuchung
des
ROSSTATISTIKA seit 2000 fast halbiert und lag 2011 bei 44 Tsd. Personen. Davon sind
knapp über 25 Tsd. Männer. 35% aller Arbeitslosen haben das 30. Lebensjahr, 18.4% das
40. Lebensjahr, 22.3% das 50. Lebensjahr und 17.6% das 60. Lebensjahr noch nicht
erreicht. Knapp über 10% der Personen ohne Beschäftigung hatten 2012 einen
Hochschulabschluss, rund 25% einen Berufsschulabschluss, fast 26% eine Lehre, knapp
über 26% Matura und rund 11% einen Grundschulabschluss. Eine soziale Untersuchung im
Jahr 2011 zeigt, dass ein Arbeitsloser im Durchschnitt 7,4 Monate für die Jobsuche
braucht, 30.8% brauchen mehr als 12 Monate.
Die Anzahl der wirtschaftlich aktiven Bevölkerung (hier Erwerbspersonen und
Arbeitslose) in der Region Tver ist in zehn Jahre kontinuierlich von 750 Tsd. Menschen
auf 719 Tsd. im Jahr 2011 zurück gegangen (GKS, 2014). Der mögliche Grund dafür ist
ein Rückgang der Bevölkerung. Das Niveau der Erwerbsaktivität betrug 2000 somit 63,9%
und ist bis 2011 auf 68,6% gewachsen. Das Höhe der Erwerbsaktivität hat sich dem
Niveau in Zentralrussland von durchschnittlich 69,3% angenähert.
0,9% aller Erwerbstätigen sind unter 20 und 4.9% der Erwerbstätigen sind über 60 Jahre
alt. Knapp über 20% aller Beschäftigten hatten 2012 einen Hochschulabschluss, 32% einen
90
Untersuchungsregion Kashin
Berufsschulabschluss, fast 25% eine Lehre, knapp über 17% Matura und rund 5% einen
Grundschulabschluss.
Im Gebiet Tver haben in der Agrar- und Landwirtschaft im Jahr 2011 65.6 Tsd. und im
Jahr 2012 59,7 Tsd. Personen gearbeitet. In der Land- und Forstwirtschaft der Region
Kaschin waren während des Jahres 2013 zwischen 543 und 613 Personen tätig, was nach
Angaben der Statistik 10% aller in der Wirtschaft der Region Kaschin tätigen Personen
entspricht.
Tabelle 12: Anzahl der Beschäftigten in der Agrar- und Forstwirtschaft der Region Kaschin, 2009-2012
2009
2010
2011
2012
Januar-März
718
-
566
490
Januar -Juni
723
-
579
484
Januar -September
716
627
575
-
Januar -Dezember
713
623
566
-
- keine Angaben in der Statistik
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
6.1 Tsd. im Jahr 2010 und 7.1 Tsd. im Jahr 2011 haben im Gebiet Tver in Hotels und
Restaurants gearbeitet. In der Region Kaschin sind das bis zu 160 Personen im Jahr 2012.
Tabelle 13: Anzahl der Beschäftigten in Hotels und Restaurants in der Region Kaschin, 2009-2012
2009
2010
2011
2012
Januar-März
-
-
150
160
Januar -Juni
148
-
148
158
Januar -September
151
128
146
-
Januar -Dezember
146
132
147
-
- keine Angaben in der Statistik
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Der durchschnittliche nominale Monatslohn in der Agrar- und Forstwirtschaft lag nach
Angaben der GKS auf dem Niveau von 14.129, 4 Rubel oder 270 Euro, in Hotels und
Restaurants 16631,1 Rubel oder rund 326 Euro. Dies entspricht heutzutage der Hälfte des
durchschnittlichen Lohns in der Wirtschaft Russlands. In der Region Kaschin sind die
Löhne in der Agrar- und Forstwirtschaft in der Regel noch niedriger
91
Untersuchungsregion Kashin
Tabelle 14: Durchschnittlicher Lohn in der Agrar-, Forst- und Jagdwirtschaft in der Region Kaschin 20092013, Euro
2009
2010
2011
2012
2013
147,71
156,162
189,146
204,484
215,674
156,414
167,468
194,432
215,468
232,364
166,598
175,842
200,134
223,358
236,142
170,332
178,582
201,768
223,426
237,386
Januar-März
Januar -Juni
Januar -September
Januar -Dezember
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Tabelle 15: Durchschnittlicher Lohn in Hotels und Restaurants in der Region Kaschin 2009-2013, Euro
Januar-März
Januar -Juni
Januar -September
Januar -Dezember
2009
2010
2011
2012
2013
160,634
168,562
193,366
237,5
204,242
161,396
176,216
198,556
243,306
213,462
161,52
181,588
207,262
246,036
213,432
163,936
184,248
213,686
236,352
212,418
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014)
Die demographische Situation ist ein Indikator für die in der Region auftretenden Prozesse
des Bevölkerungsrückgangs. Es sei darauf hingewiesen, dass in den letzten 7 Jahren sich
die demographische Lage in der Region erheblich geändert hat. Aufgrund der Mortalität
und der Migration ist die Bevölkerung um rund zwei Tsd. Menschen zurückgegangen.
Siehe Tabelle 16.
92
Untersuchungsregion Kashin
Tabelle 16: Entwicklung der Wohnbevölkerung in der Region Kaschin,2006-2011, Personen
Veränderung
2006
2007
2008
2009
2010
2011
Einwohnerzahl
28142
27545
27117
26796
26429
25897
-2245
Stadt
16152
15796
15536
15297
15389
15107
-1045
Land
11990
11735
11605
11472
11040
10790
-1200
2011 zu 2006
(Quelle: Statistik Kaschin eigene Darstellung, 2012)
Die Region verliert im ländlichen Raum und in der Stadt an Bevölkerung. Der Tabelle 17
ist zu entnehmen, dass im Jahr 2011 in der Region insgesamt rund 2,3 Tsd. Personen
weniger im Vergleich zu 2006 wohnten.
Tabelle 17: Altersstruktur der Erwerbstätigen Personen in der Region Kaschin 2006-2010
2006
Jünger als 15 Jahre alt
2007
2008
2009
2010
3961
3857
3852
3831
3980
14
14
14,2
14,3
15
16404
16089
15762
15523
15120
Anteil, %
58,3
58,4
58,1
58
57,2
Älter als 65 Jahre alt
7777
7599
7503
7415
7329
Anteil, %
27,7
27,6
27,5
27,7
27,8
28142
27545
27117
26796
26429
Anteil, %
Erwerbsalter
Jahre alt
15-65
Summe
(Quelle: Statistik Kaschin eigene Darstellung, 2012)
Für die Region Kaschin ist folgende Information aus Statistikservice zu lesen. Von den 9.2
Tsd. Beschäftigten in der Region sind 6571 in Mittel- und Großbetrieben, 1657 in
öffentlichen Einrichtungen und 1055 in der Regionalverwaltung und in der Politik tätig. Im
Jahr 2013 waren von der arbeitenden Bevölkerung mehr als 920 Personen in der Bildung,
1115 in der medizinischen Versorgung, 237 im Handel, 824 in der Sozialversicherung,
über 365 in der Kommunikation tätig. 461 arbeiteten in der Gas- und Wasserversorgung
der Region. Daten über die jeweiligen Unternehmen sind von statistischen Stellen offiziell
nicht ausgewiesen.
93
Untersuchungsregion Kashin
Tabelle 18: Beschäftigungskennzahlen in der Region Kaschin 2006-2010
Kennwert
2006
Anteil der durchschnittlichen jährlichen
Zahl der erwerbstätigen Personen an der
Gesamtbevölkerung in %
Die Zahl
Personen
Zahl
der
Arbeitslosen.
der
wirtschaftlich
offiziell
2007
2008
2009
2010
48
48,5
47,2
47
46,6
12788
12788
12788
12788
12596
104
96
94
261
640
0,8
0,7
0,7
2
4,8
aktiven
registrierten
Arbeitslosenquote
(Quelle: Statistik Kaschin eigene Darstellung, 2012)
Nachdem die Untersuchungsregion Kaschin aus Sicht des Tourismus, der Landwirtschaft
und der Bevölkerung vorgestellt wurde, werden Beschäftigungseffekte des Agrartourismus
anhand von Fallbeispielen näher analysiert.
Die folgenden Fallbeispielunternehmen in der Untersuchungsregion sind keine
Familienbetriebe. Alle untersuchten Betriebe wurden zwischen 2006 und 2008 gegründet.
Alle drei Unternehmen betreiben unterschiedliche Arten des ländlichen Tourismus.
6.5. Fallbeispielunternehmen
Für die Untersuchung der Beschäftigungsituation im Agrartourismus standen folgende drei
Betriebe zur Verfügung.
6.5.1 Touristenlager Medveditsa (Туристическая база Медведица)
Seit dem Jahr 1999 werden hier von der Snajp GmbH Pferde der Baschkirischen Rasse
gezüchtet und Pferdemilch „Kumys“ hergestellt. Der Betrieb ist mit Abstand der größte
dieser Art in Russland und bietet zudem touristische Dienstleistungen. Der touristische
Komplex besteht aus mehreren Häusern am Ufer des Flusses Medveditsa, ist von einem
Kiefernwald umgeben und weit von lauten Autobahnen entfernt. Zur Zeit der Entstehung
kamen alle Mitarbeiter aus der nächsten städtischen Siedlung, Verchnjaja Troitsa (Верхняя
Троица). Sechs Personen arbeiten in den Ställen und neun Personen arbeiten in der
94
Untersuchungsregion Kashin
Freizeitzone. Dem Gespräch mit einer der Kontaktpersonen ist zu entnehmen, dass es sich
um ein stabiles Team handelt und derzeit keine zusätzlichen Mitarbeiter benötigt werden.
Abbildung 21:Touristische Siedlung Medveditsa (Quelle: Medveditsa, 2012)
6.5.2 Schar-Ptitsa (Жар-Птица)
Das zweite Beispiel entspricht nicht vollständig dem Begriff Agrartourismus, aber es fällt
unter die Definition des ländlichen Tourismus. Es werden nur Tagesaktivitäten für
Besucher angeboten. Es ist das kreative Kollektiv Schar-Ptitsa (Жар-Птица), bestehend
aus mehreren Haushalten, fünf aktiven Mitgliedern und deren Familien, die aus anderen
Teilen Russlands in die Region kamen. Der Verein stellt touristische Dienstleistungen,
Unterhaltung, Verkostung von Naturprodukten, traditionelles russisches Handwerk und
Spiele zur Verfügung. Sie sind bereit, Freiwillige einzuladen; kreative Menschen, welche
ein Handwerk beherrschen und die Natur lieben. Die Zahl der Siedler variiert je nach
Saison und beträgt ca. 15 Personen im Sommer und sieben Personen im Winter.
95
Untersuchungsregion Kashin
Abbildung 22: Maskottchenpuppen (Quelle: Schar-Ptitsa, 2014)
6.5.3 Tourismusbüro Schemtschuschina Kaschin
Das Tourismusbüro Schemtschuschina in Kaschin ist eine öffentliche Einrichtung, die sich
mit der Tourismusentwicklung beschäftigt. Es erteilt Touristen Informationen, gibt
Broschüren heraus und organisiert Exkursionen in der Region. Im Rahmen eines Projekts
veranstaltet das Büro Empfänge für Touristen am Wolgaufer.
Das dritte Fallbeispiel ist ein privater Unternehmer, Nikolaj, der mit dem Tourismusbüro
zusammenarbeitet und Touristen in seinem Haus im Dorf aufnimmt. Sein Haus besitzt
einen Pavillon mit Blick auf den Fluss. Neben seinen Haustieren hält er auch manchmal
Nutztiere.
Abbildung 23: Restaurierungsarbeiten im Kloster Klobukov in Kaschin (Quelle: das private Archiv von Vera
Alekseevna Nikonova, 2014)
96
Untersuchungsregion Kashin
Abbildung 24: Eröffnung des Denkmals der heiligen Patronin der Stadt Kaschin - Anna Kaschinskaja im Jahr
2009 (Quelle: das private Archiv von Vera Alekseevna Nikonova, 2014)
Alle drei Unternehmen betreiben Agrartourismus bzw. ländlicher Tourismus wie im
Kapitel Definitionen beschrieben.
97
Ergebnisse
6.
ERGEBNISSE
Alle drei Fallbeispiele des ländlichen Tourismus in der Region unterscheiden sich
hinsichtlich ihres Konzepts voneinander. Folgend wird auf die Faktoren eingegangen,
welche den Beschäftigungsgrad im Agrartourismus beeinflussen. Die Faktoren selbst
wurden
im
Modell
in
Kapitel
4
beschrieben.
Logische
Überlegungen
für
Beschäftigungseffekte wurden ebenso in Kapitel 4 beschrieben. Die interviewten Personen
sind nicht auf alle angenommenen Einflussfaktoren eingegangen. Viele haben folgende
Faktoren genannt: Saisonalität, Wetterbedingungen, Qualität der Straßen, Investoren,
Öffentlichkeitsarbeit, Tourismusperspektiven und das regionale Entwicklungsprogramm.
Die Form der Beschäftigung wurde ebenso angesprochen.
7.1. Durchgeführte Interviews
Zuerst wurden Interviews durchgeführt. Es stand von jedem Unternehmen jeweils eine
Ansprechperson zur Verfügung. Die Kontaktpersonen wurden per Email (Ljoscha
Stoljarov) oder Telefon gefragt, ob sie über ihre Unternehmen in einem Telefoninterview
zu sprechen bereit wären. Das Interview mit Ljoscha aus Schar-Ptitsa war informativ und
ausführlich. Ljoscha Stoljarov war als erster bereit, in einem Interview über sein
Unternehmen zu erzählen. Er sprach schnell, konsequent und begeistert. Seinen Atem hat
nichts aus dem Rythmus gebracht und nicht mal die Hintergrundgeräusche – Kinderstimme
auf der Aufnahme – haben seine Aufmerksamkeit gestört. Das Interview hat fast eine
Stunde gedauert.
Das zweite Interview dauerte viel kürzer, nur etwa 17 Minuten. Das Büro
„Schemtschuschina“ ist eine örtliche öffentliche Einrichtung, welche für den in-coming
Tourismus in der Region Kaschin und Umgebung zuständig ist. Das Büro leistet
Öffentlichkeitsarbeit für touristische Betriebe in der Region und ist selbst auch ein
Reiseveranstalter und Organisator von Events. Elena Konstantinovna hat über den Zustand
des ländlichen Tourismus in der Region gesprochen. Unter anderem hat sie über den
Pferdetourismus sowie über Ljoschas Betrieb gesprochen. Das Interview wurde zwei
Wochen nach der ersten telefonischen Anfrage durchgeführt. Elena Konstantinovna war
damals sehr beschäftigt und wollte sich auf das Interview vorbereiten. Sie sprach schnell
98
Ergebnisse
und sehr emotional, manchmal hat sie dabei auch gelacht. Das Gespräch war leider zu
kurz, um über alle Zusammenhänge des ländlichen Tourismus zu sprechen. Sie hatte
Verständnis für die Anfrage der Interviewerin, die agrartouristische Beschäftigung zu
erläutern, meinte aber, es wäre besser, mit Ljoscha Stoljarov zu sprechen, weil dieser
besser in die Materie vertieft sei. Das Büro hat eine unregelmäßige Zusammenarbeit mit
Herrn Aljonov, der ein Haus am Wolgaufer hat, in dem Gäste aufgenommen werden. Für
den ländlichen Raum hat das Büro auch ein Unterhaltungsprogramm ausgearbeitet. Das
Büro beschäftigt sich vor allem mit der folkloristischen Begleitung der touristischen
Besichtigungen. Sie bereiten sich zusammen mit dem Kulturhaus auf die verschiedenen
Unterhaltungsprogramme vor. Das Projekt ist aber viel zu klein, um darüber mehr sagen zu
können. Über Herrn Aljonov ist nichts Weiteres bekannt.
Das letzte der drei zuerst geplanten Gespräche hat mit Nikolaj Emeljanovitsch
stattgefunden. Der Interviewtermin hatte sich wie beim zweiten Fall zweimal verschoben.
Ein Grund dafür ist die hohe berufliche Belastung der interviewten Person. Zur Zeit
arbeitet Nikolaj Emeljanovitsch in der Stadtverwaltung in Kaschin. Er ist für die
Datenerhebung interessant, weil er einige Zeit in einem touristischen Betrieb tätig war.
Über diesen Betrieb hat er im Interview erzählt. Das Interview dauerte 52 Minuten und
brachte viele ausführliche Informationen über das Pferdemilchherstellungsprojekt.
Zusammengefasst sind dem Interview folgende Informationen zu entnehmen. Im Jahr 1997
startete die Forschungsarbeit für ein Pferdemilchprojekt. Ungefähr ein Jahr später wurde
die Snajp GmbH gegründet. Nikolaj Emeljanovitsch war von 2005 bis 2010 als
Geschäftsführer im diesem Betrieb tätig. Er sprach ziemlich genau über das
Geschäftsmodell. Über den touristischen Teil des Projektes, der zu einem selbständigen
Betrieb, dem „Touristenlager Medveditsa“ wurde, sprach er aber wenig. Dabei wurde klar,
dass der Tourismus nur ein kleiner Teil des Gesamtprojekts ist. Nikolaj sprach in seiner
Erzählung mehr über die Pferde, weil die Milchproduktion zuerst existierte, und erst später
die Bauernhäuser für die Touristen entstanden. Auch als er explizit über touristische
Tätigkeiten gefragt wurde, sprach er meist über die Pferdehaltung. Er erzählte sehr wenig
über den Tourismus, wie Exkursionen, Jagd oder Pferdeausritte. Der Tourismus wird als
zusätzliche Tätigkeit betrachtet und ist nicht als Massentourismus gedacht. Jedoch ist
folgendes gewiss: noch bevor ein kleines Dorf gebaut wurde, sind viele Jäger hier her
gekommen. Die Jagdwirtschaft hat 18000 ha landwirtschaftliche Fläche. Über das
99
Ergebnisse
Entstehen der touristischen Tätigkeit weist er darauf hin, dass es logisch war, hier auch
Tourismus zu betreiben. Die angenehmen Lebensbedingungen, die Möglichkeit, einen
Pferdmilchkurs anzubieten und die saubere Umwelt waren die wichtigsten Gründe dafür.
