Prefeitura Municipal de Valença publica

Сomentários

Transcrição

Prefeitura Municipal de Valença publica
Prefeitura Municipal de Valença
1
Sexta-feira • 11 de Julho de 2014 • Ano VI • Nº 1008
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Prefeitura Municipal de
Valença publica:
• Republicação Aviso Pregão Presencial nº 054/2014 - Objeto: Registro
de Preços para prestação de serviço de manutenção e reparo de motos e
veículos leves e pesados, compreendendo serviços de mecânica em
geral, borracharia, elétricos/eletrônicos e lavagem, p/ as diversas
Secretarias do Município, de acordo com o Edital.
• Aviso Pregão Presencial nº 056/2014 - Objeto: Registro de Preços para
fornecimento de material para telefonia e cabeamento estruturado, que se
destinarão as diversas Secretarias do Município, de acordo com o Edital.
• Aviso Pregão Presencial nº 057/2014 - Objeto: Registro de Preços para
fornecimento de gêneros alimentícios que se destinarão a merenda
escolar da rede municipal de ensino, de acordo com o Edital.
• Edital de Licitação Pregão Presencial nº 054/2014 - Objeto: Prestação
de serviço de manutenção e reparo de motos e veículos leves e pesados,
compreendendo serviços de mecânica em geral, borracharia,
elétricos/eletrônicos e lavagem, visando atender as necessidades das
diversas Secretarias do Município de Valença/BA, conforme
especificações.
• Edital de Licitação Pregão Presencial nº 056/2014 - Objeto: Registro de
preços para eventual contratação de empresa especializada para
fornecimento de material para telefonia e cabeamento estruturado que se
destinarão às diversas Secretarias do Município, conforme especificações
constantes no anexo I, que integra este Edital.
• Edital de Licitação Pregão Presencial nº 057/2014 - Objeto: Registro de
preços para eventual contratação de empresa especializada para
fornecimento de gêneros alimentícios que se destinarão a merenda
escolar da rede municipal de ensino, conforme especificações constantes
no anexo I, que integra este Edital.
Gestor - Jucelia Sousa do Nascimento / Secretário - Governo / Editor - Ass. de Comunicação
Valença - BA
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Sexta-feira
11 de Julho de 2014
2 - Ano VI - Nº 1008
Valença
Licitações
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
3 - Ano VI - Nº 1008
Valença
Editais
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
(',7$/'(/,&,7$d­2
35(*­235(6(1&,$/1ž
2 081,&,3,2 '(9$/(1d$(67$'2'$%$+,$ SRULQWHUPpGLRGD 3UHIHLWXUD0XQLFLSDO
GH 9DOHQoD DWUDYpV GR 35(*2(,52 2),&,$/ H (TXLSH GH $SRLR GHVLJQDGR SHOD 3RUWDULD
GHGHMDQHLURGHWRUQDS~EOLFRSDUDFRQKHFLPHQWRGRVLQWHUHVVDGRVTXHIDUi
UHDOL]DUSURFHGLPHQWROLFLWDWyULRQDPRGDOLGDGH³35(*­235(6(1&,$/´7LSR0(12535(d2
*/2%$/325/27(SHOR6,67(0$'(5(*,6752'(35(d26QRGLDGHMXOKRGH
jV KRUDV FRQIRUPH GHVFULWR QHVWH (GLWDO H VHXV DQH[RV GH FRQIRUPLGDGH FRP DV /HLV
)HGHUDLV Qƒ 'HFUHWRV 0XQLFLSDLV Qž H OHJLVODomR
YLJHQWH
2V HQYHORSHV FRQWHQGR D SURSRVWD GH SUHoR H RV GRFXPHQWRV GH KDELOLWDomR GHYHUmR VHU
HQWUHJXHV DR SUHJRHLUR jV KRUDV GR GLD VHWRU GH OLFLWDomR QD 3UHIHLWXUD
6,78$'$ 3529,625,$0(17( ¬ 58$ &(&Ë/,$ 0(,5(/(6 1ž &(1752
9$/(1d$%$+,$$QWLJR&ROpJLR3DXOR)UHLUH
2VLQWHUHVVDGRVHPFRQKHFHUDtQWHJUDGRHGLWDOHVWHHVWDUiGLVSRQtYHOQRVLWLRHOHWU{QLFRGD
3UHIHLWXUD0XQLFLSDOZZZYDOHQFDEDLRRUJEUHFDVRRLQWHUHVVDGRTXHLUDRHGLWDOLPSUHVVRHVWH
GHYHUiVHGLULJLUD3UHIHLWXUD0XQLFLSDOGH9DOHQoDORFDOL]DGDSURYLVRULDPHQWHj5XD0DUHFKDO
)ORULDQR 3HL[RWR Qž FHQWUR 9DOHQoD %DKLD PHGLDQWH SDJDPHQWR QR YDORU QmR
UHHPEROViYHO5FLQTXHQWDUHDLVUHIHUHQWHDRVFXVWRVFRQIRUPHDUWLJR†žGD/HLQž
'22%-(72'$/,&,7$d­2
2SUHVHQWH3UHJmRWHPSRUREMHWRR5(*,6752'(35(d26SDUDHYHQWXDOFRQWUDWDomRGH
HPSUHVD HVSHFLDOL]DGD SDUD 35(67$d­2 '( 6(59,d2 '( 0$187(1d­2 ( 5(3$52 '(
02726 ( 9(Ë&8/26 /(9(6 ( 3(6$'26 &2035((1'(1'2 6(59,d26 '( 0(&Æ1,&$
(0 *(5$/ %255$&+$5,$ (/e75,&26( /(75Ð1,&26 ( /$9$*(0 YLVDQGR DWHQGHU DV
QHFHVVLGDGHV GDV GLYHUVDV 6HFUHWDULDV GR 0XQLFtSLR GH 9DOHQoD%$ FRQIRUPH HVSHFLILFDo}HV
FRQVWDQWHVQRDQH[R,TXHLQWHJUDHVWH(GLWDO
REGISTRO DE PREÇOS
Lei Federal n° 8.666/93
"Art.15 inciso V parágrafo 4º - A existência de preços registrados não obriga a
Administração a firmar as contratações que deles poderão advir, ficando-lhe
facultada a utilização de outros meios, respeitada a legislação relativa as
licitações, sendo assegurado ao beneficiário do registro preferência em
igualdade de condições."
'$6&21',d®(6'(3$57,&,3$d­2
3RGHUmRSDUWLFLSDUGHVWH3UHJmRRVLQWHUHVVDGRVGRUDPRGHDWLYLGDGHSHUWLQHQWHDRREMHWR
GDFRQWUDWDomRTXHDWHQGHUHPDWRGDVDVH[LJrQFLDVFRQVWDQWHVGHVWH(GLWDOHVHXV$QH[RV
1mR SRGHUmR SDUWLFLSDU GD SUHVHQWH OLFLWDomR RV LQWHUHVVDGRV TXH VH HQTXDGUHP QDV
VHJXLQWHVKLSyWHVHVDVHJXLUHOHQFDGDV
7HQKDP VLGR GHFODUDGRV LQLG{QHRV SDUD OLFLWDU RX FRQWUDWDU FRP D $GPLQLVWUDomR 3~EOLFD
HQTXDQWR SHUGXUDUHP RV PRWLYRV GHWHUPLQDQWHV GD SXQLomR RX DWp TXH VHMD SURPRYLGD D
UHDELOLWDomR SHUDQWH D SUySULD DXWRULGDGH TXH DSOLFRX D SHQDOLGDGH TXH VHUi FRQFHGLGD VHPSUH
TXHRFRQWUDWDGRUHVVDUFLUD$GPLQLVWUDomRSHORVSUHMXt]RVUHVXOWDQWHVHDSyVGHFRUULGRRSUD]R
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
4 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
GD VDQomR DSOLFDGD FRP EDVH QR LQFLVR DQWHULRU LQFLVR ,9 GR DUW GD OHL GH GH
MXQKRGH
4XH VH HQFRQWUHP VRE IDOrQFLD FRQFRUGDWD FRQFXUVR GH FUHGRUHV GLVVROXomR RX
OLTXLGDomR
4XH HP UHJLPH GH FRQVyUFLR TXDOTXHU TXH VHMD VXD IRUPD GH FRQVWLWXLomR VHMDP
FRQWURODGRUDVFROLJDGDVRXVXEVLGLiULDVHQWUHVL
(VWUDQJHLUDVTXHQmRIXQFLRQHPQR3DtV
4XHQmRGHWHQKDPDDWLYLGDGHSHUWLQHQWHHFRPSDWtYHOFRPRREMHWRGHVWH3UHJmR
$SDUWLFLSDomRQDSUHVHQWHOLFLWDomRILFDFRQGLFLRQDGDDRDWHQGLPHQWRDWRGDVDVH[LJrQFLDV
FRQVWDQWHVGHVWH(GLWDOHVHXVDQH[RVFRUUHQGRSRUFRQWDGDVHPSUHVDVLQWHUHVVDGDVWRGRVRV
FXVWRVGHFRUUHQWHVGDHODERUDomRHDSUHVHQWDomRGHVXDVSURSRVWDVQmRVHQGRGHYLGDQHQKXPD
LQGHQL]DomRjVOLFLWDQWHVSHODUHDOL]DomRGHWDLVDWRV
'2&5('(1&,$0(172)25$'26(19(/23(6
$SUHVHQWDU±VHGHYLGDPHQWHFUHGHQFLDGRVFRQIRUPHPRGHOR$QH[R,,,RVUHSUHVHQWDQWHV
OHJDLV GD HPSUHVD OLFLWDQWH RX VHXV SURFXUDGRUHV FRQVWLWXtGRV QD IRUPD GD OHL PXQLGRV GH
FHUWLILFDGRV GH KDELOLWDomR SUpYLD TXDQGR IRU R FDVR 7UDWDQGR±VH GH SURFXUDomR D PHVPD
GHYHUiFRQIHULUDPSORVSRGHUHVSDUDUHSUHVHQWDURXFRPILPHVSHFLILFRSDUDDSUHVHQWHOLFLWDomR
2UHSUHVHQWDQWHGHYHUiDSUHVHQWDURGRFXPHQWRGHLGHQWLILFDomR5*RXRXWURGRFXPHQWRRILFLDO
±'HYHUiRUHSUHVHQWDQWHGDHPSUHVDOLFLWDQWHDSUHVHQWDUMXQWDPHQWHFRPDFUHGHQFLDOD
'HFODUDomR GH PLFURHPSUHVD RX GH HPSUHVD GH SHTXHQR SRUWH REMHWLYDQGR H[HUFtFLR GD
SUHIHUrQFLD SUHYLVWD QD /HL &RPSOHPHQWDU Qž GH DFRUGR FRP R PRGHOR FRPSRVWR SHOR
$QH[R 9,, TXH GHYHUi VHU DSUHVHQWDGD IRUD GRV HQYHORSHV ³³ H ³´ MXQWDPHQWH FRP RV
GRFXPHQWRVGHFUHGHQFLDPHQWRVHQRGLDGHVLJQDGRSDUDRUHFHELPHQWRGRVHQYHORSHV
'$)250$'($35(6(17$d­2'26(19(/23(6³´H³´
'HFODUDGD DEHUWD j VHVVmR SHOR 3UHJRHLUR R V UHSUHVHQWDQWH V GD V OLFLWDQWH V
DSUHVHQWDUimR GHFODUDomR GDQGR FLrQFLD GH TXH FXPSUHP SOHQDPHQWH RV UHTXLVLWRV GH
KDELOLWDomR $QH[R 9 HP HQYHORSH SUySULR H HQWUHJDUimR RV (19(/23(6 /$&5$'26
FRQWHQGR DV SURSRVWDV GH SUHoRV H RV GRFXPHQWRV GH KDELOLWDomR QmR VHQGR DFHLWD D SDUWLU
GHVVHPRPHQWRDDGPLVVmRGHQRYRVOLFLWDQWHV