Zuerst war die Gegend für die Jäger attraktiv, aber schließlich wurde sie auch für Touristen
interessant. Aus dem Kontext ist erkennbar, dass die Attraktivität dank der Pferdehaltung
gestiegen ist. Besonders interessant scheint das Reiseziel für Touristen aus Moskau zu sein.
Fast die gesamte Nahrung wird in Eigenproduktion hergestellt. Es wird auch Kindern und
Erwachsenen angeboten, das Reiten zu erlernen. Dafür gibt es speziell ausgebildete Lehrer
im Betrieb.
Das Interview mit Nikolaj Emeljanovitsch war zwar lang, aber außer auf die
Personalanzahl - es arbeiten dort neun Personen - wurde auf die Tourismustätigkeit nicht
vertiefend eingegangen. Die zweite Person aus dem Betrieb „Medveditsa“ wurde von
Nikolaj Emeljanovitsch empfohlen bzw. zur Verfügung gestellt, da er selbst für ein zweites
Interview sowieso keine Zeit hatte. Julia ist Administrator bei „Medveditsa“ und kennt den
Betrieb seit seiner Entstehung. Im Interview mit Julia strebte man danach, die
Beschäftigungssituation genauer zu betrachten. In knapp einer viertel Stunde skizzierte sie
die Arbeitslage im Betrieb. So wurde das vierte Interview aufgenommen.
Nach drei geplanten Interviews und einem zusätzlichen Interview mit Tourismusbetrieben
aus der Region Kaschin und deren Auswertung wurde folgendes festgestellt: Entweder
spielt der Agrartourismus in der Region keine große Rolle in der Regionalwirtschaft, oder
es stehen zu wenige Informationen zu Verfügung. Um das Bild zu vervollständigen und die
Information von der Regionalentwicklungsseite zu bekommen, wurden noch zwei
zusätzliche
Interviews
durchgeführt.
Diese
zwei
weiteren
Interviews
waren
Experteninterviews mit Personen aus Kaschin und Tver. Die Expertenmeinungen lieferten
letztendlich mehr Information bezüglich des Zustands des Tourismus in der Region
Kaschin.
Die Expertin aus der Region Kaschin ist Elena Konstantinovna, die im Tourismusbüro
Schemtschuschina in Kaschin arbeitet. Sie und ihr Büro ist für die Tourismusentwicklung
in der Region Kaschin zuständig. Im ersten Interview, welches nur begrenzte
Informationen liefert konnte, war sie über die Beschäftigungssituation und die
Zusammenarbeit mit Herrn Aljonov gefragt worden. Dieses Interview war für sie nicht
leicht gewesen, weil der ländliche Tourismus nur ein kleines Projekt ist und in der Gegend
100
Ergebnisse
nicht viel los ist. Das zweite Interview war für sie einfacher zu geben. Sie hat viel
Information geliefert. Das Gespräch dauerte etwas über 26 Minuten, wobei die Interviewte
zuvor einige Unterlagen für das Gespräch vorbereitet und die Situation im Tourismus
skizziert hatte. Es ging um die Dokumente, die die Tourismusentwicklung steuern: das
Entwicklungsprogramm für Tourismus bis 2020 sowie Subprogramme und Gesetze. Die
Gesetzestexte
sind
frei
im
Web
zugänglich.
Den
Text
des
Tourismusentwicklungsprogramms für die Region Tver, Anhänge (Diagramme und eine
Karte der Region Tver mit geplanten Themenzonen) und einen touristischen Pass der
Region Kaschin hat das Büro zur Verfügung gestellt. Diese Informationen dienen als eine
wichtige Basis für die Präsentation der Region Kaschin im Kapitel 6.
Der Experte aus Tver ist Beamter im Ministerium für Wirtschaftsentwicklung. Er wirkte
skeptisch gegenüber dem Thema dieser Masterarbeit und empfahl, es zu wechseln. Es sei
kaum erfolgreich, meinte er, Agrartourismus in der Region Tver zu betreiben. Auch wenn
es in der Region Tver gute Beispiele für Agrartourismus, wie etwa eine italienische Farm,
„Fattoria del Sole“, gibt, bedeute es nicht, dass alle etwas damit verdienen könnten. In der
Moskauer Region sei die Entwicklung des ländlichen Tourismus möglich, aber in den
peripheren Gebieten, wie Kaschin, eher nicht, oder auf jeden Fall nicht in den nächsten
Jahrzehnten. Für ländlichen Tourismus sei Frankreich sehr interessant, sagte der Experte.
Die agrartouristische Beschäftigung in der Region Kaschin sei so unbedeutend, dass man
dieser keine Zeit widmen sollte. Er sprach leise, diskret, philosophisch, mit langen
Erzählungen und hat Fragen oft mit Gegenfragen beantwortet. Wie zum Beispiel „ Was
verstehen Sie unter ländlichem Raum, Agrartourismus, ländlichem Tourismus,
Qualitätsstandards?“ Dies gibt wohl zu bedenken, dass man sich auf verschiedene
Terminologien stützt und daher das Forschungsgebiet dieser Arbeit aus verschiedenen
Blickwinkeln betrachtet. Es war eine Skepsis des Experten über Perspektiven des
Agrartourismus in der Region Tver festzustellen. Das Gespräch dauerte 40 Minuten.
Es wurden insgesamt sechs Interviews durchgeführt. Die interviewten Personen sind in
verschiedenen Maßen auf Beschäftigung im ländlichen Tourismus eingegangen.
101
Ergebnisse
7.2. Arbeit und Ausbildung im Agrartourismus
Aus dem Experteninterview in Kaschin geht hervor, dass der Tourismus in der Region
Kaschin (also in der Stadt Kaschin und ihrer Umgebung) in Zukunft zur
Beschäftigungssituation beitragen kann. Im Rahmen eines neuen Entwicklungsprogramms
besprechen die Stadtverwaltung und Kaschiner Einwohner den Agrartourismus. Das
Tourismusbüro in Kaschin könnte die Agrartouristen mit Bauernhöfen verbinden. Zur Zeit
wird von Elena Konstantinovna in der Region recherchiert, ob Dorfbewohner die
Möglichkeit haben, Touristen einen Platz im Haus zur Verfügung zu stellen. Dabei würde
die Stadt Kaschin mit der Schulung und Werbung sowie Information helfen und eine
Datenbank mit Kontakten erstellen. Elena Konstantinovna meinte, dass ländliche
Einwohner durch den Tourismus zusätzliche Beschäftigung sowie extra Einkommen
hätten. Doch das funktioniert mit der Vermittlung nicht ganz, weil die Gäste das Büro nur
einmal kontaktieren, um direkte Verbindung zu heimischen Personen zu bekommen. Die
ersten zwei ländlichen Einwohner haben angeblich im Jahr 2013 begonnen mitzumachen,
haben aber noch keine Daten geliefert und es ist nicht bekannt, ob sie in der Sommersaison
2014 mitmachen. Die Daten über die private Unterbringung bei einheimischen Einwohnern
werden durch das Büro Zemchuzina von Elena Konstantinovna und ihren Büromitarbeiter
verwaltet. Das ganze Projekt ist aber noch in der Probephase und es ist noch zu früh, es zu
analysieren.
Nach der Wende in der 90er Jahren wurden viele Personen im Dorf Verchnjaja Troitsa
arbeitslos, als ein großer Agrarbetrieb Pleite ging. Statistische Daten von damals sind nicht
zugänglich, vielleicht wurden solche in jener Zeit auch nicht erhoben. Julia und Nikolaj
Emeljanovitsch aus dem Pferdetourismusbetrieb meinten, dass die Arbeitskräfte teilweise
aus der landwirtschaftlichen Produktion in Dienstleistungssektoren gewandert sind.
Agrartourismus und Pferdehaltung sollte der Region helfen, Leute wieder zu beschäftigen.
Eine Bestätigung in der Wissenschaft findet man in dem Artikel von BONDARENKO
(2011), es sei schwer in der ländlichen Gegend nichtlandwirtschaftliche Beschäftigung zu
finden. Landwirtschaft, vor allem in großen landwirtschaftlichen Betrieben, braucht eher
qualifizierte, aber dafür weniger Arbeitskräfte.
Aus den Interviews mit Julia und Nikolaj Emeljanovitsch wurde folgende Geschichte
bekannt: zu sowjetischen Zeiten gab es im Dorf Verchnjaja Troitsa in der Region Kaschin
102
Ergebnisse
einen großen Betrieb. Dieser ging in den 90er Jahren Pleite und rund hundert Menschen
wurden arbeitslos. Jetzt bietet der Pferdemilchbetrieb der Region eine Möglichkeit, rund
60 Personen aus dem Dorf zu beschäftigen. Acht Personen arbeiten ausschließlich für den
Tourismus im Betrieb Medveditsa. Wenn es den Betrieb nicht gäbe, wäre schwer zu sagen,
was die Leute hier machen würden, sagte Julia in ihrer Erzählung: «если бы этого не
было, сложно сказать, чем бы занимался народ, потому что все, что было в
советские времена, все было разрушено, у нас был большущий колхоз, он пришел в
убыток. Другого места для занятости просто нет, в близлежащих селах »/ „Wenn
es den Betrieb nicht gäbe, wäre schwer zu sagen, womit sich die Leute beschäftigen
würden. Einen anderer Platz für die Beschäftigung gibt es in den naheliegenden Dörfern
einfach nicht. Alles, was es hier zu Sowjetzeiten gab, ist zerstört worden. Wir hatten einen
riesengroßen Betrieb, der in Verfall geriet“.
Laut Nikolaj Emeljanovitsch herrschte zu Beginn der Entwicklung des Geschäftsmodells
für den Pferdehaltungsbetrieb nur Chaos. Die exakte Anzahl der Arbeitskräfte, die nötig
sein würden, und die genaue Beschäftigung waren noch unklar. Es gab keine ähnliche
Produktion in Russland, welche als Vorbild hätte dienen können. Mit der wachsenden
Erfahrung im laufenden Betrieb wurde die Anzahl der Arbeitskräfte verringert und
optimiert. Die Beschäftigung hat sich ungefähr von 120 auf 60 Personen halbiert.
Zeitgleich mit der Pferdeherde entwickelte sich auch der Tourismus in der Region. Im Jahr
2000 hat ein privater Investor ein kleines touristisches Dorf gebaut. Dort waren anfangs
noch 20 Personen beschäftigt. Aus Optimierungsgründen wurden aber Personen entlassen,
und so arbeiten heute dreizehn Personen im Betrieb, davon acht mit fester Anstellung. Vor
allem kommen Leute aus Moskau in das Dorf, denn dank der Lage ist es hier möglich, das
ganze Jahr durchgehend 50 Touristen aufzunehmen. Das Personal im Dorf ist mit 8
Vollzeitbeschäftigten ausreichend. Es arbeiten dort zwei Köche, zwei Zimmermädchen, ein
Elektriker, ein Installateur, ein Verwalter, ein Direktor und manchmal noch zwei
Sicherheitskräfte. Es gibt im Dorf einen Pferdestall für bis zu zehn Pferde. Es ist möglich,
die Pferde für einen Ausritt zu buchen. Im Stall sind noch drei weitere Personen
beschäftigt. Außerdem gibt es noch drei Biorinder, die frische ökologische Milch liefern.
Zu Beginn der Tätigkeit im Jahr 1998 kamen zum Betrieb auch einige Schüler aus
Interesse an Pferden, um mit diesen Zeit zu verbringen. Einige haben im Betrieb zu
arbeiten angefangen, haben später jedoch eine andere Ausbildung gewählt. Die
103
Ergebnisse
spezifischen Qualifikationen in der Pferdehaltung wurden durch spezielle Ausbildungen
und Trainings erworben. Der Betrieb hat die Kosten für die Ausbildung übernommen. Fast
jeder im Betrieb hat einen Hochschulabschluss und wird laufend geschult, um die
beruflichen Qualifikationen zu erhalten oder zu verbessern. Beispielweise bekommt Julia
durch ein Fernstudium ihren zweiten Hochschulabschluss. Sie betonte, dass Studium sei
wichtig und helfe ihr den Betrieb zu managen.
Beide Interviewte aus dem Betrieb wiesen darauf hin, dass durch die Pferdehaltung und
den Tourismus soziale Spannungen wegen der Arbeitslosigkeit im Dorf verschwunden
sind. Die Touristen kommen zur Erholung, wegen den komfortablen Lebensbedingungen
und zur Erhaltung ihrer Gesundheit. Julia merkte an, dass die Angestellten regelmäßig ihr
Gehalt bekommen. Gehälter werden häufig seit der Wende und zum Teil bis heute nicht
regelmäßig ausgezahlt. In der Statistik gibt es dafür eine Kennzahl für überfällige
Auszahlungen. Deshalb ist Julia darauf eingegangen, als Zeichen, dass es dem Betrieb gut
geht. Der Verdienst liegt bei 15000 Rubel, das entspricht ca. 300 Euro, was laut Nikolaj
Emeljanovitsch ein sehr gutes Gehalt ist. Wie bereits aus der Statistik ersichtlich, lag der
nominale durchschnittliche Lohn in der Hotellerie im Jahr 2012 bei rund 11.880 Rubel. Ein
normaler Arbeitstag im Betrieb Medveditsa beginnt um acht Uhr morgens, wenn das
Firmenauto die Mitarbeiter zur Arbeit bringt. Um 17 Uhr werden sie wieder nach Hause
gebracht. Nur die Köche arbeiten länger in der Kantine, manchmal bis 23 Uhr bzw. bis der
letzte Gast geht, sagte Julia. Da die Köche länger im Betrieb sind, übernehmen sie auch
einige Verwaltungsfunktionen. Beispielsweise heben die das Telefon ab und beantworten
Fragen, stornieren oder nehmen eine Buchung an usw.
Julia bestellt u.a. Animationsgruppen für die Unterhaltung der Touristen im Betrieb, vor
allem für große Feiertage. Früher waren das Leute aus Kaschin, seit zwei Jahren sucht sie
immer neue Animationsgruppen aus, damit den Touristen, insbesondere Stammkunden,
nicht langweilig wird. Es besteht für die Touristen auch die Möglichkeit, andere Orte in der
Umgebung zu besuchen. Der Betrieb Medveditsa stellt dann die Verbindung zu
Ansprechpersonen vor Ort her. Manchmal werden Reiseführer benötigt. Unter anderem
nannte Julia die Städte Myschkin und Bezhetsk als touristische Destinationen, das
Kaschiner Landesmuseum, sowie das in der Nähe des Betriebes gelegene Kalinin Museum.
Bei Ljoscha im Dorf werden Ausbildungseinflüsse auf die Beschäftigung in der Region
Kaschin unterschiedlich bewertet. Da bei ihm die Mehrheit der Leute keine feste
104
Ergebnisse
Anstellung hat, sondern als Selbständige (у нас у большинства участников
фрилансовая занятость) arbeitet, listete Ljoscha auch die Art der Beschäftigung sowie
Projekte mit anderen Organisationen auf.
In seinem Interview erzählte er über die einzelnen Personen, die seinen Betrieb formen.
Ein Freund von ihm, der sich dem Gewerbe (Puppen machen, Brotbacken, Eier bemalen
usw.) widmet, war früher ein Spezialist für Mittel- und Langstreckenraketen. Der ist froh,
seinen früheren Beruf aufgegeben zu haben und sich als Volkspuppenmeister qualifizieren
zu können (Abbildung 25). Ljoscha
ist ein gelernter Geschichtsforscher, seine
Schwiegermutter ist eine gelernte Volkspuppenmeisterin. Daher war der Gedanke
naheliegend, Geschichte und Tourismusunternehmen zu verbinden.
Abbildung 25: Handwerker und seine Puppen (Quelle: Schar-Ptitsa, 2014)
Ljoscha weist darauf hin, dass die Idee des touristischen Business mit befreundeten
Nachbarn im Dorf geboren worden sei. Zuerst erzählte er, dass anfangs ein Haus als
Ferienhaus (Datscha) gekauft wurde. Eine Datscha zu haben ist in Russland sehr typisch.
Manche Einwohner aus den Städten haben ein Ferienhaus auf dem Land/ außerhalb der
Stadt, wo sie ihre Wochenenden oder Ferien verbringen. Mit der Zeit sind zwischen den
Nachbarn in Matino Freundschaften entstanden, aus welchen letztlich die Idee des
Folklorensembles Schar-Ptitsa entsprungen ist. Diese Gruppe von jungen Burschen dachte
sich ihre Beschäftigung selbst aus. Sie organisierten Events wie Volksfeste und andere
Aktivitäten. So vergingen fast acht Jahre, bis Ljoscha
sein Hobby entwickelte und
Geschichten aus der Umgebung zu sammeln begann. Aus dem Hobby wurde nach und
105
Ergebnisse
nach eine gewerbliche touristische Dienstleistung. « мы как бы вот по сути своей,
наверное, с 2008 года мы в этот мир вступили, в туристический»/Im Wesentlichen
sind wir ab dem Jahr 2008 in diese touristische Welt eingetreten.
Ljoscha
und seine Gruppe haben in großem Umfang Recherchearbeiten über den
Agrartourismus durchgeführt. Mit dem Ziel, den Agrartourismus zu erforschen, ist Ljoscha
viel gereist. In Russland war er im Altai Gebirge, im Moskauer Gebiet und im Wladimir
Gebiet. Dabei wurden zum Beispiel russische Volksspiele, -tänze und -musik sowie
Musikinstrumente
gesammelt.
Aufgrund
seiner
historisch
ethnographischen
Forschungsarbeit entwarf er Programme für seine Touristen. Später arbeiteten Ljoscha und
sein neuer Bekannter Jaroslav ein Geschäftsmodell aus und entschlossen sich dazu, die
Firma offiziell als einen Tourismusbetrieb registrieren zu lassen. Ursprünglich wollte
Jaroslav "einen Web-Reiseführer für Kaschin schaffen. Dafür suchte er nach Leuten, die
sich mit dem Tourismus verbunden fühlten". Ljoscha hat zuerst über eine NonprofitOrganisation den Tourismus belebt und weiter entwickelt Bis letztlich daraus ein
touristisches Geschäft, die Firma „Kaschingrad“ (Transkript Zeilenverweis 129-151),
entstand, dauerte es ein paar Jahre. „Das Volksfest „Maslenitsa“ 2013 haben wir schon
unter der touristischen Gesellschaft „Kaschingrad" durchgeführt.“
Ljoscha zählte alle Teilnehmer des ländlichen Tourismus, mit welchen es
eine
kontinuierliche Zusammenarbeit gibt, auf. Das Erholungsheim Tetkovo, der Kurort
Kaschin, das Cafe Derevenka, das Kalinin Museum und das Museum im Dorf Vosnesenie.
Ljoscha sagte, dass sie diese Objekte betreuen und dass er bereits weitere Angebote für
Kooperationen im Tourismus bekommen hat. Eines dieser neuen Angebote ist ein Projekt,
bei dem eine russisch-orthodoxe Tour mit einer Mahlzeit in einem alten Kloster Kaschins
geführt wird. Die Organisation der Führung im Kloster und der Mahlzeiten dort wird von
einer anderen Person, Jaroslav Prokopiev, erledigt, weil Ljoscha keinen guten Zugang
zum Kloster hat.
Eine wesentliche Rolle für die Beschäftigung von Ljoschas Unternehmen spielt Werbung
in Kaschiner Zeitungen sowie im Web durch soziale Netzwerke. Für die Werbung
(Ljoscha nennt sie die informative Unterstützung) ist Frau Dr. Olga Nikitina zuständig.
Am Anfang hat sie nur aus Freundschaft Ljoscha geholfen, denn sie war Journalistin und
hat für eine Zeitung gearbeitet. Als die Firma Kaschingrad entstand, gab Frau Dr. Nikitina
ihren Job bei der Zeitung auf. Ob sie nun fest bei Kaschingrad angestellt ist, bleibt
106
Ergebnisse
ungewiss. Die Projekte von Ljoscha bekommen eine große Resonanz, wodurch Gäste
angezogen werden.
Ein weiteres Projekt von Ljoschas Firma hat unmittelbar die Beschäftigung beeinflusst.
Ljoscha arbeitet mit dem Gewerbezentrum Slavitsch zusammen. Am ehesten ist dieses
Zentrum wohl mit einer Volkshochschule zu vergleichen. Viele der Gewerbemeister im
Slavitsch leben in Dörfern der Region Kaschin. Sie pendeln nach Moskau, um dort zu
unterrichten oder Meisterklassen abzuhalten. Das Zentrum wird auch dazu genutzt,
mögliche Gäste für Kaschin zu gewinnen. («офисом даже в Москве…ну по крайней
мере неким клубом, через который можно набирать тоже людей.., фактически
через него мы сейчас будем набирать группу в Кашин»)/ein Büro in Moskau…na
eigentlich ist das so ein Kulturverein, mit dem wir auch neue Gäste nach Kaschin bringen
können.., in der Tat werden wir jetzt über den Kulturverein eine Gruppe für Kaschin
zusammenstellen“. Anschließend kommen einige der Touristen wieder nach Slavitsch, um
dort die Freizeit zu verbringen und etwas Gewerbliches zu lernen. (Transkript
Zeilenverweis 235-237) «И еще один проект тоже связанный с туристическими
нашими делами, это центр ремесел Славич, это московский дом ремесел на
кропоткинской, где работает порядка 15 мастеров и вот я там как бы «щас»
администрирую этот центр.»/ „und noch ein Projekt ist mit unseren touristischen
Angelegenheiten verbunden. Das Zentrum für Gewerbe in Slavitsch, ein Moskauer
Zentrum für Gewerbe neben der U-Bahnstation Kropotkinskaja. Dort sind rund 15
Handwerksmeister
beschäftigt,
nun
bin
ich
im
Zentrum
administrativ
tätig“.
Resümierender Satz Ljoschas «непосредственная линейка выстраивается там
Москва-Кашин»/ „eine unmittelbare Verbindung entwickelt sich zwischen Moskau und
Kaschin“.
Der Großteil der in den Projekten ständig beschäftigten Personen sind Animateure.
«Наверное, людей, если говорить о постоянном участии в анимации, в
анимационном участии, это самая большая нагрузка по людям, то людей у нас
задействовано не так много.» / ich kann wohl sagen, wenn wir über kontinuierliche
Beschäftigung sprechen, haben wir nicht so viele Personen beschäftigt. Die
Programmbegleitung hat die meiste Personalauslastung ". Je nach dem sind zwischen fünf
bis acht Personen dauerhaft im Betrieb beschäftigt. Weiters gibt Ljoscha ein Beispiel:
«Потому что на группу сорок человек в среднем нужно человека четыре всего
107
Ergebnisse
народу чтобы эту группу вести. В программе, если человек двести, то нужно уже
десять человек». / für ein Gruppe bestehend aus 40 Personen brauchen wir vier Personen
für die ganze Führung. Bei einem Programm mit 200 Personen Brauchen wir schon 10
Personen für die Programmbegleitung. Wenn man diesen Absatz genauer betrachtet, wird
offensichtlich, dass keiner eine fixe Anstellung hat. «Сейчас у нас такое фрилансовое
состояние всех участников, да большинства наших экскурсий». Фрилансовый
характер заключается в том, что на работу люди приглашаются, когда уже есть
заявка на экскурсию, «то есть когда люди нам нужны, то мы их на те или иные, ну
как бы очень четко относительно заранее приглашаем… Как следствие, участие в
проектах говорит непостоянном заработке большинства человек». / " jetzt haben
wir ein sogenanntes Freelance-Modell aller Beschäftigten, für die Mehrheit aller unserer
Exkursionen». Der Freelance Charakter besteht darin, dass die Beschäftigten gebucht
werden, wenn die Exkursion bereits fixiert worden ist, "also wenn wir Leute brauchen,
dann fordern wir sie für bestimmte Veranstaltungen rechtzeitig an“. In der Folge werden
die Beschäftigten je nach Teilnahme an den Projekten bezahlt.
Bei den künstlerischen Aufführungen sind keine professionellen Schauspieler beschäftigt.
Hauptsächlich haben die Personen (Animateure, Schauspieler) Erfahrung mit dem
Publikum und können singen. Dabei nehmen manche Künstler seltener und andere öfter
teil. "Es gibt Personen, die sind nur bei den großen Veranstaltungen dabei, ja, wenn man
viele Leute braucht". Diese Beschäftigung bewertet Ljoscha als einen Nebenverdienst, und
solange jemand mitmacht, hat er Geld und es ist gut so. Für Ljoschas Familie ist es ein
Hauptverdienst, "da er davon leben kann und die Beschäftigung ihn ernährt.“ Ljoscha lässt
einen Teil der Veranstaltungen oder sogar das ganze Unterhaltungsprogramm von Kindern
durchführen. Er sieht es positiv, dass die Kinder etwas Geld verdienen können und so
lernen, die Veranstaltungen durchzuführen (Transkript Zeilenverweis 285-290).
„Als unser Puppentheater das Licht der Welt erblickt hat, haben wir auch eine Animation
mit Puppen für die Touristen gemacht, unsere Maskottchen/ростовые куклы haben wir
uns selbst angeschafft“, sagte Ljoscha. Maskottchen sind solche große Puppen, wo ein
Mensch drinnen ist oder, anders gesagt, kostümierte handelnde Personen, wie zum Beispiel
große Gänse. Jedes unserer Programme dient dazu“, erzählte Ljoscha, „den Touristen
etwas durch praktische Anwendung (Seminar/Мастеркласс) zu lernen. Das Fertigen einer
108
Ergebnisse
kleinen Puppe aus Birkenrinde und Flachs oder wir malen nach einer dreitausendjährigen
Technik Eier an“(Abbildung 26).
Abbildung 26: Traditionellbemalte Eier (Quelle: Schar-Ptitsa, 2014)
Meisterklassen für Touristen sind eine Seltenheit, und Ljoscha ist stolz darauf, dass sie das
machen. «В эти игры играли и молодежь, и дети, и старики играли на селе, то есть
там не надо ничего придумывать, там уже все вещи отработаны веками, скажем
так»./ "Die Spiele hatten die Kinder und die Alten im Dorf schon immer gespielt, man
brauchte sich also nichts auszudenken, dort ist alles über Jahrhunderte eingeübt, so zu
sagen". Die früher gesammelten ethnologischen Materialien werden in Form von Spielen,
Liedern und Tänzen wieder an die Touristen weitergegeben. So hat Ljoscha die
Beschreibung seines touristischen Konzeptes beendet. Was sie in der Kaschiner Region
machen, meinte er, sei inhaltlich einzigartig, weil kein Mensch in der Gegend ähnliche
Meisterklassen anbiete.
Seit dem Jahr 2013 arbeitet die Firma „Kaschingrad“ mit dem Sanatorium der Stadt
Kaschin zusammen und führt für diese Anstalt auf deren Gelände Feste durch. «в 2013
году мы будем делать масленицу, в Кашинском санатории, то есть мы берем
другую площадку себе, у нас есть площадка в Матино, называемая Берендеевская
изба, у нас появилась еще одна изба для приема гостей, вот, она конечно небольшая,
то есть там дом ремесел». „ Im Jahr 2013 werden wir das Maslenitsa-Fest woanders
machen, im Kaschiner Sanatorium, wir begeben uns also auf einen anderen Platz. Wir
haben einen weiteren Platz in Matino, das sogenannte „Berendeevskaja Isba“. Wir haben
dort seit kurzem ein weiteres Haus für den Gästeempfang, es ist nicht sehr groß, aber dort
befindet sich auch die Werkstatt“. Bei den Veranstaltungen sind Kinder aus dem Dorf
109
Ergebnisse
sowie Freizeit-Schauspieler beschäftigt. Im Dorf sind künstlerisch begabte Voluntäre
immer herzlich willkommen.
Touristen werden auch im Haus des Herrn Aljonov aufgenommen. Er beschäftigt sich nur
mit der Essensvorbereitung und hat dafür manchmal drei bis vier Personen beschäftigt. Er
besitzt auch ein Haus am Ufer der Wolga und hilft bei besonders großen Gruppen ab 90
Personen auch mit Zelten aus. Er verrichtet einfache Vorbereitungsarbeiten für die Gäste,
wie das Kochen von Suppen über einem Lagerfeuer oder Grillen. Aus Freundschaft zu dem
Tourismusbüro Schemtschuschina lässt Herr Alönov die Touristen, vor allem im Sommer,
auf seinem Grund zelten.
Zusammenfassend lässt sich feststellen:

der Betrieb Ljoschas führt mehrere Projekte in der Region Kaschin durch, es geht
nicht um eine feste Anstellung, sondern eher um einen Nebenverdienst. Einige Personen
aus der Gruppe unterrichten ihr Handwerk im Zentrum Slavitsch in Moskau. Bei Ljoscha
sind Voluntäre willkommen, für die Unterhaltungsprogramme werden arbeitsabhängig
Leute kontaktiert.

das Projekt des ländlichen Tourismus vom Tourismusbüro Schemtschuschina hat
nur episodische Bedeutung für die Region, vor allem im Sommer.

Der Betrieb Medveditsa nimmt Touristen bei sich in der Siedlung auf. Zurzeit
achtet der Betrieb darauf, dass alle erworbenen Qualifikationen der Mitarbeiter
kontinuierlich verbessert werden. Das Personal ist mit 8 Leuten komplett, momentan
werden keine zusätzlichen Mitarbeiter gesucht.
Als
Experte aus
der
Region
Kaschin
meinte Elena
Konstantinovna,
dass
Tourismusentwicklungseinrichtungen soweit keine zusätzlichen Arbeitskräfte im Bereich
Regionalentwicklung brauchen, sondern Finanzierungen.
7.3. Soziale Einflüsse
Dass der Agrartourismus in der Region Kaschin im Trend ist, kann man nicht sagen. Dazu
macht Ljoscha
einen Vergleich. Er sagte, dass man in EU-Ländern ökologische
Lebensmittel, ländlichen Tourismus, Ökotourismus viel mehr schätzen würde, als in
110
Ergebnisse
Russland. Ein geprüftes Qualitätssystem, wie z.B. Blumen in Österreich, existiert auch
nicht. Die Expertenmeinung aus der Region lautet sogar, dass wegen der mangelnden
Entwicklung des Agrartourismus es noch zu früh wäre, eine Zertifizierung durchzuführen.
Über die Zertifizierungssysteme wissen die Betriebe nichts; weder Ljoscha noch Julia
haben bestätigt, dass ihnen das Zertifizierungssystem für Tourismusbetriebe bekannt ist.
Zertifizierungssysteme gibt es auf einer freiwilligen Basis. Der Experte aus Tver meinte
auch, die Tourismusbetriebe dürfen sich freiwillig zertifizieren lassen. Viele wollen es aber
nicht, vor allem weil der Zertifizierungsprozess kostenpflichtig ist. Und ob es für den
Betrieb etwas bringen würde, sei fraglich. Als ein wichtiges Problem für den ländlichen
Tourismus nannte Ljoscha eine negative Einstellung der Kunden zu den russischen
Provinzen.
Eine negative Einstellung zur Kaschin bildet sich bei den potenziellen Touristen aus, weil
die Region von den Kaschiner Reiseveranstaltern schlecht vorgestellt wird und dadurch für
die Touristen unattraktiv bleibt, meinte Ljoscha : «что как мы уже поняли ни одна по
сути Кашинская турфирма не могла да и не может по сей день, достойно
представить Кашинский край на каких то больших проектах перед крупными
тверскими и московскими турфирмами.» / was wir schon bereits wussten, dass nicht
ein Kaschiner Reiseveranstalter in der Lage war, die Region vernünftig zu präsentieren, um
sie so den großen Reiseveranstaltern aus Tver und Moskau vorzustellen" (Transkript
Zeilenverweis 124-146).
Julia und Ljoscha erzählten, dass ihre Gäste gerne im Urlaub von der Stadt weg in die
Natur fahren, wo u.a. frisches Obst, Gemüse und gut gestaltete Unterhaltungsprogramme
angeboten werden. Zu erfahren, was die Agrartouristen in die ländlichen Regionen wie
Kaschin bewegt, hätte eine Befragung der Touristen geholfen.
Der Betrieb Medveditsa hat einen Stammkundenkreis und wird durch die Gäste
weiterempfohlen. In welchem Zusammenhang genau der Betrieb empfohlen wird, ist nicht
gewiss. Aus dem Interview mit Ljoscha wurde klar, dass er keine Stammkunden hat. Die
Mehrheit kommt einmalig zu einer Veranstaltung. Jedoch haben die beiden Betriebe noch
freie Kapazitäten, vor allem in den Übergangszeiten. Dann hat Medveditsa weniger
Kunden, vor allem unter der Woche – im Sommer, und dann besonders am Wochenende,
ist die Touristensiedlung meist ausgebucht. Auch Ljoscha
kämpft damit, dass bei
schlechtem Wetter die Buchungen für seine Veranstaltungen storniert werden. Das Wetter
111
Ergebnisse
beeinflusst die Erreichbarkeit seines Dorfes wegen nicht asphaltierter Straßen, was in
Medveditsa dank eines aus Sowjetzeiten erhaltenen Straßennetzes nicht passiert.
7.4. Erreichbarkeit
Mehrmals in seiner Erzählung wies Ljoscha auf die Probleme, wie z.B. die Erreichbarkeit
oder das Fehlen von Werbeunterstützungen hin. Es gibt nicht überall Straßen.
Touristengruppen werden mit Bussen hingebracht, gehen aber auch stückweise zu Fuß.
Der Betrieb Medveditsa gewährleistet zu 100 Prozent die Erreichbarkeit der touristischen
Siedlung. Alle Mitarbeiter des Betriebes werden aus den Dörfern Verchnjaja Troitsa und
Tetkovo 2 km und 3,5 km mit einem Dienstwagen in die Arbeit gebracht. Es gibt eine
asphaltierte Straße durch den Wald, die, wenn nötig, durch eigene Dienste gepflegt wird.
Anzumerken ist, dass in dieser Teilregion die Infrastruktur auch zu sowjetischen Zeiten
hervorragend war. Hier muss erklärt werden, warum die Infrastruktur in der Umgebung
von Medveditsa gut ist und woanders, wie bei Ljoscha, nicht.
Einerseits hatten früher alle, die gearbeitet haben, von ihren Organisationen Kurchecks,
Ferienchecks, Urlaubschecks bekommen. Die sowjetische Nomenklatur (Beamte), Ärzte,
Lehrer, Künstler, Arbeiter, Militärs usw. hatten aber nur bestimmte Möglichkeiten, wohin
sie mit so einem Check / Путевка fahren durften, denn eine Erholungseinrichtung war
meist mit einer bestimmten Fabrik, Ministerium, Universität etc. verbunden. Heutzutage
sind solche Checks mit Gutscheinen vergleichbar. Das Checksystem funktioniert zum Teil
in Russland wie folgend: alle dürfen überall gegen einen Vollpreis hinfahren, mit einem
Check meistens für weniger als die Hälfte des Preises. Andererseits ist Verchnjaja Troitsa
ein besonderer Standort für die Geschichte der Region und des Landes. 1875 wurde hier
Michail Ivanovitsch Kalinin geboren, der in Russland als ehemaliges Staatsoberhaupt der
Sowjetunion bekannt ist. Das Gebiet Tver trug bis 1990 den Namen Kalinin, die an die
Sowjetunion übergegangene ehemalige ostpreußische Hauptstadt Königsberg trägt heute
den Namen Kaliningrad. Das früher für Beamte gedachte Erholungsheim Tetkovo (Дом
отдыха Тетьково) befindet sich in der Nähe von Verchnjaja Troitsa.