2V HQYHORSHV ³´ H ³´ FRQWHQGR UHVSHFWLYDPHQWH D SURSRVWD GH SUHoR H GRFXPHQWDomR
UHIHUHQWH j KDELOLWDomR GHYHUmR VHU HQWUHJXHV QD GDWD KRUiULR H ORFDO LQGLFDGRV QR SUHkPEXOR
GHVWHHGLWDOGHYLGDPHQWHODFUDGRVFRQVWDQGRGDIDFHGHFDGDTXDORVVHJXLQWHVGL]HUHV
D(19(/23(3523267$'(35(d26
35()(,785$081,&,3$/'(9$/(1d$%$+,$
35(*­235(6(1&,$/1ž
5$=­262&,$/(1ƒ'2&13-'2/,&,7$17(
E(19(/23('2&80(1726'(+$%,/,7$d­2
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
5 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35()(,785$081,&,3$/'(9$/(1d$%$+,$
35(*­235(6(1&,$/1ƒ
5$=­262&,$/(1ƒ'2&13-'2/,&,7$17(
'$3523267$'(35(d2
$3URSRVWDGH3UHoRVGHYHUiVHUDSUHVHQWDGDHPXPDYLDLPSUHVVDUHGLJLGDFRPFODUH]D
HP OtQJXD SRUWXJXHVD VHP HPHQGDV VHP UDVXUDV RX HQWUHOLQKDV GHYLGDPHQWH GDWDGD H
DVVLQDGDQD~OWLPDIROKDHUXEULFDGDQDVGHPDLVSHORUHSUHVHQWDQWHOHJDOGDOLFLWDQWHQDIRUPDGR
$QH[R,,
1D3URSRVWDGH3UHoRVGHYHUmRFRQVWDUVRESHQDGHGHVFODVVLILFDomR
±5D]mR6RFLDOGDOLFLWDQWH
1žGR&13-0)
(QGHUHoRFRPSOHWR
7HOHIRQH
)D[SDUDFRQWDWR
1žGD&RQWDFRUUHQWHDJrQFLDHUHVSHFWLYR%DQFR
3UD]RGHHILFiFLDGDSURSRVWDRTXDOQmRSRGHUiVHULQIHULRUDVHVVHQWDGLDVFRUULGRV
DFRQWDUGDGDWDGHVXDDSUHVHQWDomR
8PD ~QLFD FRWDomR FRP SUHoRV XQLWiULRV WRWDLV H JOREDLV HP PRHGD FRUUHQWH QDFLRQDO
H[SUHVVRVHPDOJDULVPRVHSRUH[WHQVRVHPSUHYLVmRLQIODFLRQiULD(PFDVRGHGLYHUJrQFLDHQWUH
RV YDORUHV XQLWiULRV H WRWDLV VHUmR FRQVLGHUDGRV RV SULPHLURV H HQWUH RV YDORUHV H[SUHVVRV HP
DOJDULVPRHSRUH[WHQVRVHUiFRQVLGHUDGRHVWH~OWLPR
&RWDomR SRU LWHP FRP YDORUHV XQLWiULRV WRWDLV H JOREDLV FRP D PDUFD GRV SURGXWRV
FRWDGRVQRFDVRGHSURGXWRVLQGXVWULDOL]DGRVVRESHQDGHGHVFODVVLILFDomR
3UD]RGHIRUQHFLPHQWRH[HFXomRQmRVXSHULRUDKTXDUHQWDHRLWRKRUDVFRQWDGRGR
UHFHELPHQWRGD2UGHPGH)RUQHFLPHQWR6HUYLoR
1RVSUHoRVSURSRVWRVGHYHUmRHVWDULQFOXtGRVDOpPGROXFURWRGDVDVGHVSHVDVHFXVWRV
FRPRSRUH[HPSORWUDQVSRUWHOLPSH]DVHJXURVWULEXWRVGHTXDOTXHUQDWXUH]DHWRGDVDVGHPDLV
GHVSHVDV GLUHWDV RX LQGLUHWDV UHODFLRQDGDV FRP D SUHVWDomR GH VHUYLoRV REMHWR GD SUHVHQWH
OLFLWDomR
± 2V SUHoRV RIHUWDGRV SHUPDQHFHUmR IL[RV SHOR SUD]R GH XP DQR D FRQWDU GD GDWD GH
DVVLQDWXUDGD$WDGH5HJLVWURGH3UHoRV
$ DSUHVHQWDomR GDV SURSRVWDV LPSOLFDUi QD SOHQD DFHLWDomR SRU SDUWH GR OLFLWDQWH GDV
FRQGLo}HVHVWDEHOHFLGDVQHVWH(GLWDOHVHXV$QH[RV
6HUmRGHVFODVVLILFDGDVDVSURSRVWDVTXHQmRDWHQGHUHPDVHVSHFLILFDo}HVHH[LJrQFLDVGR
SUHVHQWH (GLWDO H GH VHXV $QH[RV H TXH DSUHVHQWHP RPLVV}HV LUUHJXODULGDGHV RX GHIHLWRV
FDSD]HVGHGLILFXOWDURMXOJDPHQWR
(P QHQKXPD KLSyWHVH SRGHUi VHU DOWHUDGR R FRQWH~GR GD SURSRVWD DSUHVHQWDGD VHMD FRP
UHODomRDSUHoRXQLWiULRSDJDPHQWRSUD]RRXTXDOTXHUFRQGLomRTXHLPSRUWHDPRGLILFDomRGRV
WHUPRVRULJLQDLV
'2-8/*$0(172'$63523267$6
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
6 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
$UWLJRR9,,,,;;;,;,,;9;9,;9,,H;;,,,GD/HLQR
$EHUWRVRVHQYHORSHVDVSURSRVWDVVHUmRUXEULFDGDVSHOR3UHJRHLURHHTXLSHGHDSRLR
/LGR RV SUHoRV R 3UHJRHLUR UHODFLRQDUi WRGDV DV SURSRVWDV HP RUGHP FUHVFHQWH (P
VHJXLGDFODVVLILFDUiDVGHPHQRUSUHoRJOREDOSRUORWH
3DUDMXOJDPHQWRHFODVVLILFDomRGDVSURSRVWDVQDVHVVmRS~EOLFDVHUiDGRWDGRRFULWpULR
GH0(12535(d2*/2%$/325/27(REVHUYDGRVRVSUD]RVPi[LPRVSDUDIRUQHFLPHQWR
$SyVDDEHUWXUDGRVHQYHORSHVFRQWHQGRDVSURSRVWDVGHSUHoRVRDXWRUGDRIHUWDGHYDORU
PDLVEDL[RHRVGDVRIHUWDVFRPSUHoRVDWpGH]SRUFHQWRVXSHULRUHVjTXHODSRGHUmRID]HU
QRYRVODQFHVYHUEDLVHVXFHVVLYRVDWpDSURFODPDomRGRYHQFHGRU
$SyVDSUHVHQWDomRGDSURSRVWDQmRFDEHUiGHVLVWrQFLDVDOYRSRUPRWLYRMXVWRGHFRUUHQWH
GHIDWRVXSHUYHQLHQWHHDFHLWRSHOR3UHJRHLUR
1mRKDYHQGRSHORPHQRVWUrVRIHUWDVQDVFRQGLo}HVGHILQLGDVQRLWHPSRGHUmR
RV DXWRUHVGDV PHOKRUHV SURSRVWDV DWp R Pi[LPR GH WUrV RIHUHFHU QRYRV ODQFHV YHUEDLV H
VXFHVVLYRVTXDLVTXHUTXHVHMDPRVSUHoRVRIHUHFLGRV
1R FDVR GH HPSDWH QRV SUHoRV VHUmR DGPLWLGDV WRGDV DV SURSRVWDV HPSDWDGDV
LQGHSHQGHQWHPHQWHGRQ~PHURGHOLFLWDQWHV
2 SUHJRHLUR FRQYLGDUi LQGLYLGXDOPHQWH RV OLFLWDQWHV FODVVLILFDGRV GH IRUPD VHTHQFLDO D
DSUHVHQWDUODQFHVYHUEDLVDSDUWLUGRDXWRUGDSURSRVWDFODVVLILFDGDGHPDLRUSUHoRJOREDOSRUORWH
HRVGHPDLVHPRUGHPGHFUHVFHQWHGHYDORUJOREDOKDYHUiVRUWHLRHPFDVRGHHPSDWH
± 2V ODQFHV GHYHUmR VHU IRUPXODGRV SRU YDORU JOREDO SRU ORWH HP YDORUHV GLVWLQWRV H
GHFUHVFHQWHVLQIHULRUHVDSURSRVWDGHPHQRUSUHoRFRQVLGHUDQGRRYDORUWRWDOGRORWH
±2LQWHUYDORPtQLPRGHYDORUHQWUHRVODQFHVDVHUHPDSUHVHQWDGRVSHORVOLFLWDQWHVVHUi
GHILQLGRSHORSUHJRHLUR
±$GHVLVWrQFLDHPDSUHVHQWDUODQFHYHUEDOTXDQGRFRQYRFDGRSHORSUHJRHLURLPSOLFDUiD
H[FOXVmR GR OLFLWDQWH GD HWDSD GH ODQFHV YHUEDLV H QD PDQXWHQomR GR ~OWLPR SUHoR DSUHVHQWDGR
SHOROLFLWDQWHSDUDHIHLWRGHRUGHQDomRGDVSURSRVWDV
1mRSRGHUiKDYHUGHVLVWrQFLDGRVODQFHVRIHUWDGRVVXMHLWDQGRVHRSURSRQHQWHGHVLVWHQWH
jVSHQDOLGDGHVFRQVWDQWHVQRLWHPGHVWH(GLWDO
&DVRQmRVHUHDOL]DUHPODQFHVYHUEDLVVHUiYHULILFDGDDFRQIRUPLGDGHHQWUHDSURSRVWD
HVFULWDGHPHQRUSUHoRHRYDORUHVWLPDGRSDUDDFRQWUDWDomR
'HFODUDGD HQFHUUDGD D HWDSD FRPSHWLWLYD H RUGHQDGDV jV SURSRVWDV R SUHJRHLUR
H[DPLQDUi D DFHLWDELOLGDGH GD SULPHLUD FODVVLILFDGD TXDQWR DR REMHWR H YDORU GHFLGLQGR
PRWLYDGDPHQWHDUHVSHLWR
&RQVLGHUDGDDRIHUWDGHPHQRUSUHoRDFHLWiYHOVHKRXYHUSDUWLFLSDomRGH0LFURHPSUHVD
±0(RX(PSUHVDGH3HTXHQR3RUWH(33QRFHUWDPHVHUmRREVHUYDGDVDVGLVSRVLo}HVGD/HL
&RPSOHPHQWDUQž
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
7 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
6H D SURSRVWD GD 0((33 PHOKRU FRORFDGD IRU VXSHULRU HP DWp FLQFR SRU FHQWRGR
YDORUGROLFLWDQWHGHPHOKRURIHUWDVHUiFRQFHGLGRRSUD]RGHFLQFRPLQXWRVSDUDDSUHVHQWDU
SUHoRLQIHULRU
1D KLSyWHVH GD 0((33 PHOKRU FODVVLILFDGD QmR DSUHVHQWDU QRYD SURSRVWD VHUi
FRQYRFDGDDVHJXQGD0((33PHOKRUFODVVLILFDGDHDVVLPVXFHVVLYDPHQWHDWpTXHVHFKHJXH
jPDUJHPGHVXSHULRUDRYDORUGROLFLWDQWHFODVVLILFDGRHPžSULPHLUROXJDU
1mRKDYHQGRQHQKXPDSURSRVWDQDIDL[DGHDWpFLQFRSRUFHQWRVXSHULRUjPHOKRU
RIHUWDRXQmRKDYHQGRQRYDSURSRVWDGH0((33DSURSRVWDRULJLQiULDVHUiFRQVLGHUDGDFRPRD
PHOKRUFODVVLILFDGD
6HQGR DFHLWiYHO D SURSRVWD GH PHQRU SUHoR VHUi DEHUWR R HQYHORSH FRQWHQGR D
GRFXPHQWDomR GH KDELOLWDomR GR OLFLWDQWH TXH D WLYHU IRUPXODGR SDUD FRQILUPDomR GDV VXDV
FRQGLo}HVKDELOLWDWyULDV
&RQVWDWDGR R DWHQGLPHQWR GDV H[LJrQFLDV IL[DGDV QR HGLWDO R OLFLWDQWH VHUi GHFODUDGR
YHQFHGRUVHQGROKHDGMXGLFDGRRREMHWRGRFHUWDPH
6H D RIHUWD QmR IRU DFHLWiYHO RX VH R OLFLWDQWH GHVDWHQGHU jV H[LJrQFLDV KDELOLWDWyULDV R
SUHJRHLUR H[DPLQDUi D RIHUWD VXEVHTHQWH YHULILFDQGR D VXD DFHLWDELOLGDGH H SURFHGHQGR j
KDELOLWDomRGRSURSRQHQWHQDRUGHPGHFODVVLILFDomRHDVVLPVXFHVVLYDPHQWHDWpDDSXUDomRGH
XPD SURSRVWD TXH DWHQGD DR HGLWDO VHQGR R UHVSHFWLYR OLFLWDQWH GHFODUDGR YHQFHGRU H D HOH
DGMXGLFDGRRREMHWRGRFHUWDPH
1DV VLWXDo}HV SUHYLVWDV QRV VXELWHQV H R SUHJRHLUR SRGHUi QHJRFLDU
GLUHWDPHQWHFRPRSURSRQHQWHSDUDTXHVHMDREWLGRSUHoRPHOKRU
'D UHXQLmR ODYUDUVHi DWD FLUFXQVWDQFLDGD QD TXDO VHUmR UHJLVWUDGDV DV RFRUUrQFLDV
UHOHYDQWHV GHYHQGR D PHVPD DR ILQDO VHU DVVLQDGD SHOR 3UHJRHLUR H RV OLFLWDQWHV SUHVHQWHV
UHVVDOWDQGRVH TXH SRGHUi FRQVWDU j DVVLQDWXUD GD HTXLSH GH DSRLR VHQGROKHV IDFXOWDGR HVVH
GLUHLWR
'$+$%,/,7$d­2
$UWLJRR;,,,;,9GD/HLQRFFD/HLQž
2 HQYHORSH ³´ FRQWHQGR D GRFXPHQWDomR UHODWLYD j +DELOLWDomR GHYHUi FRQWHU
REULJDWRULDPHQWHVRESHQDGHLQDELOLWDomRGDOLFLWDQWHRVGRFXPHQWRVDVHJXLULQGLFDGRV
+$%,/,7$d­2-85Ë',&$
D&pGXODGH,GHQWLGDGHGRVVyFLRVLQFOXVLYHHPFDVRGHILUPDLQGLYLGXDO
E$WRFRQVWLWXWLYRHVWDWXWRRXFRQWUDWRVRFLDOHPYLJRUGHYLGDPHQWHUHJLVWUDGRHP
VH WUDWDQGR GH VRFLHGDGHV FRPHUFLDLV H DFRPSDQKDGR QR FDVR GH VRFLHGDGHV SRU
Do}HVGRFXPHQWRVGHHOHLomRGHVHXVDWXDLVDGPLQLVWUDGRUHV
F ,QVFULomR GR DWR FRQVWLWXWLYR QR FDVR GH VRFLHGDGH FLYLO DFRPSDQKDGD GH SURYD GD
GLUHWRULDHPH[HUFtFLR
G 'HFUHWR GH DXWRUL]DomR HP VH WUDWDQGR GH HPSUHVD RX VRFLHGDGH HVWUDQJHLUD HP
IXQFLRQDPHQWRQR3DtV
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
8 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
H7RGDVDVOLFLWDQWHVGHYHUmRDSUHVHQWDUDGHFODUDomRFRQIRUPHPRGHORGR$QH[R,9
DWHVWDQGRTXH
1mR H[LVWH HP VHX TXDGUR GH HPSUHJDGRV VHUYLGRUHV S~EOLFRV H[HUFHQGR
IXQo}HVGHJHUrQFLDDGPLQLVWUDomRRXWRPDGDGHGHFLVmR
,QH[LVWHIDWRVXSHUYHQLHQWHLPSHGLWLYRGHKDELOLWDomRQDIRUPDGR$UW†ž
GD/HL
1mRSRVVXLHPVHXTXDGURGHSHVVRDOHPSUHJDGRVFRPPHQRVGHDQRVHP
WUDEDOKRQRWXUQRSHULJRVRRXLQVDOXEUHHPHQRUGHDQRVHPTXDOTXHUWUDEDOKR
VDOYRQDFRQGLomRGHDSUHQGL]DSDUWLUGHDQRVQRVWHUPRVGRDUWž;;;,,,
GD&RQVWLWXLomR)HGHUDOHDUW9GD/HL
5(*8/$5,'$'(),6&$/75$%$/+,67$
D3URYDGH,QVFULomRQR&DGDVWUR1DFLRQDOGH3HVVRD-XUtGLFD&13-
E 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD )HGHUDO H 'tYLGD $WLYD GD 8QLmR
PHGLDQWH D DSUHVHQWDomR GH &HUWLGmR GH 4XLWDomR GH 7ULEXWRV H &RQWULEXLo}HV
)HGHUDLV H[SHGLGR SHOD 6HFUHWDULD GD 5HFHLWD )HGHUDO GR GRPLFLOLR RX VHGH GR
SURSRQHQWH
F 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD (VWDGXDO PHGLDQWH DSUHVHQWDomR GH
&HUWLGmR GH 5HJXODULGDGH )LVFDO H[SHGLGD SHOD 6HFUHWDULD GD )D]HQGD (VWDGXDO GR
GRPLFLOLRRXVHGHGRSURSRQHQWH
G 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD 0XQLFLSDO PHGLDQWH DSUHVHQWDomR GH
&HUWLGmR GH 5HJXODULGDGH )LVFDO H[SHGLGD SHOD 6HFUHWDULD GD )D]HQGD 0XQLFLSDO GR
GRPLFLOLRRXVHGHGRSURSRQHQWH
H 3URYD GH UHJXODULGDGH UHODWLYD DR )XQGR GH *DUDQWLD SRU 7HPSR GH 6HUYLoR )*76
GHPRQVWUDQGRDVLWXDomRUHJXODUQRFXPSULPHQWRGRVHQFDUJRVVRFLDLVLQVWLWXtGRVSRU
OHL
I 3URYD GH UHJXODULGDGH UHODWLYD D 6HJXULGDGH 6RFLDO MXQWR D 3UHYLGrQFLD 6RFLDO ,166
GHPRQVWUDQGRDVLWXDomRUHJXODUQRFXPSULPHQWRGRVHQFDUJRVVRFLDLVLQVWLWXtGRVSRU
OHL
J &HUWLGmR 1HJDWLYD GH )DOrQFLD H &RQFRUGDWD H[SHGLGD SHOR GLVWULEXLGRU GD VHGH GR
SURSRQHQWHH[SHGLGDDPHQRVGHQRYHQWDGLDVGDDEHUWXUDGDVSURSRVWDV
K$OYDUiGHORFDOL]DomRHIXQFLRQDPHQWRRXGRFXPHQWRHTXLYDOHQWH±HPLWLGRSHOR3RGHU
([HFXWLYR0XQLFLSDO
M3URYDGHLQH[LVWrQFLDGHGpELWRVLQDGLPSOLGRVSHUDQWHD-XVWLoDGR7UDEDOKRPHGLDQWH
DDSUHVHQWDomRGHFHUWLGmRQHJDWLYDQRVWHUPRVGR7tWXOR9,,$GD&RQVROLGDomRGDV
/HLVGR7UDEDOKR
48$/,),&$d­27e&1,&$
D $SUHVHQWDomR GH QR PtQLPR GRLV DWHVWDGRV IRUQHFLGRV SRU SHVVRD MXUtGLFD GH
GLUHLWR S~EOLFR RX SULYDGRV FRPSURYDQGR D UHDOL]DomR GH WUDEDOKRV H[HFXomR GH
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
9 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
VHUYLoRV HRX IRUQHFLPHQWRV FRPSDWtYHLV HP FDUDFWHUtVWLFDV TXDQWLGDGHV H SUD]RV
FRPRREMHWRGHVWDOLFLWDomRFRQIRUPHPRGHORDQH[R9,
48$/,),&$d­2(&21Ð0,&2±),1$1&(,5$
D%DODQoR3DWULPRQLDOHGHPRQVWUDo}HVFRQWiEHLVGHH[HUFtFLRILQDQFHLURGRDQR
TXH FRPSURYHP D ERD VLWXDomR ILQDQFHLUD H RSHUDFLRQDO GD HPSUHVD YHGDGD D VXD
VXEVWLWXLomR SRU EDODQFHWHV RX EDODQoR SURYLVyULRV 1mR VHQGR D OLFLWDQWH REULJDGD D
SXEOLFDURVHXEDODQoRGHYHUiDSUHVHQWDUIRWRFySLDDXWHQWLFDGDGDSiJLQDGR/LYUR'LiULR
RQGH IRL WUDQVFULWR R UHIHULGR EDODQoR H D GHPRQVWUDomR GR UHVXOWDGR GR H[HUFtFLR (VWHV
GRFXPHQWRV GHYHUmR FRQWHU DV DVVLQDWXUDV GH SHOR PHQRV XP VyFLRJHUHQWH H GR
FRQWDGRU UHVSRQViYHO DWUDYpV GR VHOR GH KDELOLWDomR SURILVVLRQDO GHYLGDPHQWH UHJLVWUDGR
QR &RQVHOKR 5HJLRQDO GH &RQWDELOLGDGHV GR (VWDGR RQGH RV PHVPRV IRUDP HIHWXDGRV
FRP RV UHVSHFWLYRV WHUPRV GH DEHUWXUD GH HQFHUUDPHQWR UHJLVWUR QD -XQWD &RPHUFLDO GR
(VWDGRGD6HGHGD/LFLWDQWHRXQR5HJLVWURGH7tWXORVH'RFXPHQWRV
E¬V6RFLHGDGHVHQTXDGUDGDVQRUHJLPHHVWDEHOHFLGRQD/HLQžGHGHGH]HPEUR
GH±/HLGDV0LFURHPSUHVDVHGDV(PSUHVDVGH3HTXHQR3RUWHQmRVHUiH[LJLGRR
%DODQoR 3DWULPRQLDO FRQIRUPH UHJH R $UW GD &RQVWLWXLomR )HGHUDO GHVGH TXH ILTXH
FRPSURYDGRRVHXHQTXDGUDPHQWR
7RGDV DV OLFLWDQWHV GHYHUmR DSUHVHQWDU GHQWUR GR HQYHORSH Qž RV GRFXPHQWRV
HVSHFLILFDGRV SDUD D SDUWLFLSDomR QHVWH 3UHJmR GHYHUmR VHU HQWUHJXHV SUHIHUHQFLDOPHQWH
QXPHUDGRV VHTHQFLDOPHQWH D ILP GH SHUPLWLU FHOHULGDGH QD FRQIHUrQFLD H H[DPH
FRUUHVSRQGHQWHV
6RESHQDGHLQDELOLWDomRWRGRVRVGRFXPHQWRVDSUHVHQWDGRVSDUDKDELOLWDomRGHYHUmRHVWDU
(P QRPH GD OLFLWDQWH H SUHIHUHQFLDOPHQWH FRP QXPHUR GR &13- H FRP HQGHUHoR
UHVSHFWLYR
DVHDOLFLWDQWHIRUDPDWUL]WRGRVRVGRFXPHQWRVGHYHUmRHVWDUHPQRPHGDPDWUL]RX
E VH D OLFLWDQWH IRU ILOLDO WRGRV RV GRFXPHQWRV GHYHUmR HVWDU HP QRPH GD ILOLDO H[FHWR
DTXHOHV GRFXPHQWRV TXH SHOD SUySULD QDWXUH]D FRPSURYDGDPHQWH IRUHP HPLWLGRV
VRPHQWHHPQRPHGDPDWUL]
FRVDWHVWDGRVGHFDSDFLGDGHWpFQLFDUHVSRQVDELOLGDGHWpFQLFDSRGHUmRVHUDSUHVHQWDGRV
HPQRPHHFRP&13-GDPDWUL]HRXGDVILOLDOLVGDOLFLWDQWH
'DWDGRV GRV ~OWLPRV FHQWR H RLWHQWD GLDV DWpD GDWD GH DEHUWXUD GD VHVVmR S~EOLFD
TXDQGRQmRWLYHUSUD]RHVWDEHOHFLGRSHORyUJmRFRPSHWHQWHH[SHGLGRU
D QmR VH HQTXDGUDP QR SUD]R GH TXH WUDWD R LWHP DQWHULRU RV GRFXPHQWRV FXMD YDOLGDGH p
LQGHWHUPLQDGDFRPRpRFDVRGRVDWHVWDGRVGHFDSDFLGDGHUHVSRQVDELOLGDGHWpFQLFD
2VGRFXPHQWRVSUHYLVWRVQHVWH(GLWDOSRGHUmRVHUDXWHQWLFDGRVSHORSUHJRHLURHSHODHTXLSH
GHDSRLRDSDUWLUGRRULJLQDOSUHIHUHQFLDOPHQWHHPPRPHQWRDQWHULRUDR3UHJmR
6HUmRDFHLWDVVRPHQWHFySLDVOHJtYHLV
1mRVHUmRDFHLWRVGRFXPHQWRVFXMDVGDWDVHVWHMDPUDVXUDGDV
2 3UHJRHLUR UHVHUYDVH R GLUHLWR GH VROLFLWDU R RULJLQDO GH TXDOTXHU GRFXPHQWR VHPSUH TXH
WLYHUG~YLGDHMXOJDUQHFHVViULR
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
10 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
2VGRFXPHQWRVQHFHVViULRVjKDELOLWDomRSRGHUmRVHUDSUHVHQWDGRVHPRULJLQDORXHPFySLD
DXWHQWLFDGD SRU FDUWyULR FRPSHWHQWH RX SRU TXDOTXHU VHUYLGRU RX HP SXEOLFDomR GD LPSUHQVD
RILFLDO RX HP FySLDV VLPSOHV GHVGH TXH DFRPSDQKDGDV GRV RULJLQDLV SDUD FRQIHUrQFLD SHOR
3UHJRHLUR
1mRVHUmRDFHLWRVSURWRFRORVGHHQWUHJDRXVROLFLWDo}HVGHGRFXPHQWRHPVXEVWLWXLomRDRV
GRFXPHQWRVUHTXHULGRVQRSUHVHQWH(GLWDOHVHXVDQH[RV
6H D GRFXPHQWDomR GH KDELOLWDomR QmR HVWLYHU FRPSOHWD H FRUUHWD RX FRQWUDULDU TXDOTXHU
GLVSRVLWLYRGHVWH(GLWDOHVHXV$QH[RVR3UHJRHLURFRQVLGHUDUiRSURSRQHQWHLQDELOLWDGR
3RGHUiR3UHJRHLURGHFODUDUTXDOTXHUIDWRIRUPDOGHVGHTXHQmRLPSOLTXHGHVREHGLrQFLDj
OHJLVODomR H IRU HYLGHQWH D YDQWDJHP SDUD D $GPLQLVWUDomR GHYHQGR WDPEpP VH QHFHVViULR
SURPRYHUGLOLJrQFLDSDUDGLULPLUDG~YLGD
&RQVWDWDQGR DWUDYpV GD GLOLJrQFLD R QmR DWHQGLPHQWR DR HVWDEHOHFLGR R 3UHJRHLUR
FRQVLGHUDUiRSURSRQHQWHLQDELOLWDGR
7RGDV DV HPSUHVDV TXH HQVHMDU GHFODUDomR IDOVD RX TXH GHOD WHQKD FRQKHFLPHQWR QRV
WHUPRVGRDUWLJRGR&yGLJR3HQDOILFDUiVXMHLWRjVSHQDVGHUHFOXVmRGHXPDFLQFRDQRVVH
R GRFXPHQWR p S~EOLFR H UHFOXVmR GH XP D WUrV DQRV H PXOWD VH R GRFXPHQWR p SDUWLFXODU
LQGHSHQGHQWHGDSHQDOLGDGHHVWDEHOHFLGDQRDUWLJRžGD/HL)HGHUDOQž
±'26,67(0$'(5(*,6752'(35(d26
2 6LVWHPD GH 5HJLVWUR GH 3UHoRV UHJXODVH SHODV QRUPDV H SURFHGLPHQWRV SUHYLVWRV QR
'HFUHWR0XQLFLSDOQž
1RkPELWRGR6LVWHPDGH5HJLVWURGH3UHoRVDDGMXGLFDomRVLJQLILFDWmRVRPHQWHRUHJLVWUR
GRVSUHoRVRIHUWDGRVVHQGRTXHSDUDDSUHVHQWHFRQWUDWDomRVHUiUHGLJLGDDPLQXWDGRFRQWUDWRH
SRVWRRYDORUUHJLVWUDGRHPDWD
$H[LVWrQFLDGR5HJLVWURQmRREULJDD$GPLQLVWUDomRDHIHWLYDUDVFRQWUDWDo}HVSRUHVVHPHLR