Die Erreichbarkeit anderer kleiner Orte in der Region Kaschin ist oft durch das Fehlen
asphaltierter Straßen erschwert. Abhängig von der Jahreszeit besteht die Möglichkeit, dass
die Erreichbarkeit nur mehr zu Fuß gegeben ist. Für Busse ist eine Einfahrt in die
112
Ergebnisse
Ortschaften sowieso nicht möglich. Das Dorf ist zu Fuß erreichbar: d.h. vom Busparkplatz
geht die Touristengruppe zum Dorf und wird am Weg von Animateuren unterhalten. Der
Weg zu Fuß bereitet zwar Schwierigkeiten, ist aber im Unterhaltungsprogramm integriert.
Die Erreichbarkeit hat immer Einfluss auf die Gestaltungsmöglichkeiten eines Programms.
Ljoscha wies darauf hin, dass beim Erstellen der touristischen Programme auf die gute
Erreichbarkeit zumindest zu Fuß geachtet wurde. Der Weg ist bereits ein Teil des
Programms. (Transkript Zeilenverweis 80-85): «люди идут пешком, идут в общем то
не просто так, они идут по сказочной тропе, которую мы разработали для них,
там определенные персонажи встречают их на этой сказочной тропе, дальше они
приходят к самой избе»/ „die Leute gehen zu Fuß, gehen in der Regel nicht einfach so,
sie gehen auf einem märchenhaften Pfad. Auf dem Weg treffen sie bestimmte handelnde
Personen, und schließlich kommen die Touristen zum Bauernhaus“.
Manchmal trägt auch das Wetter direkt zur Tätigkeit in der Firma bei. So passierte es
einmal wegen einer Wetteranomalie im Frühling 2013, dass sich die Anzahl der geplanten
Gäste auf einem großen Maslenitsa-Fest aufgrund der Erreichbarkeit halbierte. Das
bedeutete für die Anzahl der beschäftigten Personen auch eine Reduktion. «200 человек,
это немного, но для Кашина много даже это. Вот приняли двести, хотя должно
было быть 400, из за аномалий в погоде половина людей отказалась ехать и
туроператоры сняли свою бронь в программе. 400 человек в принципе это уже
неплохая цифра для масленичной программы.» / „200 Menschen sind nicht viel, aber für
Kaschin ist auch das schon viel. Wir haben 200 aufgenommen, sollten aber 400
aufnehmen, alles wegen den anomalen Wetterveränderungen, die Hälfte der Leute hat ihre
Reise abgesagt und der Reiseveranstalter hat seine Reservierungen für das Programm
zurückgezogen. 400 ist grundsätzlich schon eine gute Zahl für das Maslenitsa-Fest".
Wie man sieht hat das Wetter einen starken Einfluss auf die erwarteten Zahlen der
Touristen bzw. Buchungen. Trotzdem beurteilt Ljoscha seine Tätigkeit positiv. Das
Unternehmen hat Erfolg, und als Vergleichsbasis zieht er ein Beispiel eines
Reiseveranstalters aus der Nachbarregion heran, welcher in seiner Tätigkeit schon 10 Jahre
auf dem Markt existiert. (Transkript Zeilenverweis 152-159) «Для сравнение «Пилигрим»
проводит масленницу на 800 человек, то есть это Калязинская фирма составляет
10 лет работы именно уже как туроператор». Zum Beispiel veranstaltet eine Firma
113
Ergebnisse
aus Kaljasin mit 10 jährigen Erfahrungen als Reiseveranstalter ein Maslenitsa-Fest für 800
Personen.
Für Aktivitäten am Wolgaufer ist die Saisonalität von großer Bedeutung. In den
Übergangszeiten gibt es Schnee und Regen, was eine Anfahrt sehr kompliziert macht. Die
landwirtschaftlichen Betriebe in der Nähe helfen, falls notwendig, mit ihren Traktoren, den
Weg frei zu machen. Elena Konstantinovna erwähnte, dass die Stadt gerne hilft, den Weg
vom Schnee zu befreien, wenn sie am Fluss eine Veranstaltung organisiert.
Elena wies in ihrem Interview darauf hin, dass die Touristenströme von den Jahreszeiten,
den Wetterbedingungen und auch den Straßenverhältnissen abhängig sind. Die
Erreichbarkeit ist ein wichtiger Faktor.
7.5. Die Umfeldfaktoren
Zu Umfeldfaktoren zählen die Landwirtschaftsstruktur, Tourismusinfrastruktur und
Umweltsituation. Die Landwirtschaft der Region wurde umfangreich samt der Region
Kaschin präsentiert.
Die Landwirtschaft der Region Kaschin ist hauptsächlich durch Großbetriebe geprägt.
Diese liefern landwirtschaftliche Erzeugnisse an regionale Märkte und haben mit dem
Tourismus nur wenige direkte Anknüpfungspunkte. Nikolaj Emeljanovitsch erklärte, dass
die Betriebe Snaip und Medveditsa über mehrere Hektar Weide für Pferde verfügen. In den
Betrieben Medveditsa und Kaschingrad wird nur für die Selbstversorgung produziert,
wobei einige Dorfeinwohner selbstgemachte Marmelade und ähnliche Produkte an die
Touristen verkaufen.
In den Interviews sind alle Auskunftspersonen auf die Umfeldfaktoren eingegangen. Über
die Umweltsituation waren Betriebsvertreter sowie Experten einer Meinung. Sie sprachen
über die herrliche Landschaft und die guten ökologischen Bedingungen. Die Region
Kaschin grenzt an die Wolga, wo laut befragten Personen viele Touristen im Sommer wild
zelten. Tourismusinfrastruktur gibt es dort keine. Der Betrieb Medveditsa befindet sich am
Medveditsa Ufer im Wald und sorgt selbst dafür, dass seine Flächen von Müll frei bleiben.
Julia sagte „wir machen es selbst“, mit eigenen Kräften sozusagen. Auf konkrete Arbeiten
im Umweltbereich wurde nicht eingegangen.
114
Ergebnisse
Um die Umweltsituation in der Region Kaschin näher präsentieren zu können, wird der
Umweltteil aus dem touristischen Profil der Region Kaschin zitiert
«Красота природы экологически чистого района, мягкий климат и
уникальный ландшафт старинного Кашина создают самые благоприятные условия
для всех. Кашинский район является одним из наименее загрязненных районов
области. Состояние окружающей среды и экологическая безопасность на
территории Кашинского района на протяжении многих лет остается стабильной.
Основными факторами такой стабильности являются отсутствие в границах
района и на ближайших территориях крупных промышленных и химических
предприятий, автомобильных пробок, как основных источников загрязнения
окружающей среды».
Die Naturschönheit einer ökologisch sauberen Region, mäßiges Klima und einzigartige
Landschaften des alten Kaschin schaffen für alle sehr günstige Bedingungen. Die Region
Kaschin ist eine der am wenigsten verschmutzten Regionen des Gebiets Tver. Der
Umweltzustand sowie die Umweltsicherheit bleiben auf dem Territorium der Region
Kaschin seit mehreren Jahren stabil. Hauptfaktoren dieser Stabilität sind das Fehlen großer
Industrie- und Chemieunternehmen sowie Autostaus an den Grenzen der Region und in
den nahe liegenden Territorien als Hauptquellen der Umweltverschmutzung.
«Район находится в лесной зоне. Главные лесообразующие породы – ель,
сосна, береза, осина, ольха, дуб. Наличие разнообразных лесных угодий с хвойным и
хвойно-лиственным древостоем в сочетании с открытыми пространствами,
болотами, реками - залог высокой продуктивности охотничьей фауны. О
благоприятной экологической обстановке свидетельствует тот факт, что на
территории Кашинского района обитают виды, занесенные в Красную книгу
Тверской области: серая куропатка, европейская норка, а так же ежегодно
встречаются такие редкие «краснокнижные» виды, как черный аист, орланбелохвост. В лесах обитают: медведи, лоси, кабаны, олени, волки, лисы, зайцы.»
Die Region befindet sich in einer Zone des Waldes. Die wichtigsten Baumarten sind
Fichte, Kiefer, Birke, Espe, Erle und Eiche. Die Verfügbarkeit vielfältiger Nadel- und
115
Ergebnisse
Laubwälder gemeinsam mit offenen Räumen, Mooren, Flüssen gewährt eine hohe
Produktivität der Jagdfauna. Für eine günstige Umweltsituation spricht, dass es auf dem
Territorium der Region Kaschin Arten gibt, welches sich in der roten Artenliste befinden.
das graue Rebhuhn und den europäischen Nerz, und jedes Jahr sind solche seltene „Arten
des roten Buches“, wie der schwarze Storch und der Seeadler an zu treffen. In den Wäldern
wohnen Bären, Elche, Wildschweine, Hirsche, Wölfe, Füchse und Hasen.
«Водный фонд Кашинского района состоит из 29 рек, длиной каждая в
пределах района от 1 до 70 километров (Дрезна, Мурмышка, Рудомошь, Рам,
Медведица, Яхрома, Нерехта, Кашинка, Морзынка, и др.). В настоящее время в
Кашинском районе образовано 3 заказника, имеющие региональный статус (болота
Лаптевское, Савицкое, Битюковское)…»
Innerhalb der Region Kaschin gibt es 29 Flüssen, von denen jeder innerhalb der
Regionsgrenzen zwischen 1 und 70 km lang ist (Drezhna, Murmyschka, Rudomosch, Ram,
Medveditsa, Jachroma, Nerechta, Kaschinka, Morschynka etc.). Drei Naturschutzgebiete
regionaler (Tver) Bedeutung gibt es heutzutage in der Region Kaschin: die Moore
Laptevskoje, Savitskoje, Bitjukovskoje.
Die Tourismusinfrastruktur in den Fallbeispielsunternehmen sieht wie folgend aus: eine
gut ausgestaltete neue Cottagesiedlung in Medveditsa und auseinanderfallende alte Häuser,
ewige Renovierungsarbeiten bei Ljoscha .
Ljoschas Dorf steht nur zum Teil für die Touristen zur Verfügung, er deutet das mit den
Worten «Конечно, когда мы только приехали, да мы тут в каждом доме делали
ремонт фактически, я участник очень многих деревенских ремонтов, с большим
стажем. Все же старое все же разваливается, это же деревня, и сейчас не все ее
части можно показывать туристам»/ „Natürlich haben wir hier überall renovieren
müssen, als wir gekommen sind. De facto bin ich ein erfahrener Teilnehmer [Helfer]
mehrerer dörflicher Renovierungen. Alles ist doch sehr alt und fällt auseinander, das ist
doch ein Dorf. Auch jetzt kann man nicht alles [z.B. Dorfstraßen] den Touristen zeigen“
(Transkript Zeilenverweis 314-321). Nur bestimmte Dorfteile sind für Touristen gedacht
bzw. vorbereitet.
116
Ergebnisse
Was die Tourismusinfrastruktur der Region angeht, gibt es nach Ljoschas Meinung wenig
Gastronomiebetriebe, und die Situation mit der Gastronomie ist nicht befriedigend.
Ljoscha hofft, in der Zukunft ein Restaurant zu eröffnen, aber findet die Konditionen dazu
nicht günstig. Er hat den Traum, ein Restaurant zu besitzen, aber zur Verwirklichung hat er
momentan weder Geld noch einen vernünftigen Raum zur Verfügung. (Transkript
Zeilenverweis 277 - 281 und 347 – 355). Es ist schwer einen passenden Raum zu finden.
Die Stadt hätte einige Plätzte zu vermieten bzw. zu verkaufen, aber entweder ist der Preis
zu hoch oder die Lage ungünstig. Das Essen zu organisieren ist nicht ganz einfach.
Ein weiteres Problem der Tourismusinfrastruktur der Region Kaschin nannte die Expertin
für Tourismusentwicklung in der Region. Elena Konstantinovna sprach davon, dass die
Stadt schlechte Übernachtungsmöglichkeiten für Touristen anzubieten hat. Museen und
zahlreiche
Kirchen
werden
von Touristen
u.a. Pilgern
ständig besucht.
Die
Unterbringungsprobleme, vor allem das Preis-Leistungs-Verhältnis, meinte Elena
Konstantinovna, sei schlecht: das einzige Hotel in der Stadt ist ziemlich alt, sieht
unfreundlich aus, hat manchmal Probleme mit warmem Wasser und monopolistische
Preise. Der Teufelskreis besteht darin, dass private Investoren nicht das Risiko, ein neues
Hotel zu bauen, eingehen wollen; die Stadt hat dafür überhaupt kein Geld. Als Folge
müssen die meisten Touristen woanders übernachten und die Region bleibt ein Ort für
Tagesausflüge für Besichtigungen und Exkursionen.
Wenn Ljoscha über Infrastruktur sprach, erzählte er über die Häuser, die seine Gruppe
besitzt und betreut. (Transkript Zeilenverweis 122) «На самом деле это две такие
полуразваливающиеся избушки, но тем не менее, но люди в них едут.» / in der Realität
sind es zwei fast auseinanderfallende Bauernhäuser, aber immerhin kommen die Leute".
Als Ausgleich für den schlechten Zustand der Häuser befinden sie sich in einer ruhigen
und attraktiven Gegend.
Laut der Auskunftsperson haben sich Touristenzuströme vergrößert (Ljoscha nannte keine
genauen Zahlen), was die Notwendigkeit, das Umfeld zu verbessern, mit sich bringt. Zum
Beispiel die Häuser zu renovieren, wo man die Gäste aufnimmt und wo die Meisterklassen
durchgeführt werden. Toiletten waren auch zu bauen. «Вот, когда мы поняли, что мы
принимаем уже большие группы, возник вопрос с туалетами, пришлось построить
туалеты»/ " nun, als wir verstanden haben, dass wir bereits große Gruppen empfangen,
ist die Frage mit den Toiletten entstanden, man musste die bauen." Das war die
117
Ergebnisse
dringlichste Aufgabe, die Toiletten hatte man bauen müssen und diese Aufgabe wurde
erledigt. Danach hat Ljoschas Gruppe eine kleine Waldwiese für das Camping vorbereitet.
Dort war es möglich, ein Lager zu beziehen und somit den Touristen Campingplätze
anzubieten. Es geht um Kinder, aber auch um Erwachsene „сейчас у нас есть еще
небольшая полянка, на которой у нас летом помещаются детские и взрослые
лагеря. Семейные лагеря, вот“ / „zur Zeit haben wir auch einen Platz freigemacht, wo
wir im Sommer Kinder- und Erwachsenenlager anbieten können, Familienlager
sozusagen." Ljoscha wies auf die Ungezogenheit einiger Gäste hin, weil ein Schild, auf
dem viel Information für Touristen stand -"wir hatten mal so ein Schild bis es gestohlen
wurde". „Das ist die Wahrheit, wir haben es so gut gemacht, dass es uns gestohlen wurde.
Es wurde mitsamt dem Fundament ausgegraben. Nun, solch einen Moment haben wir auch
erlebt", sagte Ljoscha seufzend, sprach aber sofort weiter (Transkript Zeilenverweis 122128).
Die Tourismusinfrastruktur im Medveditsa Betrieb ist so ausgestattet, dass der Tourist
keine Freizeit hat, sagte Julia. Das klingt etwas komisch, ist aber so: zwischen vorher
geplanten
Pferdeausritten,
Exkursionen,
Besichtigungen
der
Kumys-Herstellung,
Kumystrinken, im Sommer Baden, im Winter Skifahren, Jagd, Waldwanderungen und
Ausflügen wird nicht viel Zeit übrig bleiben. Die Aktivitäten werden gleich bei der
Buchung besprochen, nur Kleinigkeiten werden normalerweise vor Ort geklärt.
7.6. Tourismus- und Regionalentwicklungsstrategien
In den letzten drei Jahren hat sich die Tourismusentwicklungsarbeit wesentlich aktiviert. In
23 der 43 Regionen des Gebiets Tver gibt es eigene Tourismusentwicklungsprogramme.
Im Jahr 2012/13 wurde in Moskau ein Regionalentwicklungsprogramm, sowie ein
Tourismusentwicklungsprogramm für ganz Russland beschlossen. Die Regionen (Tver)
sollten das Programm anpassen und an die Teilregionen (Kaschin) weiterleiten. Es gab
eine Sitzung der gesetzgebenden Versammlung in Tver, eine mündliche Botschaft des
Gouverneurs und eine Planausarbeitung für die Entwicklung der Tourismusbranche bis
zum Jahr 2020. In Kaschin wurde dem Programm, nach einer Anpassung, zugestimmt. Das
in Kaschin zuvor existierende Programm war bereits im Jahr 2011 ausgelaufen.
118
Ergebnisse
Das Ministerium für Wirtschaftsentwicklung hat ein Monitoring der Tourismusbranche im
Gebiet Tver durchgeführt. Ein Experte aus der Region Tver nahm in diesem Monitoring
Teil. Aus der Erzählung Elena Konstantinovnas folgte, wie sich die Situation weiter
entwickelte. Auf der Grundlage des Monitorings wurden die touristischen Profile der
Regionen, das Entwicklungsprogramm und dessen Anhänge erstellt, welche die
touristischen Angebote jeder Region darstellen. Für die Tourismusentwicklung der Region
Kaschin war die Gründung eines Koordinationsrates für touristische Entwicklung der
Region ein wichtiger Meilenstein. Der Rat besteht aus Unternehmern, Leuten aus der
Abteilung für Kultur und Tourismus, Leuten, die sich für Tourismusentwicklung
interessieren und sich damit beschäftigen möchten. Insgesamt sind es 15 Personen, welche
an der Anpassung des Entwicklungsprogramms für die Region Kaschin arbeiten. Mögliche
Projekte für Kaschin (Kreml in Kaschin, Urlaub am Bauernhof, Stadtpflege) werden
besprochen und diskutiert. Anschließend wird entschieden, ob und wieviel Geld für
Investitionsprogramme, Gebäude und Flächen zu Verfügung stehen. Durchführungs- und
Kontrollmaßnahmen werden vorgeschrieben. Das staatliche Geld ist vor allem für
Öffentlichkeitsarbeit vorgesehen. So wurden Werbebroschüren und eine neue Infowebseite
für Kaschin aus dem Budget bezahlt. Der Experte aus Tver hat bestätigt, dass die
Broschüren bzw. Reiseführer geldabhängig, aber fast jedes Jahr, gedruckt werden. Die
Expertin Elena Konstantinovna versicherte, dass die Perspektiven der Stadt davon
abhängig sind, wieviel Geld für Investitionen vorhanden ist. Elena denkt, dass andere
Faktoren weniger Einfluss auf die künftige Entwicklung haben. Sie ist der Meinung, dass
der Tourismus in Kaschin gute Aussichten habe, wenn es gelingt, in naher Zukunft ein
neues, modernes Hotel für die Touristen zu bauen. Diese Aussage wird durch den Experten
aus Tver bestätigt. Er vertritt die Meinung, dass der Tourismus als Privatbusiness nur dann
sinnvoll ist, wenn der Unternehmer ein Hotel für die Touristen hat oder dieses baut.