ILFDQGROKH IDFXOWDGD D DTXLVLomR SRU RXWUDV PRGDOLGDGHV UHVSHLWDGD D OHJLVODomR UHODWLYD jV
OLFLWDo}HV VHQGR DVVHJXUDGR j GHWHQWRUD GD $WD R GLUHLWR GH SUHIHUrQFLD HP LJXDOGDGH GH
FRQGLo}HV
8PDYH]UHJLVWUDGRVRVSUHoRVD$GPLQLVWUDomRSRGHUiFRQYRFDUDGHWHQWRUDGR5HJLVWUR
D IRUQHFHU RV UHVSHFWLYRV PDWHULDLV H H[HFXWDU RV VHUYLoRV QD IRUPD H FRQGLo}HV IL[DGDV QR
SUHVHQWH(GLWDOHQD$WDGH5HJLVWURGH3UHoRV
'$,038*1$d­2'2$72&2192&$7Ï5,2
$WpGRLVGLDV~WHLVDQWHVGDGDWDIL[DGDSDUDUHFHELPHQWRGDVSURSRVWDVTXDOTXHUSHVVRD
SRGHUiVROLFLWDUHVFODUHFLPHQWRVSURYLGrQFLDVRXLPSXJQDURSUHVHQWHHGLWDO
&DEHUiDRSUHJRHLURGHFLGLUVREUHDSHWLomRQRSUD]RGHYLQWHHTXDWURKRUDV
$FROKLGDjSHWLomRFRQWUDRDWRFRQYRFDWyULRVHUiGHVLJQDGDQRYDGDWDSDUDDUHDOL]DomRGR
FHUWDPH
$ RFRUUrQFLD GH LPSXJQDomR GH FDUiWHU PHUDPHQWH SURWHODWyULR HQVHMDQGR DVVLP R
UHWDUGDPHQWR GD H[HFXomR GR FHUWDPH D DXWRULGDGH FRPSHWHQWH SRGHUi DVVHJXUDGR R
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
11 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
FRQWUDGLWyULR H DPSOD GHIHVD DSOLFDU D SHQD HVWDEHOHFLGD QR DUWLJR ž GD /HL Qž H
OHJLVODomRYLJHQWH
4XHP LPSHGLU SHUWXUEDU RX IUDXGDU DVVHJXUDGR R FRQWUDGLWyULR H D DPSOD GHIHVD D
UHDOL]DomRGHTXDOTXHUDWRGRSURFHGLPHQWROLFLWDWyULRLQFRUUHUiHPSHQDGHGHWHQomRGHGRLV
DWUrVDQRVHPXOWDQRVWHUPRVGRDUWLJRGD/HL
'265(&85626
$UWLJRR;9,,,;,;;;H;;,GD/HLQR
'HFODUDGR R YHQFHGRU TXDOTXHU OLFLWDQWH SRGHUi PDQLIHVWDU PRWLYDGDPHQWH D LQWHQomR GH
UHFRUUHU TXDQGR OKH VHUi FRQFHGLGR R SUD]R GH WUrV GLDV SDUD DSUHVHQWDomR GDV UD]}HV GR
UHFXUVRILFDQGRRVGHPDLVOLFLWDQWHVGHVGHORJRLQWLPDGRVSDUDDSUHVHQWDUFRQWUDUD]}HVHPLJXDO
Q~PHUR GH GLDV TXH FRPHoDUmR D FRUUHU GR WpUPLQR GR SUD]R GR UHFRUUHQWH VHQGROKHV
DVVHJXUDGDYLVWDLPHGLDWDGRVDXWRV
$IDOWDGHPDQLIHVWDomRLPHGLDWDHPRWLYDGDGROLFLWDQWHLPSRUWDUiDGHFDGrQFLDGRGLUHLWRGH
UHFXUVRHDDGMXGLFDomRGRREMHWRGDOLFLWDomRSHORSUHJRHLURDRYHQFHGRU
2UHFXUVRFRQWUDGHFLVmRGR3UHJRHLURQmRWHUiHIHLWRVXVSHQVLYR
2 DFROKLPHQWR GH UHFXUVR LPSRUWDUi D LQYDOLGDomR DSHQDV GRV DWRV LQVXVFHWtYHLV GH
DSURYHLWDPHQWR
'HFLGLGRRVUHFXUVRVDDXWRULGDGHFRPSHWHQWHIDUiDDGMXGLFDomRGRREMHWRGDOLFLWDomRDR
OLFLWDQWHYHQFHGRU
2VDXWRVGRSURFHGLPHQWRSHUPDQHFHUmRFRPYLVWDIUDQTXHDGDDRVLQWHUHVVDGRVQR6HWRU
GH/LFLWDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
1D RFRUUrQFLD GH PDQLIHVWDomR RX LQWHUSRVLomR GH UHFXUVR GH FDUiWHU PHUDPHQWH
SURWHODWyULRHQVHMDQGRDVVLPRUHWDUGDPHQWRGDH[HFXomRGRFHUWDPHDDXWRULGDGHFRPSHWHQWH
SRGHUiDVVHJXUDGRRFRQWUDGLWyULRHDDPSODGHIHVDDSOLFDUDSHQDHVWDEHOHFLGDQRDUWLJRžGD
/HLQžHOHJLVODomRYLJHQWH
±'$$7$'(5(*,6752'(35(d26
± (QFHUUDGR R SURFHVVR OLFLWDWyULR SDUD 5HJLVWUR GH 3UHoRV D $GPLQLVWUDomR UHVSHLWDGD D
RUGHP FRQYRFDUi D DGMXGLFDWiULD H DV LQWHUHVVDGDV UHPDQHVFHQWHV GHVGH TXH HVWDV WHQKDP R
LQWHUHVVHHPDVVLQiODSHORSUHoRREWLGRSUD]RGHHQWUHJDHGHPDLVFRQGLo}HVGHIRUQHFLPHQWR
GD SULPHLUD FRORFDGD SDUD GHQWUR GR SUD]R GH FLQFR GLDV ~WHLV D FRQWDU GD GDWD GH
UHFHELPHQWRGDQRWLILFDomRDVVLQDUHPD$WDGH5HJLVWURGH3UHoRVFXMDPLQXWDLQWHJUDHVWHHGLWDO
$QH[R 9,,, H TXH DSyV SXEOLFDGD WHUi HIHLWR GH FRPSURPLVVR GH IRUQHFLPHQWR QDV FRQGLo}HV
HVWDEHOHFLGDVQRSUHVHQWHGRFXPHQWRHGLWDOtFLR
±4XDQGRDDGMXGLFDWiULDHDVGHPDLVLQWHUHVVDGDVDRVHUHPFRQYRFDGDVQmRDVVLQDUHPD
$WD GH 5HJLVWUR GH 3UHoRV QR SUD]R H FRQGLo}HV HVWDEHOHFLGRV VHUi IDFXOWDGR j $GPLQLVWUDomR
VHP SUHMXt]R GH VH DSOLFDU D VDQomR SUHYLVWD QHVWH HGLWDO FRQYRFDU DV OLFLWDQWHV VHJXLQWHV QD
RUGHPGHFODVVLILFDomRSDUDID]HOR
±)RUPDOL]DGDD$WDGH5HJLVWURGH3UHoRVGXUDQWHVXDYLJrQFLDDHPSUHVDGHWHQWRUDHVWDUi
REULJDGDDRVHXFXPSULPHQWREHPFRPRDRGHWRGDVDVGHPDLVFRQGLo}HVHVWDEHOHFLGDVQHVWH
HGLWDOVHPSUHMXt]RGHVHUHPDSOLFDGDVDVVDQo}HVFDEtYHLVFRQVWDQWHVGHVWHHGLWDO
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
12 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
±'235$=2'(9$/,'$'('$$7$
$$WDGH5HJLVWURGH3UHoRVWHUiYDOLGDGHGHXPDQRFRQWDGRDSDUWLUGDGDWDGHVXD
DVVLQDWXUDSRGHQGRVHUSURUURJDGRDFULWpULRGD$GPLQLVWUDomR
±'2)251(&,0(172((;(&8d­2
±2IRUQHFLPHQWRGRPDWHULDOHRXDH[HFXomRGRVHUYLoRVHUiHIHWXDGRDSyVDDVVLQDWXUDGR
FRQWUDWR PHGLDQWH HQFDPLQKDPHQWR SHOD 6HFUHWDULD FRPSHWHQWH GH 1RWD GH (PSHQKR TXH
FRUUHVSRQGH j DXWRUL]DomR GH HQWUHJD HRX H[HFXomR GHYHQGR QHOD FRQVWDU HVSHFLILFDo}HV GR
PDWHULDOHRXVHUYLoRTXDQWLWDWLYRSUD]RORFDOGHHQWUHJDHSUHoRVXQLWiULRHWRWDO
±'XUDQWHDYLJrQFLDGD$WDGH5HJLVWURGH3UHoRVVXDGHWHQWRUDILFDREULJDGDDIRUQHFHUR
PDWHULDOHRXH[HFXWDURVHUYLoRGHDFRUGRFRPRSUHoRUHJLVWUDGRQDVTXDQWLGDGHVLQGLFDGDVHP
FDGD1RWDGH(PSHQKR
± 2 0XQLFtSLR GH 9DOHQoD%$ QmR HVWi REULJDGR D DGTXLULU TXDOTXHU TXDQWLGDGH GR REMHWR
OLFLWDGR H LJXDOPHQWH D VROLFLWDU TXDOTXHU GRV VHUYLoRV ILFDQGR D VHX H[FOXVLYR FULWpULR GHILQLU D
TXDQWLGDGHHRPRPHQWRGDDTXLVLomRHH[HFXomRGDTXHOHVGHDFRUGRFRPDVQHFHVVLGDGHVGD
$GPLQLVWUDomR
±$GHWHQWRUDQmRSRGHUiVHPPRWLYRMXVWRGHYLGDPHQWHFRPSURYDGRHLQIRUPDGRUHFXVDU
VHDIRUQHFHURVPDWHULDLVHRXH[HFXWDURVVHUYLoRVVROLFLWDGRVSHOR0XQLFtSLRGH9DOHQoD%$
±2VPDWHULDOLVSURGXWRVVHUimRGHYROYLGRVRXVHUYLoRVVHUmRUHFXVDGRVQDKLSyWHVH
GHDSUHVHQWDULUUHJXODULGDGHVQmRFRUUHVSRQGHUjVHVSHFLILFDo}HVGD$WDGH5HJLVWURGH3UHoRV
RX HVWDU IRUD GRV SDGU}HV GHWHUPLQDGRV GHYHQGR VHU VXEVWLWXtGRV SHOD HPSUHVD GHWHQWRUD GD
$WDQRSUD]RPi[LPRGHTXDUHQWDHRLWRKRUDVDFRQWDUGDQRWLILFDomRVRESHQDGHDSOLFDomR
GDVSHQDOLGDGHVSUHYLVWDVQHVWHHGLWDO
±'235$=2(/2&$/3$5$(175(*$((;(&8d­2'266(59,d26
2V SURGXWRVVHUYLoRV VHUmR HQWUHJXHVH[HFXWDGRV GH XPD Vy YH] RX SDUFHODGDPHQWH
FRQIRUPH2UGHPGH)RUQHFLPHQWR6HUYLoRQRSUD]RQmRVXSHULRUDKTXDUHQWDHRLWRKRUDV
FRQWDGRVGDGDWDGHUHFHELPHQWRGD6ROLFLWDomRGH)RUQHFLPHQWRHRX([HFXomR
2IDWXUDPHQWRGHYHUiVHUHPLWLGRSDUD
35()(,785$ 081,&,3$/ '( 9$/(1d$ LQVFULWD QR &13- VRE R Qž FRP
VHGHD7UDYHVVD*HQHUDO/DEDWXWVQžFHQWUR9DOHQoD%DKLD
±'25(&(%,0(172'22%-(72
±&DVRSRUTXDOTXHUUD]mRQmRSRVVDVHUSURFHVVDGRRUHFHELPHQWRGHILQLWLYRQRPRPHQWR
GD HQWUHJD R REMHWR OLFLWDGR VHUi UHFHELGR SURYLVRULDPHQWH FRP HIHLWR LPHGLDWR SDUD SRVWHULRU
YHULILFDomR GH VXD FRQIRUPLGDGH FRP DV HVSHFLILFDo}HV FRQVWDQWHV QD 1RWD GH (PSHQKR H
UHVSHFWLYRGRFXPHQWRILVFDO
± 2 DFHLWHDSURYDomR GRV PDWHULDOLV H VHUYLoRV SHOR yUJmR OLFLWDQWH QmR H[FOXL D
UHVSRQVDELOLGDGHFLYLOGRVIRUQHFHGRUHVSRUYtFLRVGHTXDQWLGDGHRXTXDOLGDGHGRVPDWHULDOLV
H VHUYLoRV YHULILFDGDV SRVWHULRUPHQWH JDUDQWLQGRVH DR yUJmR OLFLWDQWH DV IDFXOGDGHV SUHYLVWDV
QRDUWGD/HLQž
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
13 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&RPRFRQGLomRSDUDHPLVVmRGD³1RWDGH(PSHQKR´ROLFLWDQWHYHQFHGRUGHYHUiHVWDUFRP
D GRFXPHQWDomR REULJDWyULD YiOLGD SHUDQWH D )D]HQGD (VWDGXDO H DLQGD SHUDQWH D )D]HQGD
)HGHUDOD6HJXULGDGH6RFLDO,166HDR)XQGRGH*DUDQWLDSRU7HPSRGH6HUYLoR)*76
6H DV FHUWLG}HV UHIHULGDV QD IDVH GH KDELOLWDomR QmR FRPSURYDUHP D VLWXDomR UHJXODU GD
HPSUHVD DGMXGLFDWiULD D VHVVmR VHUi UHWRPDGD H RV GHPDLV OLFLWDQWHV FKDPDGRV QD RUGHP GH
FODVVLILFDomR SDUD ID]rOR QDV PHVPDV FRQGLo}HV GD SULPHLUD FRORFDGD REVHUYDGR TXH R
SUHJRHLUR H[DPLQDUi D DFHLWDELOLGDGH TXDQWR DR REMHWR VHP SUHMXt]R GD DSOLFDomR GDV VDQo}HV
FDEtYHLV
$FRQWUDWDQWHILFDUiREULJDGDDDFHLWDUQDVPHVPDVFRQGLo}HVGHVWHHGLWDORVDFUpVFLPRV
RX VXSUHVV}HV TXH VH IL]HUHP QHFHVViULRV DWp YLQWH H FLQFR SRU FHQWR GR YDORU LQLFLDO
DWXDOL]DGRGRREMHWRDGMXGLFDGRGHYHQGRVXSUHVV}HVDFLPDGHVVHOLPLWHVHUUHVXOWDQWHGHDFRUGR