Elena Konstantinovna bestätigte, dass einiges in der Region Kaschin gemacht wird,
obwohl die Zeiten schwierig sind. Alle Einwohner versuchen, der Stadt zu helfen. Die
Begrünung, das Pflanzen von Blumen machen die Bewohner freiwillig und ehrenamtlich,
z.B. in der Form eines Subbotniks – eines freiwilligen Arbeitseinsatzes am Wochenende.
Die Stadtverwaltung unterstützt solche Initiativen durch das Bereitstellen eines Fahrzeugs
und eines Fahrers. Aber das begrenzte Budget erlaubt nicht, alle Ideen auf einmal zu
verwirklichen. „ в этом году на 150 тыс. рублей мы сделали работы, по мере
119
Ergebnisse
поступления денег и инициативы координационного совета. мы собераемся, чтото
мы
обсуждаем
и
соглашаемся,
также
выполняем.
Если
появляется
предложения, например Вера Алексеевна всегда очень активна, мы собираем мысли
в кучу потом анализируем…. Общество изучения Кашинского края у нас хорошо
работает, поэтому мы как то работаем в контакте со всеми. вместе мы
работаем и с библиотекой, с туристическими фирмами, с администрацией, с
краеведами, ну круг людей очень большой, людей не безразличных к будущему
Кашина. Лавочки нам подарила страховая компания и так далее»/ „Je nachdem wie
viel Geld zu Verfügung steht und welche Vorschläge der Rat hat, wird eine Versammlung
abgehalten und es wird diskutiert. Vera Alekseevna ist Mitglied des Rates und sehr aktiv.
Wir bringen alle Gedanken und Ideen auf den Tisch und analysieren diese. Wenn alle
Teilnehmer einverstanden sind, werden die Vorhaben in die Tat umgesetzt. In diesem Jahr
2013 hatten wir für die Arbeit ein Budget von 150 Tsd. Rub. (ca. 3330 Euro) zur
Verfügung. Die Forschungsgesellschaft von Kaschin arbeitet auch mit uns zusammen.
Deswegen arbeite ich auch nicht allein, sondern bin ständig im Kontakt mit der Bibliothek,
dem Reiseveranstalter, der Stadtverwaltung und den Heimatkundlern. Der Kreis der Leute,
denen die Zukunft der Region nicht gleichgültig ist, ist sehr groß. Einige
Privatunternehmen
schenken
der
Stadt
Bänke.“
Die
Tourismus-
und
Regionalentwicklungseinrichtungen in Kaschin beschäftigen sich mit dem Tourismus
allgemein, dabei wird kein spezieller Wert auf den Agrartourismus gelegt. Es wird sowohl
auf die Stadt, als auch auf den ländlichen Raum gleich viel geachtet. Bestimmte
Veranstaltungen werden an den Flussufern der Wolga und der Kaschinka im ländlichen
Raum abgehalten, andere in der Stadt Kaschin selbst.
Ljoschas Firma führt seit dem Frühling 2013 die Volksfeste nun unter dem Firmennamen
„Kaschingrad“ durch. Dank diesem Projekt hat eine touristische Nische in der Region zu
Erblühen begonnen. Außerdem hat jemand in der Kaschiner Umgebung offiziell ländlichen
Tourismus zu treiben begonnen. Die Zusammenarbeit in Kaschin war für Ljoscha früher
fast unmöglich, weil keine Ansprechpartner von Seiten der Stadt zur Verfügung standen
(Transkript Zeilenverweis 77.). Eine Hürde, sagt Ljoscha, sei vor allem die mangelnde
Organisation in Kaschin, fehlende Qualität in den touristischen Einrichtungen und
fehlenden Konzepte. Ljoscha ist aber von einer Zusammenarbeit mit Tourismusfirmen
abhängig, um so die Touristen anzuziehen. Er hat sich dabei vor allem auf Moskau
120
Ergebnisse
konzentriert. Von einer Zusammenarbeit mit Kaschin erhofft er eben die Touristenströme
aus Moskau– „«это именно те люди которые продают в Кашине для Москвы, они
должны по идее ко мне привести, в идеале»/ das sind genau die Leute, die aus Kaschin
in Moskau Leute werben sollten, idealerweise sollten sie mir die Kunden bringen,
idealerweise“ (Transkript Zeilenverweis 78-80). Ljoscha erläuterte, dass die Touristen aus
Moskau bereits „alles gesehen haben“ [meinte vermutlich, dass die touristische Sättigung
in Moskau höher ist, als in der Umgebung], was an touristischen Angeboten zu sehen war.
Deshalb ist die Region Kaschin eine neue touristische Möglichkeit für Touristen aus der
Großstadt.
Die Verwaltung in Tver fördert heutzutage die Tourismusentwicklung und unter anderem
auch den Agrartourismus, weil er zum Regionalentwicklungsprogramm der Region Tver
gehört, sagten Ljoscha, die beiden Experten und der Programmtext. Ljoscha ist mit dieser
Entwicklung sehr zufrieden. Seine Firma ist zum touristischen Gesicht der Stadt geworden.
Es geht darum, dass seit dem die Gruppe "sich als offizieller Reiseveranstalter positioniert
hat, es die Verwaltung in Kaschin erlaubt, diese Nische in der Tourismusbranche zu
erschließen". Aus dem Kommentar wird klar, dass diese Nische zuvor von niemandem
besetzt worden war. Ljoscha
bestätigt es mit der folgenden Aussage ", «а щас
губернатор тверской области требует развивать туризм. Требует развивать
интерактивные площадки, еще что то делать.» / Jetzt fordert der Gouverneur von
Tver, den Tourismus zu entwickeln... Interaktive Plattformen sollen unter anderem bei der
Entwicklung helfen..." Das Wort «требует» / „fordern“ vom Gouverneur zeigt, dass der
Anstoß
zur
Entwicklung der
Tourismusbranche
von
oben
kommt.
«но
они
[администрация] не знают как это все делать и им даже, администрации даже
нечем прикрыться.» /"sie [die Verwaltung] wissen nicht, wie man das alles macht, um
dem Tourismus zu helfen. Sie war nicht in der Lage, die Situation zu verbessern, und so
wird ihr Tatenlosigkeit nachgesagt... Zumindest hatten sie nichts bis zum Zeitpunkt, als
sich eine Gruppe aus der Organisation Schar-Ptitsa als offizieller Reiseveranstalter zu
positionieren begann. (Transkript Zeilenverweis 165-167):" sie haben uns natürlich
gebraucht, jetzt sprechen sie über uns bei jeder Besprechung in Tver, letztlich hatten sie
uns auf die touristische Messe, „Otdih 2013“ gebracht"…„Wir kamen Ihnen gerade recht“,
sagte Ljoscha, und dies bedeutet, dass die Stadt Kaschin und das Umland unbedingt den
Tourismus in der Region haben wollen. Ein paar repräsentative und gut funktionierende
121
Ergebnisse
Beispiele geben einen positiven Eindruck vom Tourismus in der Region (Transkript
Zeilenverweis 180-184). Die Gruppe hat sich für die Messe vorbereitet, sie haben die
Informationsbroschüren und Flyer sowie ein Kulturprogramm „auf einem hohen
künstlerischen Niveau ausgearbeitet: erstens, haben wir ein Meisterklasseprogramm für die
Besucher dort veranstaltet - also haben wir die Meister mit Meisterklassen mitgebracht.
Wir hatten dort Akkordeon, Trommel, Balalajka, professionelle Booklets, professionelle
Flyer, drei verschiedene Arten von Flyern, professionelle große Banner…“ Die Messe hat
es letztendlich ermöglicht, einige Kontakte zu knüpfen, und hat sich positiv ausgewirkt.
«мы и сами получили от этого результат, просто потому что мы завязали новые
контакты, новых партнеров нашли, людей, которые хотят ездить в Кашин и
возить сюда туристов, да, но и плюс администрация закрыла у себя брешь, то есть
Кашин на фоне тверской области выглядел действительно лучше в этот раз, то
есть мы выглядели не хуже области, а то и лучше области». / „wir haben also selbst
auch profitiert von der Messe, einfach deswegen, weil wir neue Kontakte geknüpft haben,
neue Geschäftspartner gefunden haben - Leute, die daran interessiert sind, Touristen nach
Kaschin
zu bringen,
und ja, weiters hat
die Verwaltung ihre
Lücken im
Regionalentwicklungsprogramm aufgefüllt, also die Region Kaschin war diesmal im
Gebiet Tver tatsächlich besser, also wir sahen diesmal nicht schlechter aus als der
Gebietsdurchschnitt, aber vielleicht sogar besser.“ Und als ein Ergebnis der Teilnahme
wies Ljoscha auf neue Kontakte, sowie eine Stärkung der Tourismusbranche (u.a. mehr
Touristen, welche für die Firma Beschäftigung und Entwicklung bedeuten) hin. Als Folge
der Messe nannte Ljoscha viele neue Kontakte, welche zum Tourismus in der Region
Kaschin beitragen werden. Ljoscha ist auch froh, dass seine Firma die Region würdig
vorgestellt hatte, und so mehr Touristen in die Region anzuziehen begann. Er hat sich vor
allem auf Moskau und das Gebiet Tver konzentriert. Man erfährt, dass später auch andere
Messen folgten. Ljoscha hat lange einen Zugang zum Moskauer Markt gesucht und hat
diesen u.a. durch Messen erreicht. Als Nachteil bei der Messe nannte er, dass sich ein
schwaches Budget für die Region zeigte, aber auch einen Vorteil sah Ljoscha in der
Gestaltung des Messetages – Seminare und Konzerte, die für die Besucher unterhaltsam
und attraktiv sind.
Ljoscha sprach noch über weitere regionale Projekte. Die Zusammenarbeit mit der Stadt
Beschetsk ergab sich aus einem gemeinsamen Projekt (Transkript Zeilenverweis 220-234).
122
Ergebnisse
Das wird ein großes Projekt, welches vom Ministerium für Kultur und Tourismus des
Gebiets Tver iniziert wurde: «Сейчас мы делаем для тверской области большой
проект на два города, золотое сердце России он называется, это Кашин-Бежецк.»/
„jetzt machen wir für die Gebiete ein großes gemeinsames Projekt auf zwei Städte
bezogen, goldenes Herz Russlands heißt es, „Kaschin-Beschetsk“. Elitäre russische
Kultur“, unterstrich Ljoscha, „Dichter des silbernen Zeitalters.“ Es gibt diese Definition in
der russischen Literatur, welche eine schlichte Dichtkunst der ersten zwei Jahrzehnte des
zwanzigsten Jahrhunderts bezeichnet. In diesem Projekt werden kostümierte/ als Dichter
verkleidete Schauspieler in einer quasi Theateraufführung die Gedichte vortragen, wie z.B.
als Anna Achmatova oder als Sergej Esenin. Diese Dichter haben in der Region gelebt
oder waren dort zu Besuch.
In
den
Regionalentwicklungsstrategien
sind
einige
Anreizmaßnahmen
für
Tourismusentwicklung zu beobachten. Beispielsweise haben interviewte Experten über die
Werbung (informationelle Unterstützung) oder das Monitoring der Region gesprochen. Die
Gründung eines Koordinationsrates wird aus dem Kapitel ebenso ersichtlich. Einiges wird
durch Sammeln und Umsetzen von Ideen bewegt. Auch die Messe Otdych 2013 hat
letztendlich einen positiven Beitrag für Touristenströme in der Region Kaschin und für
Ljoschas Beschäftigung gebracht.
7.7. Politik und Rechtsvorschriften
Dem Leser muss bewusst sein, dass in der Russischen Föderation eine touristische
Tätigkeit als Reiseveranstalter und ein Privatzimmervermittlung im ländlichen Raum für
kurze Zeit nicht dasselbe ist.
Der Tourismus wird durch das Tourismusgesetz FZ 132, das Grundgesetz (Konstitution
RF) sowie das Verbraucherschutzgesetz FZ 234 geregelt, sagte der Experte aus Tver. Er
erzählte weiter: „wenn der Agrartourismus als Privatbusiness wenig Interesse bei der
Bevölkerung weckt, kann das Wirtschaftsministerium private Unternehmen nicht
beeinflussen“. Es gebe die oben genannten Gesetze, sagte er, die das touristische Business
regeln. Die interviewten Personen von touristischen Betrieben haben kaum über rechtliche
Vorschriften gesprochen. Deshalb müssen solche rechtsvorschriftliche Informationen
zusätzlich erläutert werden.
123
Ergebnisse
Die
touristische
Tätigkeit
wird
heutzutage
im
Gebiet
Tver
durch
folgende
Rechtsvorschriften gesteuert: «Федеральным законом от 24.11.1996 № 132-ФЗ «Об
основах туристской деятельности в Российской Федерации», законом Тверской
области от 26.03.1998 № 4-ОЗ-2 «О туристской деятельности в Тверской
области» / das Föderale Gesetz vom 24.11.1996 № 132-FZ „Über die Grundlagen
touristischer Tätigkeit in der Russischen Föderation“ und das Gesetz des Gebiets Tver vom
26.03.1998 № 4-OZ-2 „Über touristische Tätigkeit im Gebiet Tver“.
Außerdem hat das Gebiet Tver zwischen 2009 und 2011 Empfehlungen für den
Tourismusdienstleistungssektor des Gebiets Tver beinhaltende Verordnungen beschlossen.
Der Grund dafür ist, dass laut dem föderalen Gesetz die Regionen kein Recht haben, die
Standards
für
den
Tourismusdienstleistungssektor
auszuarbeiten.
Das
Tourismusentwicklungsprogramm weist ebenso auf folgende Verordnungen hin:
- «распоряжение Администрации Тверской области от 08.09.2009 № 693-ра «Об
утверждении рекомендаций по оказанию туристских услуг в сфере агротуризма на
территории Тверской области» / Verordnung der Administration des Gebiets Tver vom
08.09.2009
№
693-ra
„Über
die
Genehmigung
der
Empfehlungen
für
den
Agrartourismusdienstleistungssektor im Gebiet Tver“
- «распоряжение Администрации Тверской области от 07.12.2010 № 1107-ра «Об
утверждении
рекомендаций
по
проведению
мониторинга
показателей
туристической деятельности в Тверской области» / Verordnung der Administration
des Gebiets Tver vom 07.12.2010 № 1107-ra „Über die Genehmigung der Empfehlungen
für das Monitoring der Kennzahlen der Tourismustätigkeit im Gebiet Tver“
-«распоряжение Администрации Тверской области от 30.12.2010
№ 1199-ра
«Об утверждении примерных требований по оказанию услуг в сфере питания
туристов на территории Тверской области» / Verordnung der Administration des
Gebiets Tver von 30.12.2010 № 1199-ra „Über die Beispielsanforderungen für
Dienstleistungen in der Gastronomie auf dem Territorium des Gebiets Tver“
- «распоряжение Администрации Тверской области от 11.03.2011
№ 225-ра
«Об утверждении рекомендаций по оказанию гостиничных услуг на территории
Тверской области» / Verordnung der Administration des Gebiets Tver vom 11.03.2011
124
Ergebnisse
№
225-ra
„Über
die
Genehmigungen
der
Empfehlungen
für
Unterbringungsdienstleistungen auf dem Territorium des Gebiets Tver“
- «распоряжение Правительства Тверской области от 30.10.2011
№ 229-рп
«Об утверждении рекомендаций по обеспечению безопасности самодеятельных
туристов на территории Тверской области» / Verordnung der Administration des
Gebiets Tver vom 11.03.2011 № 225-ra „Über die Genehmigungen der Empfehlungen für
die
Sicherheitsgewährleistung
der
selbständigen/Eigeniniziativstouristen
auf
dem
Territorium des Gebiets Tver“.
Die durchgeführten Pilotprojekte für die regionale Entwicklung/Tourismus im ländlichen
Raum in dem Gebiet Jaroslawl und der Republik Burjatia weisen auf folgende Prozesse
und Möglichkeiten die touristische Tätigkeit durchzuführen hin:
Für die Tätigkeit, die mit der Privatzimmervermittlung verbunden ist, gibt es zwei
mögliche begleitende Rechtsformen. Folgende Zitate stammen aus dem Pilotprojekt im
Bereich ländlicher Tourismus des Gebiets Jaroslawl.
1.
«Хозяин дома, оказывающий услуги по размещению гостей, работает как
физическое лицо. В этом случае он ежегодно подает в налоговую инспекцию
декларацию
о
доходах,
где
указывает
сумму,
полученную
в
результате
использования собственного имущества, оказывая услуги по краткосрочному
проживанию (ст. 207-208 Налогового кодекса РФ). Сумма налога исчисляется,
исходя из налоговой ставки – 13% (п.1 ст. 224 Налогового кодекса РФ)».
Der Hausbesitzer, der Dienstleistungen in der Beherbergung seiner Gäste gewährleistet,
arbeitet als natürliche Person. In diesem Fall reicht er jährlich bei der Steuerbehörde eine
Einkommenserklärung ein. In der Einkommenserklärung gibt er die Summe an, die er aus
der Nutzung seines Eigentums durch kurzfristige Zimmervermittlung bezieht. (Paragraf.