HQWUHDVSDUWHV
6HDOLFLWDQWHYHQFHGRUDQmRFXPSULURSUD]RHVWLSXODGRQHVWHHGLWDORXUHFXVDUVHDUHWLUDUD
³1RWD GH (PSHQKR´ VHP MXVWLILFDWLYD IRUPDOPHQWH DFHLWD SHOR 3UHIHLWR 0XQLFLSDO GH 9DOHQoD
GHFDLUi GR GLUHLWR GH IRUQHFHU RV REMHWRV DGMXGLFDGRV VXMHLWDQGRVH jV SHQDOLGDGHV GLVSRVWDV
QHVWH(GLWDOGH3UHJmR
$3UHIHLWXUD0XQLFLSDOGH9DOHQoDQRVWHUPRVSUHYLVWRVQHVWHHGLWDOGHYHUi
5HFHEHURVSURGXWRVHDFHLWDUDH[HFXomRGRVVHUYLoRVDGMXGLFDGRVQRVWHUPRVSUD]RV
TXDQWLGDGHTXDOLGDGHHFRQGLo}HVHVWDEHOHFLGDVQHVWHHGLWDO
2VSURGXWRVVHUYLoRVVHUmRUHFXVDGRVHGHYROYLGRVQDVVHJXLQWHVKLSyWHVHV
D 1RWD ILVFDO FRP HVSHFLILFDomR H TXDQWLGDGHV HP GHVDFRUGR FRP R GLVFULPLQDGR QD QRWD GH
HPSUHQKR
E(QWUHJXHVHPGHVDFRUGRFRPDVHVSHFLILFDo}HVGRVUHTXLVLWRVREULJDWyULRVGHVWHHGLWDO
F$SUHVHQWHPYtFLRVGHTXDOLGDGHRXLPSURSULHGDGHSDUDRXVR
2UHFHELPHQWRSURYLVyULRGRSURGXWRVHUYLoRDGMXGLFDGRQmRLPSOLFDVXDDFHLWDomR
2 UHFHELPHQWR GHILQLWLYR GDUVHi SHOR 6HUYLGRU QRPHDGR SHOD 3UHIHLWXUD SDUD
UHFHELPHQWR GRV SURGXWRV DSyV DYHULILFDomRGR FXPSULPHQWR GDV HVSHFLILFDo}HV GRV SURGXWRV
QRV WHUPRV GHVWH (GLWDO H VHXV DQH[RV H GD SURSRVWD DGMXGLFDWiULD QR SUD]R GH GRLV GLDV
~WHLVFRQWDGRVGRUHFHELPHQWRSURYLVyULR
(IHWXDU R SDJDPHQWR DSyV R UHFHELPHQWR GHILQLWLYR GRV SURGXWRV HRX H[HFXomR GRV
VHUYLoRVPHGLDQWHGHSyVLWREDQFiULRFKHTXHUHFLERRXHPPRHGDFRUUHQWHDWpRƒWULJpVLPR
GLD FRQWDGR D SDUWLU GR UHFHELPHQWR GD )DWXUD1RWD )LVFDO FRPXP H HOHWU{QLFD H GHYLGDPHQWH
DWHVWDGRSHOR6HWRUFRPSHWHQWHGD6HFUHWDULD0XQLFLSDO
'$66$1d®(6$'0,1,675$7,9$6
$UWLJRžGD/HLQR
H$UWLJRVHGD/HLQž
2GHVFXPSULPHQWRLQMXVWLILFDGRGDVREULJDo}HVDVVXPLGDVQRVWHUPRVGHVWHHGLWDOVXMHLWDD
OLFLWDQWHRXDFRQWUDWDGDDPXOWDVFRQVRDQWHRcaput H††GRDUWGD/HLQƒLQFLGHQWHV
VREUHRYDORUGD1RWDGH(PSHQKRQDIRUPDVHJXLQWH
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
14 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
6HPSUHMXt]RGDVVDQo}HVFRPLQDGDVQRDUW,,,,H,9GD/HLSHODLQH[HFXomR
WRWDORXSDUFLDOGRREMHWRDGMXGLFDGRD3UHIHLWXUD0XQLFLSDOGH9DOHQoDSRGHUiJDUDQWLGDSUpYLDH
DPSODGHIHVDDSOLFDUjFRQWUDWDGDPXOWDGHDWpGH]SRUFHQWRVREUHRYDORUDGMXGLFDGR
6H D DGMXGLFDWiULD UHFXVDUVH D UHWLUDU D QRWD GH HPSHQKR LQMXVWLILFDGDPHQWH RX VH QmR
DSUHVHQWDU VLWXDomR UHJXODU QR DWR GD IHLWXUD GD PHVPD JDUDQWLGD D SUpYLD H DPSOD GHIHVD
VXMHLWDVHjVVHJXLQWHVSHQDOLGDGHV
PXOWDGHDWpVREUHRYDORUFRQWUDWDGR
VXVSHQVmR WHPSRUiULD GH SDUWLFLSDU GH OLFLWDo}HV H LPSHGLPHQWR GH FRQWUDWDU FRP D
35()(,785$081,&,3$/'(9$/(1d$SRUSUD]RGHDWpGRLVDQRVH
GHFODUDomRGHLQLGRQHLGDGHSDUDOLFLWDURXFRQWUDWDUFRPDDGPLQLVWUDomRS~EOLFD
$OLFLWDQWHDGMXGLFDWiULDRXFRQWUDWDGDTXHGHL[DUGHHQWUHJDURXDSUHVHQWDUGRFXPHQWDomR
IDOVDH[LJLGDSDUDRFHUWDPHHQVHMDURUHWDUGDPHQWRGDH[HFXomRGHVHXREMHWRQmRPDQWLYHUD
SURSRVWDIDOKDURXIUDXGDUQDH[HFXomRGRFRQWUDWRFRPSRUWDUVHGHPRGRLQLG{QHRRXFRPHWHU
IUDXGH ILVFDO JDUDQWLGD D SUpYLD H DPSOD GHIHVD ILFDUi LPSHGLGD GH OLFLWDU H FRQWUDWDU FRP R
0XQLFtSLRSHORSUD]RGHDWpFLQFRDQRVHVHPSUHMXt]RGDDomRSHQDOFRUUHVSRQGHQWHQDIRUPD
GDOHL
$PXOWDHYHQWXDOPHQWHLPSRVWDjFRQWUDWDGDVHUiDXWRPDWLFDPHQWHGHVFRQWDGDGDIDWXUDD
TXHIL]HUMXVDFUHVFLGDGHMXURVPRUDWyULRVGHXPSRUFHQWRDRPrV&DVRDFRQWUDWDGDQmR
WHQKD QHQKXP YDORU D UHFHEHU GHVWD 3UHIHLWXUD VHUOKHi FRQFHGLGR R SUD]R GH FLQFR GLDV
~WHLV FRQWDGRV GH VXD XOWLPD LQWLPDomR SDUD HIHWXDU R SDJDPHQWR GD PXOWD $SyV HVVH SUD]R
QmR VHQGR HIHWXDGR R SDJDPHQWR VHXV GDGRV VHUmR HQFDPLQKDGRV DR yUJmR FRPSHWHQWH SDUD
TXHVHMDLQVFULWDQD'LYLGD$WLYDGR0XQLFtSLRSRGHQGRDLQGD D3UHIHLWXUDSURFHGHUDFREUDQoD
MXGLFLDOGDPXOWD
$VPXOWDVSUHYLVWDVQHVWDVHomRQmRH[LPHPDOLFLWDQWHHRXDGMXGLFDWiULDGDUHSDUDomRGRV
HYHQWXDLVGDQRVSHUGDVRXSUHMXt]RVTXHVHXDWRSXQtYHOYHQKDFDXVDUDRyUJmR
6RPHQWH VHUi FRQFHGLGD SURUURJDomR GR SUD]R SDUD R IRUQHFLPHQWR GR REMHWR QR WRGR RX
HP SDUWH FDVR D HPSUHVD HIHWLYDPHQWH GHPRQVWUH H FRPSURYH HP SHGLGR IXQGDPHQWDGR IDWR
VXSHUYHQLHQWH LPSUHYLVtYHO RX GH GLItFLO SUHYLVmR LPSHGLWLYR GD HQWUHJD QR SUD]R HVWLSXODGR QD
SURSRVWD
'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±6HFUHWDULD0XQLFLSDOGD$GPLQLVWUDomR
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGH(GXFDomR
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH±*HVWmRGH6HUYLoRGH7UDQVSRUWH(VFRODU
)RQWH±5(&(GXFDomR±
)RQWH±5(&6DOiULR(GXFDomR±
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
15 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
8QLGDGH±)XQGR0XQLFLSDOGH$VVLVWrQFLD6RFLDO
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± 6HUYLoR 6RFLRHGXFDWLYR H GH &RQYLYrQFLD SDUD HUUDGLFDomR GR WUDEDOKR
,QIDQWLO
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR%ROVD)DPtOLD
)RQWH
8QLGDGH±6HFUHWDULDGR7UDQVSRUWH7UkQVLWR(VWUDGDH5RGDJHP
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH6D~GH
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± $o}HV ,QWHJUDGDV H $UWLFXODGDV HP 9LJLOkQFLD 6DQLWiULD FRP (QWLGDGHV
&LYLV
2EMHWR$WLYLGDGH±$WHQomRj6D~GHQRV6HUYLoRVGH0pGLDH$OWD&RPSOH[LGDGH
2EMHWR$WLYLGDGH±6HUYLoRGH$WHQomR%iVLFDHP6D~GH
2EMHWR$WLYLGDGH±$WHQomR(VSHFLDOL]DGDHP6D~GH0HQWDO
2EMHWR$WLYLGDGH±6HUYLoRGH$WHQGLPHQWR0yYHOGH8UJrQFLDH(PHUJrQFLD
2EMHWR$WLYLGDGH±6HUYLoRGH9LJLOkQFLD6DQLWiULD
2EMHWR$WLYLGDGH±6HUYLoRGH9LJLOkQFLD(SLGHPLROyJLFDH&RQWUROHGH'RHQoDV
)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
'$6',6326,d®(6*(5$,6
$UW†žH$UWLJR†RGD/HL
eIDFXOWDGDDR3UHJRHLURRX$XWRULGDGH6XSHULRUHPTXDOTXHUIDVHGDOLFLWDomRDSURPRomR
GHGLOLJrQFLDGHVWLQDGDDHVFODUHFHURXFRPSOHPHQWDUDLQVWUXomRGRSURFHVVRYHGDGDDLQFOXVmR
SRVWHULRUGHGRFXPHQWRRXLQIRUPDomRTXHGHYHULDFRQVWDUQRDWRGDVHVVmRS~EOLFD
$ DXWRULGDGH FRPSHWHQWH SDUD GHWHUPLQDU D FRQWUDWDomR SRGHUi UHYRJDU D OLFLWDomR SRU
UD]}HVGHLQWHUHVVHS~EOLFRGHULYDGRGHIDWRVXSHUYHQLHQWHGHYLGDPHQWHFRPSURYDGRSHUWLQHQWHH
VXILFLHQWHSDUDMXVWLILFDUWDOFRQGXWDGHYHQGRDQXOiODSRULOHJDOLGDGHGHRItFLRRXSRUSURYRFDomR
GHTXDOTXHUSHVVRDPHGLDQWHDWRHVFULWRHIXQGDPHQWDGR
$DQXODomRGRSURFHGLPHQWRLQGX]jGRFRQWUDWRRXQRWDGHHPSHQKR
2VOLFLWDQWHVQmRWHUmRGLUHLWRjLQGHQL]DomRHPGHFRUUrQFLDGDDQXODomRGRSURFHGLPHQWR
OLFLWDWyULRUHVVDOYDGRRGLUHLWRGRFRQWUDWDGRGHERDIpGHVHUUHVVDUFLGRSHORVHQFDUJRVTXHWLYHU
VXSRUWDGRQRFXPSULPHQWRGRFRQWUDWR
2VSURSRQHQWHVDVVXPHPWRGRVRVFXVWRVGHSUHSDUDomRHDSUHVHQWDomRGHVXDSURSRVWDH
D 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD QmR VHUi HP QHQKXP FDVR UHVSRQViYHO SRU HVVHV FXVWRV
LQGHSHQGHQWHPHQWHGDFRQGXomRRXGRUHVXOWDGRGRSURFHVVROLFLWDWyULR
2V SURSRQHQWHV VmR UHVSRQViYHLV SHOD ILGHOLGDGH H OHJLWLPLGDGH GDV LQIRUPDo}HV H GRV
GRFXPHQWRVDSUHVHQWDGRVHPTXDOTXHUIDVHGDOLFLWDomR
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
16 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
1mRKDYHQGRH[SHGLHQWHRXRFRUUHQGRTXDOTXHUIDWRVXSHUYHQLHQWHTXHLPSHoDDUHDOL]DomR
GR FHUWDPH QD GDWD PDUFDGD D VHVVmR VHUi UHGHVLJQDGD SDUD R GLD KRUD H ORFDO GHILQLGR H
QRYDPHQWHSXEOLFDGDQD,PSUHQVD2ILFLDO
1D FRQWDJHP GRV SUD]RV HVWDEHOHFLGRV QHVWH (GLWDO H VHXV $QH[RV H[FOXLUVHi R GLD GR
LQtFLR H LQFOXLUVHi R GR YHQFLPHQWR 6y VH LQLFLDP H YHQFHP RV SUD]RV HP GLDV GH H[SHGLHQWH
QRUPDOQD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
2 GHVDWHQGLPHQWR GH H[LJrQFLDV IRUPDLVQmR HVVHQFLDLV QmRLPSRUWDUi QR DIDVWDPHQWR GR
OLFLWDQWH GHVGH TXH VHMDP SRVVtYHLV DV DIHULo}HV GDV VXDV TXDOLILFDo}HV H DV H[DWDV
FRPSUHHQV}HVGDVXDSURSRVWDGXUDQWHDUHDOL]DomRGDVHVVmRS~EOLFDGR35(*­2
$VQRUPDVTXHGLVFLSOLQDPHVWHSUHJmRVHUmRVHPSUHLQWHUSUHWDGDVHPIDYRUGDDPSOLDomR
GDGLVSXWDHQWUHRVLQWHUHVVDGRVVHPFRPSURPHWLPHQWRGDVHJXUDQoDGRIXWXURFRQWUDWR
4XDOTXHU SHGLGR GH HVFODUHFLPHQWR HP UHODomR D HYHQWXDLV G~YLGDV QD LQWHUSUHWDomR GR
SUHVHQWH (GLWDO H VHXV $QH[RV GHYHUi VHU HQFDPLQKDGR SRU HVFULWR DR 3UHJRHLUR D 3UHIHLWXUD
0XQLFLSDOGH9DOHQoD6,78$'$3529,625,$0(17(¬58$&(&Ë/,$0(,5(/(61ž
&(17529$/(1d$%$+,$$QWLJR&ROpJLR3DXOR)UHLUHGDVjVKVDWpGRLV
GLDV~WHLVDQWHVGDGDWDGHDEHUWXUDGR35(*­2
$KRPRORJDomRGRUHVXOWDGRGHVWDOLFLWDomRQmRLPSOLFDUiGLUHLWRjFRQWUDWDomR
$RVFDVRVRPLVVRVDSOLFDPVHDVGLVSRVLo}HVFRQVWDQWHVGD/HLH
'HFUHWRV0XQLFLSDLVQžH
6mRSDUWHVLQWHJUDQWHVLQGLVVRFLiYHLVHDWUHODGDVDRFRQWH~GRGHVWH(GLWDORVDQH[RVDWD
GHUHJLVWURGHSUHoRVFXMRWHRUYLQFXODWRWDOPHQWHRVOLFLWDQWHV
$1(;2,±(VSHFLILFDo}HVGRVSURGXWRVHRXPDWHULDLV
$1(;2,,±0RGHORGH3URSRVWDGH3UHoRV
$1(;2,,,±0RGHORGH&DUWDGH&UHGHQFLDPHQWR
$1(;2 ,9 ± 0RGHOR GH GHFODUDomR GH IDWRV VXSHUYHQLHQWH TXH QmR HPSUHJD PHQRUHV GH DQRVHPWUDEDOKRQRWXUQRVHQmRSRVVXLHPTXDGURGHSHVVRDOVHUYLGRUS~EOLFRH[HUFHQGRIXQomR
WpFQLFDFRPHUFLDLVGHJHUrQFLDDGPLQLVWUDomRRXWRPDGDGHGHFLVmRLQFLVR,,,GRDUWžGD/HL
$1(;2 9 ± 0RGHOR GH GHFODUDomR GDQGR FLrQFLD GH TXH FXPSUHP RV UHTXLVLWRV SDUD D
KDELOLWDomR
$1(;29,±0RGHORGHDWHVWDGRGHFDSDFLGDGHWpFQLFD
$1(;29,,±0RGHORGH'HFODUDomRGH0LFUR(PSUHVDH(PSUHVDGH3HTXHQR3RUWH
$1(;29,,,±0LQXWDGD$WDGH5HJLVWURGH3UHoRV
$1(;2,;0RGHORGH0LQXWDGH&RQWUDWRSDUD)RUQHFLPHQWR([HFXomR
9DOHQoD%$GHMXOKRGH
0,&+(/$3$5(&,'23,172
$SURYDGR
$66(6625,$-85Ë',&$
3UHJRHLUR
3RUWDULDQžGH
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
17 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,
Item
1
Lote:
Item
1
2
3
Lote:
Item
7(502'(5()(5Ç1&,$
Código
DescriçãoDetalhada
140782 SERVIÇOSMECÂNICOSEMVEÍCULOSLEVES
2 SERVIÇOSDEBORRACHARIA
Código
DescriçãoDetalhada
140734 SERVIÇOSDEBORRACHARIAEMMOTOS
SERVIÇOSDEBORRACHARIAEMVEÍCULOS
140727 LEVES
SERVIÇOSDEBORRACHARIAEMVEÍCULOS
140730 PESADOS
3 SERVIÇOSDELAVAGEM
DescriçãoDetalhada
SERVIÇOSDELAVAGEMCOMPLETA/GERAL
140736 EMMOTOS
SERVIÇOSDELAVAGEMCOMPLETA/GERAL
140729 EMVEÍCULOSLEVES
SERVIÇOSDELAVAGEMCOMPLETA/GERAL
140733 EMVEÍCULOSPESADOS
Código
1
2
3
Lote:
Item
3
4 SERVIÇOSELÉTRICOS/ELETRÔNICOS
DescriçãoDetalhada
SERVIÇOSDESERVIÇOS
140735 ELÉTRICOS/ELETRÔNICOSEMMOTOS
SERVIÇOSELÉTRICOS/ELETRÔNICOSEM
140728 VEÍCULOSLEVES
SERVIÇOSELÉTRICOS/ELETRÔNICOSEM
140731 VEÍCULOSPESADOS
1
SERVIÇOSMECÂNICOSPARAVEÍCULOS
5 PESADOS
Código
DescriçãoDetalhada
SERVIÇOSMECÂNICOSEMVEÍCULOS
139212 PESADOS
Código
1
2
Lote:
Item
Unidade
H
Qtde
1300
Unidade
UND
Qtde
50
UND
600
UND
1400
Unidade
Qtde
UND
50
UND
1000
UND
800
Unidade
Qtde
H
50
H
1150
H
1500
Unidade
Qtde
H
1800
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
18 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,,
SDSHOWLPEUDGRGDHPSUHVD
02'(/23523267$'(35(d26
/LFLWDomR1ž309%$0RGDOLGDGH35(*­235(6(1&,$/7,320(12535(d2*/2%$/
325/27(
6HVVmR3~EOLFDjVKRUDV
/RFDO6HWRUGH/LFLWDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDVLWXDGDD7UDYHVVD*HQHUDO/DEDWXW61
&HQWUR9DOHQoD±%DKLD
,'(17,),&$d­2'$352321(17(
5D]mR6RFLDOBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&13-BBBBBBBBBBBBBBBBBBBBBBBBBB
2SWDQWHSHOR6,03/(6"6LP1mR
(QGHUHoRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
%DLUUR&LGDGHBBBBBBBBBBBBBBBBBBBBBBBBBBBBB&(3BBBBBBBBBBBBBBBBBBB
7HOHIRQH)D[BBBBBBBBBBBBBBBBBBBBBBBBB
%DQFR&RQWD%DQFiULDBBBBBBBBBBBBBBBBBBBBBBB
1RPHHQžGD$JrQFLDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
,WHP 4WGH 8QLG
'HVFULomR
0DUFD
9DORU
9DORU7RWDO
0RGHOR
8QLWiULR
$ HPSUHVD GHFODUD TXH HVWmR LQFOXVDV QR YDORU FRWDGR WRGDV DV GHVSHVDV
FRPPmRGHREUDHEHPFRPRWRGRVRVWULEXWRVHHQFDUJRVILVFDLVVRFLDLVWUDEDOKLVWDVSUHYLGHQFLiULRVH
FRPHUFLDLV
(VWDQGR GH DFRUGR FRP RV WHUPRV GR DWR FRQYRFDWyULR H FRP D OHJLVODomR QHOH LQGLFDGD SURSRPRV RV
YDORUHVDFLPDFRPDYDOLGDGHGDSURSRVWDGHBBBBBBBBBGLDVH3UD]RGH([HFXomRLPHGLDWRDFRQWDUGD
2UGHPGH6HUYLoRFRQIRUPHHGLWDO
/RFDOHGDWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&DULPERGDHPSUHVD$VVLQDWXUDGRUHVSRQViYHO
2EV 6HUmR GHVFODVVLILFDGDV DV SURSRVWDV TXH DSUHVHQWDUHP FRWDo}HV FRQWHQGR SUHoRV H[FHVVLYRV
VLPEyOLFRVGHYDORU]HURRXLQH[HTtYHLVQDIRUPDGDOHJLVODomRHPYLJRURXDLQGDTXHRIHUHoDPSUHoRV
RXYDQWDJHQVEDVHDGDVQDVRIHUWDVGRVGHPDLVOLFLWDQWHV
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
19 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,,,
0RGHORGH&DUWDGHFUHGHQFLDPHQWR
3DSHO7LPEUDGRGDHPSUHVD
¬
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
7,320(12535(d2*/2%$/325/27(
,QGLFDPRV R D 6U D BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU D GD FpGXOD GH
LGHQWLGDGH QžBBBBBBBBBBBBBBBBBBBBBBBB yUJmR H[SHGLGRU BBBBBBBBBBBBBBBBBBBBBB FRPR
QRVVR UHSUHVHQWDQWH OHJDO QD /LFLWDomR HP UHIHUrQFLD SRGHQGR UXEULFDU D GRFXPHQWDomR GH
+$%,/,7$d­2 H GDV 3523267$6 PDQLIHVWDU SUHVWDU WRGRV RV HVFODUHFLPHQWRV j QRVVD
3URSRVWD LQWHUSRU UHFXUVRV GHVLVWLU GH SUD]RV H UHFXUVRV HQILP SUDWLFDU WRGRV RV DWRV
QHFHVViULRVDRILHOFXPSULPHQWRGRSUHVHQWH&UHGHQFLDPHQWR
$WHQFLRVDPHQWH
QRPHHIXQomRQDHPSUHVD
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
20 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,9
02'(/2'('(&/$5$d­2
3DSHOWLPEUDGRGDHPSUHVD
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
'(&/$5$d­2
$BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQVFULWDDR&13-Qž
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBSRULQWHUPpGLRGHVHXUHSUHVHQWDQWHOHJDORD6UD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU D GD &DUWHLUD GH
,GHQWLGDGHQžBBBBBBBBBBBBBBBBBBHGR&3)QžBBBBBBBBBBBBBBBBBBBBBBBBB'(&/$5$VRE
DV SHQDV GD OHL TXH DWp D SUHVHQWH GDWD LQH[LVWHP IDWRV LPSHGLWLYRV SDUD VXD KDELOLWDomR QR
SUHVHQWH SURFHVVR OLFLWDWyULR FLHQWH GD REULJDWRULHGDGH GH GHFODUDU RFRUUrQFLDV SRVWHULRUHV H
SDUD ILQV GR GLVSRVWR QR LQFLVR 9 GR DUW GD /HL Qž GH GH MXQKR GH DFUHVFLGR
SHOD /HL Qž GH GH RXWXEUR GH TXH QmR HPSUHJD PHQRU GH GH]RLWR DQRV HP
WUDEDOKR QRWXUQR SHULJRVR RX LQVDOXEUH H QmR HPSUHJD PHQRU GH GH]HVVHLV DQRV UHVVDOYD
HPSUHJD PHQRU D SDUWLU GH TXDWRU]H DQRV QD FRQGLomR GH DSUHQGL] H TXH QmR SRVVXL HP VHX
TXDGUR GH SHVVRDO VHUYLGRUHV S~EOLFRV H[HUFHQGR IXQo}HV WpFQLFDV FRPHUFLDLV GH JHUrQFLD
DGPLQLVWUDomRRXWRPDGDGHGHFLVmRLQFLVR,,,GRDUWžGD/HL
/RFDOHGDWD
$VVLQDWXUDHLGHQWLILFDomRGRUHVSRQViYHOSHODHPSUHVD
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
21 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29
3DSHOWLPEUDGRGDHPSUHVD
0RGHOR GH 'HFODUDomR GDQGR FLrQFLD GH TXH FXPSUH SOHQDPHQWH RV UHTXLVLWRV GH
KDELOLWDomR)25$'26(19(/23(6³´H³´
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
'HFODUDPRVHPDWHQGLPHQWRDRSUHYLVWRQRLWHPGRHGLWDOGH3UHJmRQƒ309%$
TXH FXPSULPRV SOHQDPHQWH RV UHTXLVLWRV GH KDELOLWDomR H[LJLGRV SDUD SDUWLFLSDomR QR SUHVHQWH
FHUWDPH
/RFDOHGDWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$VVLQDWXUDHFDULPER
UHSUHVHQWDQWHOHJDO
2EV$VHUHQWUHJXHMXQWRFRPRVHQYHORSHVHTXDQGRGHFODUDGDDEHUWDDVHVVmRSHOR
SUHJRHLUR
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
22 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,
02'(/2'($7(67$'2'(&$3$&,'$'(7e&1,&$