207-208 Steuerkodex RF). Die Summe der zu entstehenden Steuer wird anhand des
Steuersatzes von 13% kalkuliert (Paragraph 1 Artikel 224 Steuerkodex RF).
2.
«Хозяин дома, оказывающий услуги по размещению гостей, выступает как
индивиду-альный предприниматель без образования юридического лица (ПБОЮЛ).
Для этого необходимо по месту жительства зарегистрироваться в местной
администрации как ПБОЮЛ. Процедура регистрации заключается в получении
свидетельства после уплаты регистрационного сбора и написания заявления о
125
Ergebnisse
регистрации с указанием вида деятельности: «услуги по краткосрочному
проживанию» (ст. 83 Налогового Кодекса РФ).»
Der Hausbesitzer, der Dienstleistungen in der Beherbergung seiner Gäste gewährleistet,
arbeitet als ein individueller Unternehmer ohne Bildung einer juristischer Körperschaft
(PBOJUL). Die Anmeldung der Dienstleistungen für kurzfristige Zimmervermittlung
erfolgt laut Paragraph 83, Steuerkodex RF.
Ein individueller Unternehmer darf sich ein Besteuerungssystem aussuchen:

Das traditionelle Besteuerungssystem beinhaltet die Einkommenssteuer mit einem
Steuersatz von 13%, Einheitssteuer (ESN) 22,8%, MwSt. 18%, Eigentums- und
Grundstücksteuer; die zwei letzten sind unabhängig von der unternehmerischen
Tätigkeit zu bezahlen.

Ein vereinfachtes Besteuerungssystem beinhaltet eine fixierte Quartalszahlung,
ESN 22,8% (bei mehr als 600 000 Rubel), MwSt., Eigentums- und
Grundstücksteuer.

Ein ENVD (single tax on the imputed income) Besteuerungssystem, soll monatlich
avanciert bezahlt werden. Die Steuersumme wird regional bestimmt. Zusätzlich
werden ESN 22,8%, MwSt. 18%, Eigentums- und Grundstücksteuer bezahlt.
Wenn der Unternehmer seine Tätigkeit als Zimmervermittlung anmeldet, wird er
höchstwahrscheinlich das ENVD-Besteuerungssystem benutzen. Wenn er Pferde
vermittelt, Exkursionen oder landwirtschaftliche Erzeugnisse anbietet, wird eher das
vereinfachte Besteuerungssystem (USN) genutzt. Wenn der Landwirt aber nur 0,5 Hektar
Fläche und keine Mitarbeiter außer seiner Familie hat, hat er einen Anspruch auf
Einkommenssteuerbefreiung. Subsidien und Zuschüsse werden in dem Fall auch von der
Einkommenssteuer befreit. Kleine bäuerliche Betriebe haben einen Anspruch auf spezielle
Besteuerungssysteme:
das
vereinfachte
Besteuerungssystem
oder
die
Einheitslandwirtschaftssteuer (ESHN), unter eine Bedingung, dass wenigstens 70% der
betrieblichen Produktion landwirtschaftlichen Erzeugnissen sind.
Außer ENVD Steuersystem hat ein Unternehmer ein Recht ein Steuerungssystem
auszuwählen, deshalb hat der Landwirt von seinen Ziele abhängig das Besteuerungssystem
126
Ergebnisse
auswählen. Kleine Landwirte, wenn sie von der Einkommenssteuer befreit werden
möchten, sollten keine Mitarbeiter außer Familienmitglieder haben. Die Betriebe, die sich
kein Besteurungssystem ausgewählt und gemeldet haben, werden automatisch das
traditionelle nehmen müssen.
In der folgenden Übersicht 4 sind Volliste der Rechtfortschriften, an die ein
agrartouristisches Unternehmen in Burjatischen Republiken achten soll. Die Darstellung
stammt aus einem durchgeführten Pilotprojekt für ländlichen Ökotourismus dient dazu,
dem Leser das Vorgehen eines Unternehmers näher zu bringen. Hier ist anzumerken, dass
der Landwirt seine Tätigkeit nicht als eine Touristische Tätigkeit angibt, sondern als
kurzfristige Zimmervermittlung.
Übersicht 4: Volliste der Rechtsvorschriften für ein Agrarunternehmer
127
Ergebnisse
128
Ergebnisse
129
Ergebnisse
(Quelle: MERZLOV, 2012)
Gewiss ist, dass der Snaip und Medveditsa ein zusammen gegründeter Betrieb war, der auf
zwei Betriebe geteilt wurde. Vermutlich geschah dies aus finanztechnischen Gründen und
hängt mit der Anzahl der Beschäftigten Personen in einem Kleinunternehmen zusammen.
Darauf wurde aber nicht präzise eingegangen. Die von Elena Konstantinovna erwähnten
Privathäuser, die Touristen bei sich aufnehmen, sind streng genommen keine
Tourismusbetriebe. Daher sollten sie sich nicht als Tourismusbetriebe registrieren. Das
zusätzliche Einkommen wird in die Steuererklärung geschrieben.
Ljoscha hat über rechtliche Fragen des Betriebes fast nicht gesprochen. Am Anfang hat er
einen Verein gegründet und seit dem Jahr 2013 haben Ljoscha und Yaroslav den „zweiten“
Betrieb „Kaschingrad“ als Reiseveranstalter registrieren lassen. Als Ljoscha
keine
130
Ergebnisse
Genehmigung dafür hatte, das Catering vorzubereiten, arbeitete er mit einigen
Organisationen zusammen, um die Möglichkeit zu haben, seine Gäste zu bewirten.
7.8. Wirtschaftslage
Im Jahr 2008 gründeten Ljoscha und seine Freunde ein Museum, welches sich den alten
Kaschiner Zeiten widmen sollte (Transkript Zeilen 17-53). Damit hat sich das
Betätigungsfeld der Gruppe um dieses kleine ethnologische Zentrum erweitert.
Ursprünglich war es nicht als ein Objekt für den Massentourismus geplant. Eher konnte
man es mit einem einfachen kleinen Gasthaus vergleichen. Aber im Wandel der Zeit
veränderte sich das Objekt und fungierte als Besichtigungsort für Touristengruppen,
welche die Dörfer Matino und Wosnesenie besichtigten. In einem anderen Haus (der
früheren Dorfbibliothek) richteten sie verschiedene Werkstätten ein. Die Idee dafür hatte
Ljoscha auf einer Reise im Altaj Gebirge. Sie machten eine Weberei und eine Werkstatt
für künstlerische und traditionelle Malerei. Eine Töpferei konnte leider nicht realisiert
werden. Diese Werkstätten werden für Veranstaltungen mit Touristen oder Meisterklassen
genutzt. Das Haus wurde im Sommer auch des Öfteren für Kinderferienlager benötigt. Die
Kinder aus dem Kinderferienlager zählte Ljoscha zu seinen ersten Touristen. Das Projekt
war nicht sehr gewinnbringend, aber Ljoscha konnte dabei viel Erfahrung im Umgang mit
Kindern sammeln: «эти проекты не принесли более или менее внушительные деньги,
там мы практически ничего не заработали, ну, чуть больше нуля вышло из этого
всего, нуу, для меня это был потрясающий опыт. Тогда»/ „Diese Projekte haben kein
oder kaum Geld eingebracht, na ja, ein wenig mehr als eine glatte Null ist davon geblieben.
Na ja, dennoch war es eine fabelhafte Erfahrung für mich. Damals.“ So sind die alten
Kaschiner Gewerbe selbst zu Museumsexponaten geworden. In der Folge hat sich die Idee
entwickelt, diese Gewerbe den Gästen und insbesondere den Kindern zu zeigen und näher
zu bringen. Dieses Gewerbehaus war früher eine Bibliothek und wurde per mündlicher
Vereinbarung zur Verfügung übergegeben. Letztlich passierte es, dass nach zwei Jahren
die Verwaltung des Bezirkes die ehemalige Bibliothek zurücknahm. Jetzt hat sie ihm
vorgeschlagen, sie zu kaufen. Zurzeit suchen Ljoscha und seine Kollegen nach Sponsoren.
(Transkript Zeilen 64-69), «вот два года у нас проработал наш дом творчества,
потом наша местная администрация решила его продать, когда мы его
отремонтировали …администрация предложила нам его за такую достаточно
131
Ergebnisse
большую сумму его выкупать.»/ „Nun, zwei Jahre hindurch hatte unser Haus der Kunst
gute Dienste erwiesen, bevor unsere lokale Verwaltung beschloss, es zu verkaufen,
nachdem wir es renoviert hatten… die Verwaltung hat uns vorgeschlagen das Haus um
eine ausreichend große Summe zurückzukaufen“. Ljoscha
verfolgt auch noch das
Vorhaben, das „Gewerbehaus“, das Haus der ehemaligen Bibliothek, wieder zu
bekommen. Vielleicht ist es möglich, es der Stadt abzukaufen. „наше помещение
библиотеки, то есть там конечно….За то помещение мы еще конечно будем
бороться, наверное»/ “unsere Räumlichkeiten in der Bibliothek, das gibt es natürlich…
für die werden wir wohl auch noch kämpfen müssen, natürlich“, (Transkript Zeilen 189).
Ljoscha
sagte (Zeile 190), dass er dafür momentan kein Geld habe «Средства
непонятно где»/ „Es ist noch unklar, woher die Mittel dafür kommen sollen“. Und es ist
immer noch nicht gewiss, ob die ausreichenden Investitionen in der nächsten Zeit getätigt
werden. In dieser Aussage wies er auf das Fehlen von konkreten Maßnahmen hin. Ljoscha
hofft zwar so, aber nichts ist geplant.
Das Projekt mit dem Kalinin-Museum kann zu der wirtschaftlichen Lage der Region
beitragen, denn das Museum bringt großen Gewinn. Ljoscha erzählte, „...sofort viel Geld.
Das heißt, der Ertrag von einer Exkursion liegt bei 9-10 Tsd. Rubel (ca. 230 Euro). Das ist
zauberhaftes Geld für so ein Museum, kaum vorstellbar". Ljoschas Firma ist eine von
zwei, die Touristen ins Museum bringen. «К Наташе, в музей к Наталье Васильевне
гостей сейчас возим только мы, только мы и Кашинский курорт, то есть два, две
организации которые вообще кого либо приводят»/ „zu Natascha ins Museum, zu
Natalja Vasilevna bringen nur wir und das Sanatorium des Kurorts Kaschin die Touristen.
Es sind also nur die zwei Organisationen, die überhaupt jemanden bringen“. Dieses
Museum besuchen auch einzelne Touristen aus Medveditsa.
Der
Betrieb
Medveditsa ist
aus
dem
Betrieb
Snaip
für Pferdehaltung
und
Pferdemilchherstellung entstanden. Die Pferde sind 5000 Kilometer entfernt in Baschkirien
gekauft und in die Region Kaschin geliefert worden. Zwei Jahre hat es gedauert, bis sich
die Pferde an das neue Klima angepasst haben. Heutzutage wird in diesem Betrieb die
beste Pferdemilch Russlands produziert. In den nächsten Jahren wird der Betrieb beginnen,
aus getrockneter Pferdemilch Kindernahrung herzustellen. Derzeit hat man die
Laborproben der Kindernahrung und einen neu entwickelten Lebensmittelstandard fertig.
Sobald im Jahr 2014 die Fabrik neue Spezialmaschinen bekommt, wird mit der Produktion
132
Ergebnisse
begonnen. Es ist schwer abzuschätzen, ob die touristische Tätigkeit von Medveditsa ohne
Snajp so erfolgreich wäre.
Medveditsa orientiert sich vor allem an Gästen, die nicht aus der Region Kaschin kommen.
Deshalb wissen auch die Experten über den Betrieb nichts Genaues.
Die Expertin aus Kaschin meinte, es sei ein Unternehmen, das nicht für die Öffentlichkeit
gedacht sei, und Ljoscha sagte, dass es ein VIP Publikum habe. Die Wirtschaftslage sei
stabil, sagte Julia. Sie und alle Mitarbeiter freuen sich, dass es den Betrieb in der Region
gibt. Eine andere Arbeit, wo der Gehalt wirklich monatlich ausgezahlt wird, gibt es in der
Nähe nicht.
Im Fallbeispiel Ljoschas ist die Beschäftigung überwiegend durch die Saisonalität geprägt
und hat meist den Charakter einer Teilzeitbeschäftigung nach einem Freelance-Modell. Im
Beispiel ist die Entlohnung abhängig von der Menge an verfügbarer Beschäftigung und
aufgewendeter Arbeitsleistung.
Im Medveditsa-Beispiel sind die Anstellungen der Mitarbeiter fest und dort wird ebenfalls
ein fixer Gehalt ausgezahlt. Die Beschäftigung selbst wird nicht durch die Saisonalität
beeinflusst.
Auch die Expertin aus der Region Kaschin hat deutlich angemerkt, dass die
Touristenströme in der Region durch die Saisonalität stark geprägt sind. Das
Tourismusbüro hat ein Experiment mit Autozählungen durchgeführt. Vor allem
überwiegten hier „fremde Autos“, Autos aus Moskau. Das sieht man an den Autonummern
auf den Straßen in der Region - Moskauer Kennzeichen tragen links oben die Nummern
77, 177, Moskauer Gebiet 50 und 150. Die Touristenströme gehen zurück, sobald die
Sommermonate vorbei sind.
Die Experten in der Tourismusentwicklung bestätigten, dass der Agrartourismus nur eine
sehr kleine Sparte innerhalb des Tourismus ist. Der Agrartourismus bekommt wenig
Unterstützung, nur Reiseführer werden jedes Jahr publiziert. Die Reiseführer sollten der
Region helfen, Touristen anzuziehen, und dienen als Informationsquellen, sagen Experten.
Die Expertin aus der Region Kaschin wies darauf hin, dass das Internet, eine wichtige
Informationsquelle sei, weshalb die Region eine neue Webseite für Kaschin erstellen hat.
133
Ergebnisse
Seine Skepsis begründet der Experte aus Tver mit BIP-Zahlen, weil der Tourismus
wirtschaftlich für die Sowjetunion und auch jetzt für Russland nicht von besonderer
Bedeutung ist. Das BIP des Tourismus lag laut Schätzungen des intervierten Expertes aus
Tver noch zu sowjetischen Zeiten bei einem Niveau von 1-2 % und sollte heutzutage nicht
viel grösser, vielleicht 2-3 % sein. 2012 lag das BIP des Tourismus laut dem
Informationsdienst PROMTURISM bei 3,4%. Mit dem Multiplikatoreffekt bei 6,7%,
berichtete das Infoportal des Kremls (2012), aus der Präsentation des UNSTAT (2009) lag
der Tourismus Anteil des BIP Russlands bei 2,5% und mit dem Multiplikatoreffekt bei
6,3%.
Im Jahr 2012 hat das BRP pro Kopf im Gebiet Tver 4000 Euro erreicht (ROSTATISTIKA,
2014).
Seit
2008
arbeitet
man
daran,
die
touristischen
Sattelitenkonten
im
ROSTATISTIKA zu einzufügen. Die Methodik ist im Jahr 2014 noch nicht eingeführt.
134
Diskussion
7.
DISKUSSION
Die Erreichbarkeit der Region Kaschin liegt an der Grenze einer guten Erreichbarkeit von
den Großstädten ausgehend. Bei gutem Wetter, vor allem im Sommer, kommen die
Touristen vor allem aus Moskau und der Gegend um Moskau. Die Erreichbarkeit wird
durch Regen in den Zwischenzeiten erschwert. Schlechte Wetterbedienungen bringen
wiederrum eine Senkung des Touristenstroms mit sich. VORLAUFER (2003) weist darauf
hin, dass in Ländern mit besonders ausgeprägtem Saisionalität, die Hotels häufiger
schließen und in Folge die Angestellten entlassen werden oder sie erhalten nur einen
geringen Lohn. „Viele Reiseländer bemühen sich auch deshalb um eine Diversifizierung
ihrer Märkte, weil Besucher aus verschiedenen Ländern nicht nur oft regional, sondern
auch ein im Jahresverlauf differenziertes Reiseverhalten haben und so die oft extreme
Saisonalität des Fremdenverkehrs mit ihren negativen Auswirkungen auf Beschäftigung
und Einkommen gemildert werden kann.“
ROBERTS UND HALL (2001) formulierten
für Großbritanien und Schweden „access to the contryside is an obvios prerequisite for
rural recreation and tourism, and growing demand suggests a greater need for access”.
Die touristische Wirtschaftslage der Region Kaschin lässt sich nicht durch BIP-Zahlen
beschreiben. Denn um das BIP des Tourismus ausrechnen zu können, sollte von den
Statistikbehörden der touristische Konsum vom nicht touristischen separat betrachtet
werden. Deshalb ist es zurzeit für Russland nicht möglich direkte und indirekte Effekte des
Tourismus – die Beschäftigungs- und Wertschöpfungseffekte - sowie Multiplikatoreffekte
exakt auszurechnen. Die Tourismussattelitenkonten würden erlauben solche Effekte zu
analysieren. Nun ist die Methodik kompliziert und verlangt besondere Datenerfassung. Seit
dem Jahr 2008 wird daran gearbeitet, die Tourismussattelitenkonten in Russland
einzufügen.
„In Luxusherbergen mit einem breiteren und qualitativ hochwertigen Angebot für eine
einkommensstarke, anspruchsvolle Klientel ist die Zahl der Beschäftigten pro Bett, der
Beschäftigungskoeffizient, höher als z.B. in „Einfach“-Hotels oder in Ferienwohnungen.