7LPEUHORJRPDUFDGDHPSUHVDHPLWHQWH±&13-
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDWHVWDSDUDRVGHYLGRVILQVTXHD
(PSUHVDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
FRP
VHGH
QD
BBBBBBBBBBBBBBBBBBBBBBB IRUQHFHXIRUQHFH RV SURGXWRV $%$,;2 5(/$&,21$'26 VHQGR
FXPSULGRUDGRVSUD]RVHWHUPRVILUPDGRVQDFRQWUDWDomRQmRKDYHQGRFRQWUDDPHVPDQHQKXP
UHJLVWURTXHDGHVDERQH
5HODomRGRVSURGXWRVIRUQHFLGRV
D
E
F
/RFDOH'DWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1RPHFRPSOHWRSRUH[WHQVRGRUHVSRQViYHOSHOD3HVVRD-XUtGLFDHPLWHQWHGHVWHDWHVWDGR
HVXDDVVLQDWXUD
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
23 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,,
02'(/2'('(&/$5$d­2'(
0,&52(035(6$((035(6$'(3(48(123257(
7LPEUHORJRPDUFDGDHPSUHVDHPLWHQWH±&13-
$
35()(,785$081,&,3$/'(9$/(1d$
5()5(*­235(6(1&,$/1ž309%$
$HPSUHVDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQVFULWDQR&13-0)VRERQž
BBBBBBBBBBBBBBBBBBBBBBB
SRU
VHX
UHSUHVHQWDQWH
OHJDO
RD
6UD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU GD &pGXOD GH ,GHQWLGDGH Qž
BBBBBBBBBBBBBBBBBBBHGR&3)0)QžBBBBBBBBBBBBBBBBBBBBGHFODUDVREDVSHQDVGDOHH
VHP SUHMXt]R GDV SHQDOLGDGHV SUHYLVWDV QHVWH HGLWDO TXH p ³PLFURHPSUHVD RX HPSUHVD GH
SHTXHQR SRUWH´ QRV WHUPRV GR HQTXDGUDPHQWR SUHYLVWR D /HL &RPSOHPHQWDU Qž GH GH
GH]HPEUR GH TXH FRQKHFH QD tQWHJUD H HVWi SRUWDQWR DSWD D H[HUFHU R GLUHLWR GH
SUHIHUrQFLDFRPRFULWpULRGHGHVHPSDWHQRSUHJmRSUHVHQFLDOQž309%$
/RFDOH'DWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1RPHFRPSOHWRSRUH[WHQVRGRUHVSRQViYHOSHOD3HVVRD-XUtGLFDHPLWHQWHGHVWHDWHVWDGRHVXD
DVVLQDWXUD
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
24 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,,,
0,187$'$$7$'(5(*,6752'(35(d26'235(*­235(6(1&,$/1ž
$RV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBD
35()(,785$
081,&,3$/'(9$/(1d$FRPVHGHD7UDYHVVD*HQHUDO/DEDWXWVQžHIRURHP9DOHQoD%DKLD
LQVFULWDQR&13-VRERQžR3UHJRHLURQRVWHUPRVGR'HFUHWR0XQLFLSDOQž
GHGHIHYHUHLURGH'HFUHWRQžGHGHMXOKRGHHGRV'HFUHWRV
GHGHDJRVWRGHLQWHJUDQWHVGRSUHVHQWHDMXVWHGLDQWHGRGLVSRVWRQRDUWLJRGD/HL
Qž GH GH MXQKR GH H GHPDLV QRUPDV OHJDLV DSOLFiYHLV HP IDFH GD FODVVLILFDomR
GDV 3URSRVWDV DSUHVHQWDGDV UHVROYH 5(*,675$5 35(d26 SDUD HYHQWXDO FRQWUDWDomR GH
HPSUHVD HVSHFLDOL]DGD SDUD 35(67$d­2 '( 6(59,d2 '( 0$187(1d­2 ( 5(3$52 '(
02726 ( 9(Ë&8/26 /(9(6 ( 3(6$'26 &2035((1'(1'2 6(59,d26 '( 0(&Æ1,&$
(0 *(5$/ %255$&+$5,$ (/e75,&26(/(75Ð1,&26 ( /$9$*(0 YLVDQGR DWHQGHU DV
QHFHVVLGDGHV GDV GLYHUVDV 6HFUHWDULDV GR 0XQLFtSLR GH 9DOHQoD%$ GH DFRUGR DV FRQGLo}HV H
HVSHFLILFDo}HV FRQVWDQWHV QR 7HUPR GH 5HIHUrQFLD H GHPDLV GLVSRVLo}HV IL[DGDV QHVWH (GLWDO H
VHXV $QH[RV GXUDQWH R SHUtRGR GH YDOLGDGH GD SUHVHQWH $7$ '( 5(*,6752 '( 35(d26
RIHUHFLGRV SHODV HPSUHVDV FODVVLILFDGDV HP
SULPHLUR OXJDU SDUD RV LWHQV DEDL[R GLVFULPLQDGRV H SHODV HPSUHVDV UHPDQHVFHQWHV
H QD RUGHP VXFHVVLYD GH FODVVLILFDomR
REVHUYDGDVDVFRQGLo}HVGR(GLWDOTXHUHJHR3UHJmR3UHVHQFLDOQž
,7(0 '(6&5,d­2
81,'$'( 48$17
35(d2
'(7(1725$
81,7È5,2
&/È868/$,±'2635$=26(35(d26
3UD]RGHHQWUHJDGRVPDWHULDLVHRXH[HFXomRGRVVHUYLoRVQmRVXSHULRUDKTXDUHQWDHRLWR
KRUDVFRQWDGRGRUHFHELPHQWRGD2UGHPGH)RUQHFLPHQWR6HUYLoR
$ SUHVHQWH $WD WHP YDOLGDGH GH XP DQR D SDUWLU GD GDWD GH VXD DVVLQDWXUD SRGHQGR VHU
SURUURJDGDjFULWpULRGD$GPLQLVWUDomR
2VSUHoRVUHJLVWUDGRVVHUmRIL[RVHLUUHDMXVWiYHLVGXUDQWHDYLJrQFLDGDSUHVHQWH$WDGH5HJLVWUR
GH3UHoRV
$V HPSUHVDV GHWHQWRUDV GR UHJLVWUR DVVXPHP R FRPSURPLVVR GH IRUQHFHU RV SURGXWRV
VROLFLWDGRV H H[HFXWDU RV VHUYLoRV QDV TXDQWLGDGHV GHILQLGDV QRV SHGLGRV D VHUHP
HPLWLGRV SHOR 0XQLFtSLR GH 9DOHQoD%$ SHORV SUHoRV UHJLVWUDGRV H QDV FRQGLo}HV
FRQVWDQWHVGRHGLWDOGXUDQWHRSUD]RGHYDOLGDGHGHVWD$WDGH5HJLVWURGH3UHoRV
'XUDQWHDYLJrQFLDGD$WDGH5HJLVWURGH3UHoRVDVHPSUHVDVGHWHQWRUDVGHYHUimRDFDGD
IDWXUDHPLWLGDFRPSURYDUVXDVUHJXODULGDGHVSHUDQWHR6LVWHPDGH6HJXULGDGH6RFLDO,166H
R)XQGRGH*DUDQWLDSRU7HPSRGH6HUYLoR)*76
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
25 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&/È868/$,,±'$&2175$7$d­2
$ FRQWUDWDomR FRP RV IRUQHFHGRUHV UHJLVWUDGRV VHUi IRUPDOL]DGD SHOR 0XQLFtSLR GH 9DOHQoD SRU
LQWHUPpGLR GH LQVWUXPHQWR FRQWUDWXDO HPLVVmR GH QRWD GH HPSHQKR GH GHVSHVD DXWRUL]DomR GH
FRPSUDRXRXWURLQVWUXPHQWRKiELOFRQIRUPHRDUWGD/HLQžGH
$ H[LVWrQFLD GH 3UHoRV 5HJLVWUDGRV QmR REULJD R 0XQLFtSLR D ILUPDU DV FRQWUDWDo}HV TXH HOHV
SRGHUmRDGYLU
1DKLSyWHVHGR)251(&('25SULPHLURFODVVLILFDGRWHUVHXUHJLVWURFDQFHODGRQmRDVVLQDUQmR
DFHLWDURXQmRUHWLUDURFRQWUDWRQRSUD]RHFRQGLo}HVHVWDEHOHFLGDVSRGHUmRVHUFRQYRFDGRVRV
IRUQHFHGRUHV UHPDQHVFHQWHV QD RUGHP GH FODVVLILFDomR SDUD ID]rOR HP LJXDO SUD]R H QDV
FRQGLo}HVSURSRVWDVSHORSULPHLURFODVVLILFDGRLQFOXVLYHTXDQWRDRSUHoRLQGHSHQGHQWHPHQWHGD
FRPLQDomRSUHYLVWDQR$UWLJRGD/HL
2EVHUYDGRVRVFULWpULRVHFRQGLo}HVHVWDEHOHFLGRVQRHGLWDOR0XQLFtSLRSRGHUiFRPSUDUGHPDLV
GHXPIRUQHFHGRUUHJLVWUDGRVHJXQGRDRUGHPGHFODVVLILFDomRGHVGHTXHDVUD]}HVGHLQWHUHVVH
S~EOLFR MXVWLILTXHP H TXH R SULPHLUR FODVVLILFDGR QmR SRVVXD IRUQHFLPHQWR FRPSDWtYHO FRP R
VROLFLWDGRSHOR0XQLFtSLRREVHUYDGRjVFRQGLo}HVGRHGLWDOHR3UHoR5HJLVWUDGR
$ILVFDOL]DomRVHUiH[HUFLGDSHOD6HFUHWDULDVROLFLWDQWH
&/È868/$,,,±'$(175(*$
$V HQWUHJDV HRX H[HFXomR GRV VHUYLoRV VHUmR HIHWXDGRV FRQIRUPH VROLFLWDomR GR 0XQLFtSLR
VHQGRTXHRSUD]RGHHQWUHJDH[HFXomRQmRVHUiVXSHULRUjKTXDUHQWDHRLWRKRUDVDSyVR
UHFHELPHQWRGD1RWDGH(PSHQKR
&DVRRVSURGXWRVQmRFRUUHVSRQGDPDRH[LJLGRSHORHGLWDORIRUQHFHGRUGHYHUiSURYLGHQFLDUQR
SUD]RPi[LPRGHDWpTXDUHQWDHRLWRKRUDVDVXDVXEVWLWXLomRYLVDQGRDRDWHQGLPHQWRGDV
HVSHFLILFDo}HVVHPSUHMXt]RGDLQFLGrQFLDGDVVDQo}HVSUHYLVWDVQRHGLWDOHQD/HL
&/È868/$,9±'$66$1d®(6
3HODLQH[HFXomRWRWDORXSDUFLDOGRREMHWRFRQWUDWDGRD$GPLQLVWUDomRSRGHUiJDUDQWLGDD
SUpYLDGHIHVDDSOLFDUj&2175$7$'$DVVHJXLQWHVVDQo}HV
DDGYHUWrQFLD
E PXOWD GH XP SRU FHQWR DR GLD VREUH R YDORU GR FRQWUDWR SRU GLD GH DWUDVR QD
H[HFXomRHRXIRUQHFLPHQWRDWpRžYLJpVLPRGLD
F PXOWD GH YLQWH SRU FHQWR VREUH R YDORU GR FRQWUDWR D SDUWLU GR ž YLJpVLPR
SULPHLUR GLD SHOR DWUDVR QR IRUQHFLPHQWR HRX H[HFXomR IDFXOWDGD D UHVFLVmR FRQWUDWXDO VHP
SUHMXt]RGDVGHPDLVSHQDOLGDGHVSUHYLVWDVQD/HLQž
GSHORVPRWLYRVTXHVHVHJXHPSULQFLSDOPHQWHD&2175$7$'$HVWDUiVXMHLWDjPXOWD
WUDWDGDQHVWD&OiXVXOD
ƒ SHODUHFXVDLQMXVWLILFDGDGHUHFHEHUD1RWDGH(PSHQKRHDVVLQDUR&RQWUDWR
ƒ SHORDWUDVRQDHQWUHJDGRIRUQHFLPHQWRHPUHODomRDRSUD]RSURSRVWRHDFHLWRH
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
26 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
ƒ SHOD QmR HQWUHJD GR IRUQHFLPHQWR FDUDFWHUL]DQGRVH D IDOWD VH D HQWUHJD QmR VH
HIHWLYDUGHQWURGRVTXLQ]HGLDVTXHVHVHJXLUHPDRWpUPLQRGRSUD]RSURSRVWRHDFHLWR
H $ FULWpULR GD $GPLQLVWUDomR SRGHUmR VHU VXVSHQVDV DV SHQDOLGDGHV QR WRGR RX HP
SDUWH TXDQGR R DWUDVR GR IRUQHFLPHQWR GRV SURGXWRV IRU GHYLGDPHQWH MXVWLILFDGR SHOD
&2175$7$'$ H DFHLWR SHOD $GPLQLVWUDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD TXH IL[DUi QRYR
SUD]RHVWHLPSURUURJiYHOSDUDDFRPSOHWDH[HFXomRGDVREULJDo}HVDVVXPLGDV
&/È868/$9±'$5(6&,6­2&2175$78$/
$LQH[HFXomRWRWDORXSDUFLDOGHVWH&RQWUDWRHQVHMDDVXDUHVFLVmRFRQIRUPHGLVSRVWRQRVDUWLJRV
DGD/HL
&DVRD&RQWUDWDQWHQmRVHXWLOL]HGDSUHUURJDWLYDGHUHVFLQGLUD$WDGH5HJLVWURGH3UHoRVDVHX
H[FOXVLYR FULWpULR SRGHUi VXVSHQGHU D VXD H[HFXomR HRX VXVWDU R SDJDPHQWR GDV )DWXUDV DWp