So hat z.B. Höfels (1990) Koeffizienten zwischen 0,43 und 0,13 für Hotels oberer
Kategorie und nicht lizensierte einfache Betriebe in Alanya (Türkei) ermittelt. Diese
Relation, nicht aber die Werte, ist nach Erhebungen [Von Vorlaufer] auch für Bali, Kenya,
135
Diskussion
Sri Lanka oder Thailand repräsentativ. Auf Bali z.B. entfielen 1994 auf ein Bett eines
klassifizierten Hotels 0,8 eines nichtklassifizierten Betriebes nur 0,3 Beschäftigte“
(VORLAUFER, 2003). Am Bespiel des Schar-Ptitsa, wird auch ersichtlich, dass
Tagesunterhaltungsprogramme und kurzfristiges Zelten bzw. einfache Unterkünfte weniger
Arbeitsplätze in der Region Kaschin schaffen. „Regionen oder einzelne Standorte z. B. mit
Betrieben vornehmlich für Besucher, die einfache Unterkünfte aufsuchen, haben
vergleichsweise wenig Arbeitsplätze in der Hotellerie. Barbados ist ein Beispiel dafür, dass
mit wachsender Besucheranzahl keine entsprechende Zunahme der Arbeitsplätze im
Beherbergungsgewerbe verbunden sein muss, da die Bettenanzahl vornehmlich in
Unterkünfte für Selbstversorger zunahm (VORLAUFER, 2003). Auch in Sri Lanka
gestiegene Löhne wurden durch einen relativen Arbeitsplatzabbau kompensiert
(VORLAUFER, 2003). Das Fallbeispiel Medveditsa veranschaulicht, dass komfortable
Unterkünfte dem Betrieb feste Anstellungen für die Mitarbeiter erlauben. In Medveditsa
standen entsprechende hohe private Investitionen für den Siedlungsbau zur Verfügung.
VORLAUFER (2003) schrieb, dass Luxushotels pro Bett in der Regel eins bis zwei Mal
mehr Beschäftigte als Einfach-Hotels brauchen, „jedoch ist die Kapitalintensität im
allgemeinen höher“.
Nur jeweils eine Person stand pro Betrieb für das Interview zur Verfügung, es wäre für die
Reliabilität der Arbeit günstiger, mehrere Personen pro Betrieb aus verschiedenen
Hierarchiestufen
zu
interviewen.
Die
Reliabilität
wurde
durch
zusätzliche
Experteninterview, statistische Daten und Literaturrecherchen erhöht.
Nicht nur in der Literatur, auch in den Gesprächen werden verschiedene Begriff- und
Bedeutungssystemen als Basis genutzt. Beim Schreiben dieser Masterarbeit wurde
festgestellt, dass die Befragten sich auf ungleichartige bzw. heterogene Definitionen
stützten. Besonders auffallende Beispiele dafür sind folgende: „Landwirtschaft zu treiben“
oder „Agrartourismus“. Unter Agrarwirtschaft werden nur große Betriebe mit angestelltem
Personal verstanden. Ljoscha beispielsweise hat eine individuelle Hauswirtschaft und
produziert für sich und seine Familie. Er kann sich locker bis in die Frühlingsmonate
ernähren, nennt sich aber weder Landwirt noch nebenberuflicher Landwirt, weil er sich für
Verkauf nicht interessiert.
In der Untersuchungsregion arbeiten nur drei Betriebe im Bereich des ländlichen
Tourismus. Der Tourismus allgemein bleibt in der Region Kaschin weitgehend
136
Diskussion
unentwickelt. Das Tourismusentwicklungsprogramm wurde vor einem Jahr gestartet und
lieferte bisher noch keine Ergebnisse. Im Gebiet Tver gibt es inklusive Kaschin 43
Regionen, und 52 Betriebe, die dem vielfaltigen ländlichen Tourismus zugeordnet werden
können. Ein bis zwei Betriebe pro Region ist nicht viel, wenn man die Fläche Tvers
(ungefähr wie ganz Ungarn) berücksichtigt. Kein Wunder, dass der Experte aus Tver
bezügliche der ländlichen Tourismusentwicklung letztlich skeptisch geblieben ist. Es ist
deshalb noch zu früh, die Beschäftigungseffekte des Agrartourismus in der Region
erforschen zu wollen.
Der Experte aus dem Ministerium für Wirtschaftsentwicklung hat in seinem Interview
sogar versucht vom Forschungsthema abzuraten. Es sei noch zu früh über ländlichen
Tourismus zu sprechen. Das Ministerium hat im Jahr 2013 ein touristisches Monitoring
durchgeführt.Es gibt zwar einige engagierte Personen in der Forschungsregion, aber der
Experte blieb skeptisch, ob diese irgendwann aus ihrem Business einen Gewinn
erwirtschaften werden.
Da nun nicht mehr drei sondern zwei Fallstudien in der Region durchgeführt wurden, war
die Repräsentativität der Case Study mangelhaft. Um sie zu erhöhen wurden zusätzlich
Expertenmeinungen abgefragt. Der Agrartourismus in der Region Kaschin hat heutzutage
fast keine Bedeutung, deshalb war es vielleicht zu früh über die Beschäftigungseffekte zu
sprechen.
137
Zusammenfassung
8.
ZUSAMMENFASSUNG
Die
vorliegende
Masterarbeit
zeigt
die
Rolle
des
Agrartourismus
für
die
Beschäftigungssituation in der Region Kaschin, Russland auf. Die Forschungsfrage der
Masterarbeit ist, welche Beschäftigungseffekte aufgrund des Agrartourismus in der Region
Kaschin in den letzten fünf Jahren zu treffen. Die möglichen Einflussfaktoren auf die
Beschäftigung sind dazu in einem theoretischen Modell zusammengefasst. Ein weiterer
theoretischer Bezug bilden die Exportbasistheorie und der Multiplikatoreffekt. Daten für
die Untersuchung sind mittels qualitativen narrativen Interviews im Rahmen einer
multiple-case study erhoben worden. Die Auswertung erfolgte durch eine qualitative
Inhaltsanalyse.
Die Untersuchungsregion Kaschin befindet sich im Osten des Gebiets Tver, 210 km
nördlich von Moskau. Auf den zwei tausend Quadratkilometer wohnen knapp über 26 Tsd.
Menschen. Die Region hat knapp über neun tausend erwerbstätige Personen, davon sind
sieben tausend in der Wirschaft der Region tätig, die Vebliebene arbeiten in der
Verwaltung und öffentlichen Einrichtungen.
Der Tourismus hat zurzeit wenig Bedeutung für die Region. 160 Personen arbeiteten im
Jahr 2012 in Gastronomie- und Beherbergungsbetrieben. Der Agrartourismus hat noch
weniger Bedeutung. Ein Fallbeispielunternehmen Medveditsa beschäftigt acht Personen,
beherbergt und bewirtet während des ganzen Jahr die Gäste. Der Betrieb Medveditsa hat
seinen Mitarbeitern notwendige spezielle Ausbildung bezahlt und sorgt dafür, dass die
erhaltenen Qualifikationen durch Schulungen und Weiterbildung aktuell bleiben.
Ein anderes Fallbeispielunternehmen Schar-Ptitsa fürht vor allem Volksfeste und
Exkursionen durch. Hat also Tagesaktivitäten für Touristen, aber keine feste Anstellung für
die Mehrheit der Mitarbeiter. Der Betrieb Schar-Ptitsa heisst Leute, die Handwerk
beherrschen, Amateure, Reiseführer als Freelancer oder Volontäre wilkommen. Es geht im
Betrieb
vor
allem
um
eine
Nebenverdienstmöglichkeit.
Die
beiden
Falbeispielsunternehmen beschäftigen weniger als 20 Mitarbeiter.
Die Arbeit zeigt, dass die sensibelsten Einflussfaktoren auf die Beschäftigung die
Infrastruktur, die Erreichbarkeit und die Saisonalität sind. Diese Punkte wurden in den
Interviews am häufigsten angesprochen. Durch die regionalen Wetterbedienungen wird die
138
Zusammenfassung
Erreichbarkeit beeinflusst. Die beiden Betriebe, Medveditsa und Schar-Ptitsa, verbinden
einen Rückgang des Touristenstroms mit den Wetterbedingungen. Die Expertin aus der
Region Kaschin weist ebenso darauf hin. Sobald der Sommer vorbei ist, nehmen die
Autoströme vor allem aus Moskau und dem Gebiet um Moskau kontinuierlich ab. Im
Vergleich zur Moskauer Umgebung bietet das Gebiet Tver nur zögerliche Entwicklung des
Agrartourismus bzw. ländlichen Tourismus. Letztendlich sind viel weniger Touristen
bereit über 200 km in die Natur zu fahren, wenn ähnliches um ein Vielfaches weniger von
der Stadt entfernt liegt.
Anschließend wurde die mangelnde Finanzierung bei den Interviews angesprochen.
Oftmals wurden Finanzierungsprobleme erwähnt, welche letztendlich die Entwicklung der
Tourismusinfrastruktur verhindern oder zumeist verzögern. Die Region Kaschin hat im
Rahmen des Tourismusentwicklungsprogramms keine Finanzierungsmittel bekommen.
Die Wirtschaftslage sowie Tourismusinfrastruktur in der Region ist derzeit für die
Ansiedlung der Agrartourismusbetriebe wenig attraktiv. Dadurch entwickelt sich die
touristische
Infrastruktur
nur
sehr
langsam.
Die
Touristische
Infrastruktur,
Freizeitaktivitäten, vor allem Gastronomiebetriebe sind weitgehend noch nicht vorhanden.
Gastronomiebetriebe gibt es nur sechs, Beherbergungsmöglichkeiten sind ebenso begrenzt.
Die Region Kaschin muss für die Finanzierung des Tourismusentwicklungsprogramms
eigene Finanzierungsmittel lukruieren, was sich ebenfalls verzögernd auf die touristische
Entwicklung auswirkt.
Im Rahmen des Regionalentwicklungsprogramms werden Inizativen und Vorschläge aus
der Region Kaschin mit solchen aus anderen Regionen verglichen und diskutiert. Der
Informationsaustausch hilft, gute Praxisbeispiele zu sammeln, welche in anderen Regionen
ebenfalls umgesetzt werden könnten. Empfehlenswert für die Region wäre eine
Aufklärung im Bereich des Agrartourismus in Form von Workshops für die Bevölkerung.
Dies soll das Interesse der heimischen Bevölkerung für den Agrartourismus wecken.
Einerseits
bietet
der
Agrartourismus
potenzielle
Teilzeit-
und
Vollzeitbeschäftigungsmöglichkeiten und andererseits die Möglichkeit eines zusätzlichen
Einkommens.
Die Einflussfaktoren soziale Einfluss, die Struktur der Landwirtschaft, Politik und
Rechtvorschriften wurden in Intervies wenig oder kaum angesprochen. Der soziale
139
Zusammenfassung
Einfluss auf die Beschäftigungssituation im Agrartourismus in der Region lässt sich nicht
beobachten. Um das Konsumentenverhalten genauer zu beschreiben, wäre eine
Touristenbefragung notwendig. Das System an Rechtvorschriften für die touristischen und
landwirtschaftlichen Unternehmen bietet von der Produktionsstukturt abhänhig mindestens
drei Möglichkeiten die touristische Tätigkeit zu führen.
Seit
2008
wird
in
Russland
daran
gearbeitet,
die
Datenerhebungen
für
Tourismussattelitenkonten anzupassen. Sobald die Tourismussattelitenkonten in die
Statistik eingeführt sind, wird es möglich, die Tourismusauswirkungen zu evaluieren und
Perspektiven abzuschätzen. In der Statistik werden weder Wertschöpfungseffekte und
Beschäftigungseffekte des Tourismus erfasst, noch Agrartourismusdaten.
Die Arbeit veranschaulicht die Hürden und Chancen des ländlichen Tourismus in der
Region und dient als Vorarbeit für eine weiterführende Forschung. Die vorliegende Arbeit
verdeutlicht die Bedeutung des Agrartourismus für die Entwicklung der Region Kaschin.
140
Abbildungsverzeichnis
9.
ABBILDUNGSVERZEICHNIS
Abbildung 1: Berechnung von Wertschöpfungs- und Beschäftigungseffekten (MAYER et
al., 2007) .............................................................................................................................. 22
Abbildung 2: Angenommene Einflussfaktoren auf regionale Beschäftigungseffekte des
Agrartourismus (eigene Darstellung) .................................................................................. 29
Abbildung 3: Bedingungen für Tourismus im Zusammenspiel von regionaler und globaler
Arbeitslosenrate. (Quelle: eigene Darstellung) ................................................................... 30
Abbildung 4: Einkommensverteilung (eigene Darstellung) ................................................ 46
Abbildung 5: Lohn und Beschäftigung im Agrartourismus in einer Teilregion und im
globalen Umfeld (Quelle eigene Darstellung) ..................................................................... 47
Abbildung 6: Suchmaschine des UniSIS (UniSIS, 2014) ................................................... 51
Abbildung 7: Interface von CSBD des GKS (Quelle: CBSD ROSSTATISTIKA, 2014) .. 52
Abbildung 8: Gestaltung einer statistischen Tabelle für eine ausgewählte Kleinregion
online (Quelle: GKS, 2014) ................................................................................................. 53
Abbildung 9: Multiple-case study Methode (Quelle: YIN, 2002)....................................... 57
Abbildung 10: Ablaufmodell der strukturierenden Inhaltsanalyse (allgemein) (Quelle:
Mayring,1997) ..................................................................................................................... 69
Abbildung 11: Ablaufmodell der strukturierenden Inhaltsanalyse anhand des
Analysematerials (Quelle: eigene Darstellung nach Mayring, 2014).................................. 70
Abbildung 12: Karte des Gebiets Tver (Quelle: Karte, 2013 UnSiS) ................................. 73
Abbildung 13: Rural Development Challenges of Russian Regions and Present Policy
Solutions (Quelle: Alexandre Merzlov, Vortrag an der Herbstakademie, Stuttgart 2012) . 74
Abbildung 14: Produktionsvolumen tierischer Erzeugnisse nach Unternehmensart, in Euro
(Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014) .......... 80
Abbildung 15: Produktionsvolumen pflanzlicher Erzeugnisse nach Unternehmensart, in
Euro (Quelle: Datenbank für Gemeindekennzahlen des GKS, eigene Darstellung, 2014) . 81
Abbildung 16: Anzahl der Gäste in Herbergen und Kurbetrieben des Gebiets Tver,, 20022012 (Quelle: UNISIS, eigene Darstellung, 2014) .............................................................. 84
Abbildung 17: Anzahl der Übernachtungen in Herbergen und in Kurbetrieben des Gebiets
Tver, 2002-2012 (Quelle: UNISIS, eigene Darstellung, 2014) ........................................... 84
Abbildung 18: Der Touristenströme in Zentralrussland 2011, Tsd. Personen (Quelle:
Tourismusentwicklungsprogramm für die Region Tver, 2011) .......................................... 85
Abbildung 19: Stadt Kaschin und deren Tourismusinfrastruktur (Quelle: Kaschingrad,
2014) .................................................................................................................................... 89
Abbildung 20: Umgebung der Stadt Kaschin und Tourismusinfrastruktur (Quelle:
Kaschingrad, 2014).............................................................................................................. 89
Abbildung 21:Touristische Siedlung Medveditsa (Quelle: Medveditsa, 2012) .................. 95
141
Tabellenverzeichnis
Abbildung 22: Maskottchenpuppen (Quelle: Schar-Ptitsa, 2014) ....................................... 96
Abbildung 23: Restaurierungsarbeiten im Kloster Klobukov in Kaschin (Quelle: das
private Archiv von Vera Alekseevna Nikonova, 2014) ...................................................... 96
Abbildung 24: Eröffnung des Denkmals der heiligen Patronin der Stadt Kaschin - Anna
Kaschinskaja im Jahr 2009 (Quelle: das private Archiv von Vera Alekseevna Nikonova,
2014) .................................................................................................................................... 97
Abbildung 25: Handwerker und seine Puppen (Quelle: Schar-Ptitsa, 2014) .................... 105
Abbildung 26: Traditionellbemalte Eier (Quelle: Schar-Ptitsa, 2014) .............................. 109
10. TABELLENVERZEICHNIS
Tabelle 1: Reiseveranstalter in der Russischen Föderation ................................................. 51
Tabelle 2: Fläche der Betriebe nach Unternehmensart und Eigentumsart in der Region
Kaschin, ha .......................................................................................................................... 76
Tabelle 3: Flächenverteilung in landwirtschaftlichen Unternehmen in der Region Kaschin
im Zeitraum von 2008 bis 2013, ha ..................................................................................... 77
Tabelle 4: Bäuerliche Betriebe (Farmen) und deren Flächenverteilung 2008-2013, ha ..... 78
Tabelle 5: Flächenverteilung in den Betrieben der Bevölkerung 2008-2013, ha ................ 78
Tabelle 6: Gesamttierbestand in Betrieben aller Kategorien 2008-2012, Stück/Tierkopf .. 79
Tabelle 7: Landwirtschaftliches Produktionsvolumen 2008-2012 in realen Preisen,
umgerechnet in Euro ............................................................................................................ 80
Tabelle 8: Anzahl der Reiseveranstalter ohne Touragenten in Russland 2010-1013,
Unternehmensanzahl ........................................................................................................... 82
Tabelle 9: Tourismusstatistik des Gebiets Tver, 2008-2012 ............................................... 83
Tabelle 10: Tourismuskennzahlen des Gebiets Tver nach Angaben des Monitorings, 2011
............................................................................................................................................. 86
Tabelle
11:
Pessimistische
und
optimistische
Erwartungen
des
Tourismusentwicklungsprogramms für das Gebiet Tver für den Zeitraum 2012 -2020 ..... 87
Tabelle 12: Anzahl der Beschäftigten in der Agrar- und Forstwirtschaft der Region
Kaschin, 2009-2012 ............................................................................................................. 91
Tabelle 13: Anzahl der Beschäftigten in Hotels und Restaurants in der Region Kaschin,
2009-2012 ............................................................................................................................ 91
Tabelle 14: Durchschnittlicher Lohn in der Agrar-, Forst- und Jagdwirtschaft in der Region
Kaschin 2009-2013, Euro .................................................................................................... 92
Tabelle 15: Durchschnittlicher Lohn in Hotels und Restaurants in der Region Kaschin
2009-2013, Euro .................................................................................................................. 92
142
Verzeichnis der Übersichtsverzeichnis
Tabelle 16: Entwicklung der Wohnbevölkerung in der Region Kaschin,2006-2011,
Personen .............................................................................................................................. 93
Tabelle 17: Altersstruktur der Erwerbstätigen Personen in der Region Kaschin 2006-2010
............................................................................................................................................. 93
Tabelle 18: Beschäftigungskennzahlen in der Region Kaschin 2006-2010 ........................ 94
11. VERZEICHNIS DER ÜBERSICHTSVERZEICHNIS
Übersicht 1: Federal State Statistics Service, several types and levels of subdivisions of
Russia .................................................................................................................................. 50
Übersicht 2: case study tactics recommended tests ............................................................. 58
Übersicht 3: Kategorien für die Auswertung und Beispiele aus transkribierten Texten ..... 66
Übersicht 4: Vollisst der Rechtsvorschriften für ein Agrarunternehmer ........................... 127
12. VERZEICHNIS DER ANHÄNGE
Anhang 1: Touristische Themenzonen des Gebiets Twer ................................................. 150
Anhang 2: Flyers zu Tourismusmesse Otdych 2013 ......................................................... 152
143
Quellen- und Literaturverzeichnis
13. QUELLEN- UND LITERATURVERZEICHNIS
ALDA, H.; BELLMANN, L. (2002): Organisatorische Änderungen und betriebliche
Beschäftigungs-und Qualifikationseffekte 1999-2001. MittAB 4: 523-545.
ASHLEY, C. et al. (2007): The role of the tourism sector in expanding economic
opportunity. John F. Kennedy School of Government, Harvard University.
ATTESLANDER, P. (2010): Methoden der empirischen Sozialforschung. 13., neu bearb.
und erw. Aufl., Berlin: <<Erich>> Schmidt.
BAUM, S. (2012): Ausprägung interregionaler Disparitäten und Ansätze zur Entwicklung
ländlicher Räume in Mittel-und Osteuropa. Studies on the agricultural and food sector in
Central and Eastern Europe.
BAXTER, P.; JACK, S. (2008): Qualitative case study methodology: Study design and
implementation for novice researchers. The Qualitative Report 13: 544-559.
BRAMWELL, B.; INTERNATIONAL SCHOOL ON RURAL DEVELOPMENT, G.
(1994): Rural tourism and sustainable rural development
Journal of sustainable tourism. Clevedon, Avon: Channel View Publ.
BRAUN, B.; SCHULZ, C. (2012): Wirtschaftsgeographie. Stuttgart: Ulmer.
BÖVENTER, E. (1989): Ökonomische Theorie des Tourismus. Frankfurt, Main [u.a.]:
Campus-Verl.
CONSTABEL, S.; OYARZÚN, E.; SZMULEWICZ, P. (2011): Agroturismo en Chile
caracterización y perspectivas.
DE OLIVEIRA SANTOS, E.; VIANNA, S. L. G.; GULLO, M. C. R. (2012): Evolución de
la renta, empleo y sueldos en propiedades rurales que ofrecen Agroturismo y Turismo rural
en la Mitad Sur de Rio Grande do Sul, Brasil (1997-2011). El Periplo Sustentable: revista
de turismo, desarrollo y competitividad 27-47.
DEPPERMANN, A. (2008): Gespräche analysieren. 4. Aufl., Wiesbaden: VS, Verl. für
Sozialwiss.
ECKEY, H.-F.; STOCK, W. (2000): Verkehrsökonomie. Wiesbaden: Gabler.
FENTANES, A. (s.a.): Agroturismo: una alternativa de sustentabilidad económica y
ambiental para microempresas agropecuarias.
144
Quellen- und Literaturverzeichnis
FORBORD, M.; SCHERMER, M.; GRIEßMAIR, K. (2012a): Stability and variety –
Products, organization and institutionalization in farm tourism. Tourism Management 33:
895-909.
FORBORD, M.; SCHERMER, M.; GRIEßMAIR, K. (2012b): Stability and variety–
Products, organization and institutionalization in farm tourism. Tourism Management 33:
895-909.
FRANZ, W. (1991): Arbeitsmarktökonomik. Berlin [u.a.]: Springer.
FREYER, W. (2006): Tourismus: Einführung in die Fremdenverkehrsökonomie.
Oldenbourg Verlag.
GAGNON, J. (2012): Cambiar el negocio de la Finca: Un Perfil del Agroturismo en la
provincia de Herrera.
GETZ, D.; CARLSEN, J. (2005): Family business in tourism: State of the Art. Annals of
Tourism Research 32: 237-258.
GLÄSER, J.; LAUDEL, G. (2010): Experteninterviews und qualitative Inhaltsanalyse. 4.
Aufl., Wiesbaden: VS, Verl. für Sozialwiss.
HEINZE, T. (1987): Qualitative Sozialforschung: Erfahrungen. Probleme und
Perspektiven, Opladen.
HEINZE, T. (2001): Qualitative Sozialforschung: Einführung, Methodologie und
Forschungspraxis. Oldenbourg Verlag.
HOLTGREWE, U. (2009): Narratives Interview. Handbuch Methoden der
Organisationsforschung. Springer.
HOPF, C. (2004): 5.2 Qualitative Interviews–ein Überblick. Uwe Flick, Ernst von Kardoff,
Ines Steinke (Hrsgg.) Qualitative Forschung. Ein Handbuch. Reinbeck bei Hamburg:
Rowohlt.(rowohlts enzyklopädie.
INTERNAZIONALE, C.; SULL’AGRITURISMO, I.-T. CIBO, AGRI-CULTURA E
TURISMO.
KASPAR, C. (1990): Einführung in das touristische Management. Bern [u.a.]: Haupt.
KAUNE, K. (2010): Qualitative Techniken–Leitfadeninterview und Inhaltsanalyse. 2010):
Change Management mit Organisationsentwicklung, Veränderungen erfolgreich
durchsetzen 2: 134-152.
KEYNES, J. M. (2009): The General Theory of Employment Interest and Money, London
1936, in deutscher Übersetzung: Allgemeine Theorie der Beschäftigung, des Zinses und
des Geldes, übersetzt von Fritz Waeger, verbessert und um eine Erläuterung des Aufbaus
ergänzt von Jürgen Kromphardt und Stephanie Schneider, 11. Auflage, Berlin.
145
Quellen- und Literaturverzeichnis
KLIEM, T. (2003): Reisemotive, Reiseverhalten und Wahrnehmungen deutscher Touristen
in Norwegen als Grundlage der Entwicklung neuer Konzepte für die norwegische
Tourismuswirtschaft.
KONRAD, K. (2011): Mündliche und schriftliche Befragung. 7., korr. Aufl., Landau in der
Pfalz: Verl. Empirische Pädagogik.
KRAMMER, M. (2006): Schutzgebiete und deren Funktion für die Regionalentwicklungein Vergleich zwischen Österreich und Neuseeland. GRIN Verlag.
KULKE, E. (2013): Wirtschaftsgeographie. UTB.
LAIMER, P.; SMERAL, E. (2004): Ein Tourismus-Satellitenkonto für Österreich. WIFOÖsterr. Inst. für Wirtschaftsforschung.
LAMNEK, S. (1995): Qualitative sozialforschung. Beltz Weinheim.
LANDMANN, O.; JERGER, J. (1999): Beschäftigungstheorie. Berlin [u.a.]: Springer.
LUNDBERG, D. E.; KRISHNAMOORTHY, M. S.; STAVENGA, M. H. (1995): Tourism
economics. New York, NY [u.a.]: Wiley.
MARCOTTE, P.; BOURDEAU, L.; DOYON, M. Agrotourisme, agritourisme et tourisme
à la ferme? Une analyse comparative.
MAYER, M.; PÜTZ, M.; ROSCHEWITZ, A. (2007): Regionalökonomische Effekte des
naturnahen Tourismus im Simmental und Diemtigtal. Schweizerische
Tourismuswirtschaft, Jahrbuch 2007: 207-229.
MAYRING, P. (1997): Qualitative Inhaltsanalyse. 6., durchges. Aufl., Weinheim: Dt.
Studien-Verl.
MAYRING, P. (2010): Qualitative Inhaltsanalyse. 11., aktualisierte u. überarb. Aufl.,
Weinheim [u.a.]: Beltz.
MÜLLER, H. (2002): Freizeit und Tourismus. 9. Aufl., erw. u. aktual., Bern: Univ. Bern,
Forschungsinstitut f. Freizeit u. Tourismus.
OPASCHOWSKI, H. W. (1997): Deutschland 2010: wie wir morgen leben-Voraussagen
der Wissenschaft zur Zukunft unserer Gesellschaft. British-American Tobacco.
OPASCHOWSKI, H. W. (2002): Tourismus. 3., aktualisierte und erw. Aufl., Opladen:
Leske + Budrich.
ORGANISATION FOR ECONOMIC CO-OPERATION AND, D. (1995): Creating
employment for rural development. Paris.
146
Quellen- und Literaturverzeichnis
ORGANISATION FOR ECONOMIC CO-OPERATION AND, D. (1996): Territorial
indicators of employment. Paris: OECD.
RAMSENTHALER, C. (2013): Was ist „Qualitative Inhaltsanalyse?“. Der Patient am
Lebensende. Springer.
ROBERTS, L.; HALL, D. (2001): Rural tourism and recreation. Wallingford [u.a.]: CABI
Publ.
ROMÁN, M.; CICCOLELLA, M. (2009): Turismo rural en la Argentina. Concepto,
situación y perspectivas.
RÖSNER, J.-M.; STOCKERT, N. (2012): Wirtschaftsfaktor Tourismus Deutschland.
Bundesministerium für Wirtschaft und Technologie (BMWi).
SCHMUDE, J.; NAMBERGER, P. (2010): Tourismusgeographie. Darmstadt: WBG
(Wiss. Buchges.).
SCHÄTZL, L. (1998): Wirtschaftsgeographie: Theorie. Schöningh.
SHARPLEY, R.; VASS, A. (2006): Tourism, farming and diversification: An attitudinal
study. Tourism Management 27: 1040-1052.
STRASDAS, W. Ländlicher Tourismus.
STUPPÄCK, S. Ausbildung und Beschäftigung im Tourismus.
TAMME, O. (2002): Beschäftigungseffekte agrar- und regionalpolitischer Maßnahmen.
Wien: Bundesanst. für Bergbauernfragen.
VANHOVE, N. (2011): Economic Characteristics of the Tourism Sector. The Economics
of Tourism Destinations (Second Edition). London, Elsevier.
VORLAUFER, K. (2003): Tourismus in Entwicklungsländern. Westermann.
WEIERMAIR, K.; BIEGER, T. (2008): Unternehmertum im Tourismus: Führen mit
Erneuerungen. Erich Schmidt Verlag GmbH &.
WILLIAMS, A. M.; SHAW, G. (2009): Future play: tourism, recreation and land use.
Land Use Policy 26: S326-S335.
YIN, R. K. (1994): Case study research: design and methods. 2nd. Thousand Oaks, CA:
Sage.
YIN, R. K. (2000): Applications of case study research. 7. [printing], Newbury Park, Calif.
[u.a.]: Sage Publ.
YIN, R. K. (2002): Case study research. 3. ed., Thousand Oaks, Calif. [u.a.]: Sage Publ.
147
Quellen- und Literaturverzeichnis
ZUM MARKT, R. W. V. P. (2004): Peter Voigt Russlands Weg vom Plan zum Markt:
Sektorale Trends und regionale Spezifika.
АЛЕКСАНДРОВА, О. АГРАРНЫЙ ТУРИЗМ–ИСТОЧНИК ИНВЕСТИЦИОННОГО
ДОХОДА СЕЛЬСКИХ ТЕРРИТОРИЙ. Агротуризм: опыт, проблемы, решения:
Материалы Международной 4.
БОНДАРЕНКО, Л. В. (2005): Сельская Россия в начале XXI века (социальный
аспект). Социол. исслед.
БОНДАРЕНКО, Л. В. (2011): Занятость на селе и ресурсное обеспечение
организаций малого бизнеса сельскими безработными. Экономика
сельскохозяйственных и перерабатывающих предприятий 58-62.
БУЙЛЕНКО, В. Ф. (2008): Туризм: учебник. Ростов н/Дону: Феникс.
КАРЯКИН, И. (2011): Методические рекомендации по развитию сети искусственных
гнездовий для балобана в Алтае-Саянском экорегионе. Нижний Новгород.
ОБЛИЦОВА, Е. система агротуриЗма в экономике региона AGRITOURISM IN
SYSTEM ECONOMY OF THE REGION. том сто шестьдесят третий москва 2012 425.
РУПОШЕВ, А. О ВОЗМОЖНОСТИ РАЗВИТИЯ ТРУДОВОГО ТУРИЗМА НА
СЕЛЕ. Агротуризм: опыт, проблемы, решения: Материалы Международной 136.
СЕРОВА, Е. et al. (2004): Сельская бедность и сельское развитие в России. М.:
ИЭПП 50: 11.
(1996): ФЕДЕРАЛЬНЫЙ ЗАКОН ОБ ОСНОВАХ ТУРИСТСКОЙ ДЕЯТЕЛЬНОСТИ
В РОССИЙСКОЙ ФЕДЕРАЦИИ.
(2010): Концепция устойчивого развития сельских территорий Российской
Федерации на период до 2020 года. электронный ресурс, МИНИСТЕРСТВО
СЕЛЬСКОГО ХОЗЯЙСТВА РОССИЙСКОЙ ФЕДЕРАЦИИ
Internetquellen:
Arbeitspapier Bemessung des Arbeitsplatzzuwachses
http://ec.europa.eu/regional_policy/sources/docgener/evaluation/pdf/1_full_de.pdf,
http://www.mend.de/index.php?id=81&tx_ttnews%5Btt_news%5D=67&tx_ttnews%5BbackPid%5D=86&
cHash=3eec4bafa3 abgerufen 14.03.2014
Arbeitspapier zur Bemessung des Arbeitsplatzzuwachses http://www.mend.de/index.php?id=81&tx_ttnews%5Btt_news%5D=67&tx_ttnews%5BbackPid%5D=86&
cHash=3eec4bafa3 abgerufen 14.03.2014
148
Quellen- und Literaturverzeichnis
Bemessung des Arbeitsplatzzuwachses
http://ec.europa.eu/regional_policy/sources/docgener/evaluation/pdf/1_full_de.pdf
Europäische Komission Resultate der regionaler Politik
http://ec.europa.eu/regional_policy/search/index.cfm?x=0&y=0&q=Die+Ma%C3%9Fnah
men+der+Strukturfonds+erzeugen+nicht+nur+Besch%C3%A4ftigungseffekte
Europäische Kommission „Bemessung des Arbeitsplatzzuwachses: Wie können die
Beschäftigungseffekte von Strukturfondsmaßnahmen bewertet werden“ (1997)
http://ec.europa.eu/regional_policy/search/index.cfm?x=0&y=0&q=Die+Ma%C3%9Fnah
men+der+Strukturfonds+erzeugen+nicht+nur+Besch%C3%A4ftigungseffekte
Eurostat-Metadaten über die Tourismusstatistik
http://epp.eurostat.ec.europa.eu/portal/page/portal/tourism/methodology
Federal low on tourism in Russia
http://base.consultant.ru/cons/cgi/online.cgi?req=doc;base=LAW;n=129632
TURPROM Agency
http://base.consultant.ru/cons/cgi/online.cgi?req=doc;base=LAW;n=129632
149
Anhang
14. ANHANG
Anhang 1: Touristische Themenzonen des Gebiets Twer
Приложение 2
к Стратегии развития туризма
Тверской области до 2020 года
в
Туристские зоны Тверской области
 Московское море
Курорт на единой акватории Иваньковского водохранилища вплоть до речного
порта Твери. Водные рекреационные ресурсы для яхтинга, аквабайка, серфинга,
кайтинга, водных лыж, ловли рыбы, охоты, уникальные условия для совмещения
деловых мероприятий с активным отдыхом. Близость к Москве и трассе Москва –
Санкт-Петербург.
 Селигер
Курорт Селигер – центр комплексного круглогодичного туризма на территории
озерно-речной системы «Селигер – Верхневолжские озера». Обширная экологически
150
Anhang
чистая территория с богатейшим археологическим и историко-культурным
наследием. Истоки двух великих рек – Волги и Западной Двины.
 Великое Троеградье
Единый экономический и духовный центр Тверской области, объединяющий
развитую туристскую и информационную инфраструктуру. Сосредоточение
историко-культурных памятников, святынь православной культуры в трех городах –
Твери, Торжке и Старице. Пересечение уникальных туристских маршрутов.
 Балтийская стрела
Экологически чистая природная территория, с уникальными водными ресурсами и
богатейшими условиями для развития экологического, спортивного и промыслового
туризма. Центрально-лесной государственный природный биосферный заповедник –
биосферный резерват ЮНЕСКО. Транспортный коридор в Европу с развитой
инфраструктурой гостеприимства.
 Русская Венеция
Вышневолоцкое Поозерье – крупнейший центр культурно-познавательного водного,
спортивного и этнографического туризма на трассе Москва – Санкт-Петербург в
равном удалении от столиц. Вышний Волочек – уникальный город на водоразделе
Балтийского и Каспийского морей – центр первой в истории России искусственной
гидротехнической системы. Действующий центр реалистической русской живописи.
 Жемчужная нить
Регион, объединяющий возможности малых городов и волжских просторов.
Зона, размыкающая маршруты «Золотого кольца». Уникальные по лечебным
свойствам Кашинские минеральные воды и лечебные грязи.
 Карельская тропа
Национально-культурная автономия тверских карел, сохранивших жизненный уклад
и самобытность своего народа. Центр зимнего и летнего спортивного отдыха.
Сопряжение этнического, аграрного и спортивного туризма.
 Бежецкий верх
Пространство гостеприимства и малых форм туристского бизнеса. Богатейшее
историко-культурное наследие Великого Новгорода. Уникальные возможности для
отдыха и занятий водными видами спорта в акватории Рыбинского водохранилища.
151
Anhang
Anhang 2: Flyers zu Tourismusmesse Otdych 2013
152
Anhang
153
Anhang
154
Anhang
155

Documentos relacionados