TXH D &RQWUDWDGD FXPSUD LQWHJUDOPHQWH D FRQGLomR FRQWUDWXDO LQIULQJLGD VHP SUHMXt]R GD
LQFLGrQFLDGDVVDQo}HVSUHYLVWDVQRHGLWDOHQD/HL
$UHVFLVmRSRGHUiVHU8QLODWHUDO$PLJiYHORX-XGLFLDOQRVWHUPRVHFRQGLo}HVSUHYLVWDVQR$UWLJR
GD/HL
&/È868/$9,±'2&$1&(/$0(172'25(*,6752'(35(d26
25HJLVWURGH3UHoRVGRIRUQHFHGRUSRGHUiVHUFDQFHODGRJDUDQWLGDSUpYLDGHIHVDQRSUD]RGH
FLQFRGLDV~WHLVDFRQWDUGRUHFHELPHQWRGDQRWLILFDomRQDVVHJXLQWHVKLSyWHVHV
,±3HOR0XQLFtSLR
D2IRUQHFHGRUQmRFXPSULUDVH[LJrQFLDVFRQWLGDVQR(GLWDORX$WDGH5HJLVWURGH3UHoRV
E 2 IRUQHFHGRU GHU FDXVD j UHVFLVmR DGPLQLVWUDWLYD GH FRQWUDWR GHFRUUHQWH GR 5HJLVWUR GH
3UHoRVSRUXPGRVPRWLYRVHOHQFDGRVQR$UWLJRGD/HLQž
F2V3UHoRV5HJLVWUDGRVVHDSUHVHQWDUHPVXSHULRUHVDRVSUDWLFDGRVQRPHUFDGR
G3RUUD]}HVGHLQWHUHVVHS~EOLFRGHYLGDPHQWHIXQGDPHQWDGRQDIRUPDGR,QFLVR;,,GR$UWLJR
GD/HLQžHDOWHUDo}HVSRVWHULRUHV
,,±3HOR)RUQHFHGRUTXDQGRPHGLDQWHVROLFLWDomRSRUHVFULWRFRPSURYDUHVWDULPSRVVLELOLWDGRGH
FXPSULUDVH[LJrQFLDVGRLQVWUXPHQWRFRQYRFDWyULRTXHGHXRULJHPDR5HJLVWURGH3UHoRV
2 FDQFHODPHQWR VHUi SUHFHGLGR GH 3URFHVVR $GPLQLVWUDWLYR D VHU H[DPLQDGR SHOR 0XQLFtSLR
VHQGRTXHDGHFLVmRILQDOGHYHUiVHUIXQGDPHQWDGD
$ VROLFLWDomR GR )251(&('25 SDUD FDQFHODPHQWR GR 5HJLVWUR GH 3UHoRV QmR GHVREULJD GR
IRUQHFLPHQWR GRV SURGXWRV DWp D GHFLVmR GR 0XQLFtSLR D TXDO GHYHUi VHU SURODWDGD QR SUD]R
Pi[LPRGHWULQWDGLDV
&/È868/$9,,±'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±6HFUHWDULD0XQLFLSDOGD$GPLQLVWUDomR
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
27 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGH(GXFDomR
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH±*HVWmRGH6HUYLoRGH7UDQVSRUWH(VFRODU
)RQWH±5(&(GXFDomR±
)RQWH±5(&6DOiULR(GXFDomR±
8QLGDGH±)XQGR0XQLFLSDOGH$VVLVWrQFLD6RFLDO
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± 6HUYLoR 6RFLRHGXFDWLYR H GH &RQYLYrQFLD SDUD HUUDGLFDomR GR WUDEDOKR
,QIDQWLO
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR%ROVD)DPtOLD
)RQWH
8QLGDGH±6HFUHWDULDGR7UDQVSRUWH7UkQVLWR(VWUDGDH5RGDJHP
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH6D~GH
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± $o}HV ,QWHJUDGDV H $UWLFXODGDV HP 9LJLOkQFLD 6DQLWiULD FRP (QWLGDGHV
&LYLV
2EMHWR$WLYLGDGH±$WHQomRj6D~GHQRV6HUYLoRVGH0pGLDH$OWD&RPSOH[LGDGH
2EMHWR$WLYLGDGH±6HUYLoRGH$WHQomR%iVLFDHP6D~GH
2EMHWR$WLYLGDGH±$WHQomR(VSHFLDOL]DGDHP6D~GH0HQWDO
2EMHWR$WLYLGDGH±6HUYLoRGH$WHQGLPHQWR0yYHOGH8UJrQFLDH(PHUJrQFLD
2EMHWR$WLYLGDGH±6HUYLoRGH9LJLOkQFLD6DQLWiULD
2EMHWR$WLYLGDGH±6HUYLoRGH9LJLOkQFLD(SLGHPLROyJLFDH&RQWUROHGH'RHQoDV
)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
&/È868/$9,,,±'2)252
)LFD HOHLWR R IRUR GD &RPDUFD GH 9DOHQoD%$ SDUD GLULPLU G~YLGDV H TXHVW}HV RULXQGDV GD
SUHVHQWH $WD GH 5HJLVWUR GH 3UHoRV FRP H[FOXVmR GH TXDOTXHU RXWUR SRU PDLV SULYLOHJLDGR TXH
VHMD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
&13-1ž[[[[[[[[[[[[[[
(QGHUHoR[[[[[[[[[[[[[[
5HSUHVHQWDQWH[[[[[[[[[[[[[[[[
5*[[[[[[[
&3)[[[[[[[[[[[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
28 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
&13-1ž[[[[[[[[[[[[[[
(QGHUHoR[[[[[[[[[[[[[[
5HSUHVHQWDQWH[[[[[[[[[[[[[[[[
5*[[[[[[[
&3)[[[[[[[[[[[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
29 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,;
0,187$&2175$721ž;;;;;;;;;;;;
&2175$72 3$5$ )251(&,0(172 3$5&(/$'2 '( 352'8726 28
(;(&8d­2 '( 6(59,d26 48( (175( 6, &(/(%5$0 $ 35()(,785$
081,&,3$/
'(
9$/(1d$
(
$
235()(,785$081,&,3$/'(9$/(1d$LQVFULWDQR&13-VRERQž
FRP VHGH D 7UDYHVVD *HQHUDO /DEDWXW VQž FHQWUR 9DOHQoD%DKLD QHVWH DWR UHSUHVHQWDGD
SHODVXD3UHIHLWDD6U-8&e/,$6286$'21$6&,0(172&3)QžH5*Qž
663%$EUDVLOHLUDFDVDGDUHVLGHQWHHGRPLFLOLDGDD5XD&LGDGHGR5LRGH-DQHLUR
Qž 9DOHQoD%DKLD H D HPSUHVD HVWDEHOHFLGD D
&13- QžUHVROYHP FHOHEUDU R
SUHVHQWH &RQWUDWR VXMHLWDQGRVH DV SDUWHV jV QRUPDV SUHYLVWDV QD /HL H DOWHUDo}HV
SRVWHULRUHV GH DFRUGR FRP R TXH FRQVWD QD 3UHJmR 3UHVHQFLDO Qž PHGLDQWH DV
&OiXVXODVHRX&RQGLo}HVVHJXLQWHV
&/È868/$35,0(,5$'22%-(72
2 SUHVHQWH FRQWUDWR WHP SRU REMHWR D FRQWUDWDomR GH HPSUHVD GR UDPR SDUD
35(67$d­2'(6(59,d2'(0$187(1d­2(5(3$52'(02726(9(Ë&8/26/(9(6
( 3(6$'26 &2035((1'(1'2 6(59,d26 '( 0(&Æ1,&$ (0 *(5$/ %255$&+$5,$
(/e75,&26(/(75Ð1,&26 ( /$9$*(0 YLVDQGR DWHQGHU DV QHFHVVLGDGHV GDV GLYHUVDV
6HFUHWDULDVGR0XQLFtSLRGH9DOHQoD%$GHDFRUGRDVFRQGLo}HVHHVSHFLILFDo}HVFRQVWDQWHVQR
7HUPRGH5HIHUrQFLDHGHPDLVGLVSRVLo}HVIL[DGDVQHVWH(GLWDOHVHXV$QH[RV
68%&/È868/$Ò1,&$±9LQFXODPVHDRSUHVHQWHFRQWUDWRR3UHJmR3UHVHQFLDOQž
$WD GH 5HJLVWUR GH 3UHoRV EHP FRPR D SURSRVWD GD FRQWUDWDGD DPERV FRP VHXV $QH[RV H
GHPDLV GRFXPHQWRV RV TXDLV VH FRQVWLWXHP HP SDUWHV LQWHJUDQWHV GHVWH LQVWUXPHQWR
LQGHSHQGHQWHPHQWHGHWUDQVFULomR
&/È868/$6(*81'$'25(*,0('((;(&8d­2
2REMHWRGHVWHFRQWUDWRVHUiUHDOL]DGRSRUH[HFXomRLQGLUHWDVRERUHJLPHGHPHQRUSUHoR
JOREDOSRUORWH
&/È868/$7(5&(,5$'2$80(172286835(66­2
1RLQWHUHVVHGD$GPLQLVWUDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDRREMHWRGHVWH&RQWUDWR
SRGHUi VHU DXPHQWDGR RX VXSULPLGR DWp R OLPLWH GH YLQWH H FLQFR SRU FHQWR FRQIRUPH
GLVSRVWRQRDUWLJRSDUiJUDIRVžHžGD/HLQž
68%&/È868/$ 35,0(,5$ $ &2175$7$'$ REULJDVH D DFHLWDU QDV PHVPDV
FRQGLo}HV OLFLWDGDV RV DFUpVFLPRV RX VXSUHVV}HV TXH VH IL]HUHP GH DWp YLQWH H FLQFR SRU
FHQWRGRYDORUFRQVWDQWHGDSURSRVWDGHYLGDPHQWHDWXDOL]DGDGHFRQIRUPLGDGHFRPRGLVSRVWRQD
&OiXVXOD'pFLPD
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
30 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
68%&/È868/$6(*81'$QHQKXPDFUpVFLPRRXVXSUHVVmRSRGHUiH[FHGHURVOLPLWHV
HVWDEHOHFLGRVQRSDUiJUDIRDQWHULRUVDOYRVHDVVXSUHVV}HVUHVXOWDUHPGHDFRUGRFHOHEUDGRHQWUH
RVFRQWUDWDQWHVFRQIRUPH$UWSDUiJUDIRžLQFLVR,,GD/HL
68%&/È868/$ 7(5&(,5$ DV HYHQWXDLV PRGLILFDo}HV GRV WHUPRV GHVWH &RQWUDWR
SRGHUmR VHU DOWHUDGRVFRP DV GHYLGDV MXVWLILFDWLYDV QRV FDVRV UHIHULGRV QR $UWLJR GD /HLQž
PHGLDQWH7HUPR$GLWLYR
&/È868/$48$57$'$62%5,*$d®(6'2&2175$7$17(
'XUDQWHDYLJrQFLDGHVWH&RQWUDWRR&2175$7$17(GHYHUi
DDFRPSDQKDUILVFDOL]DUHFRQIHULURVSURGXWRVVHUYLoRVRUDFRQWUDWDGRV
E HIHWXDU R SDJDPHQWR SHORV SURGXWRVVHUYLoRV GH DFRUGR FRP R HVWDEHOHFLGR QD
&OiXVXOD1RQDH
FUHMHLWDUQRWRGRRXHPSDUWHVRIRUQHFLPHQWRH[HFXomRHPGHVDFRUGRFRPRFRQWUDWR
&/È868/$48,17$'$62%5,*$d®(6'$&2175$7$'$
&DEHUi j &RQWUDWDGD HQTXDQWR YLJRUDU HVWH &RQWUDWR DOpP GDV REULJDo}HV GR 7HUPR GH
5HIHUrQFLDDVGHPDLVTXHVHVHJXHP
DUHDOL]DURIRUQHFLPHQWRRXH[HFXomRGRVHUYLoRDRUHVSRQViYHOGR6HWRUGD3UHIHLWXUD
0XQLFLSDOGHVWH0XQLFtSLRVHJXLQGRFURQRJUDPDGHHQWUHJD
E DSUHVHQWDU DQWHV GR IDWXUDPHQWR TXDGUR GHPRQVWUDWLYR GRV IRUQHFLPHQWRV SDUD
FRQIURQWRGHLQIRUPDo}HV
FFRPXQLFDUGHLPHGLDWRHSRUHVFULWRj&RQWUDWDQWHTXDOTXHUWLSRGHLUUHJXODULGDGHTXH
RFRUUDGXUDQWHDYLJrQFLDGHVWH&RQWUDWR
G IRUQHFHU DR &RQWUDWDQWH GH IRUPD UHJXODU H QDV TXDQWLGDGHV UHTXLVLWDGDV RV
SURGXWRVVHUYLoRVOLFLWDGRV
H DUFDU FRP RV {QXV UHIHUHQWHV DR IRUQHFLPHQWR RUD FRQWUDWDGR GHVGH R SDJDPHQWR GH
HQFDUJRVWUDEDOKLVWDVFRPHUFLDLVILVFDLVHSUHYLGHQFLiULRVQmRWUDQVIHULQGRSDUDD&RQWUDWDQWHD
UHVSRQVDELOLGDGHSRUVHXSDJDPHQWRQHPRQHUDURREMHWRGRFRQWUDWR
I UHVSRQGHU SHORV GDQRV FDXVDGRV GLUHWDPHQWH j $GPLQLVWUDomR RX D WHUFHLURV
GHFRUUHQWHVGHVXDFXOSDRXGRORQmRLQFOXLQGRRXUHGX]LQGRHVVDUHVSRQVDELOLGDGHjILVFDOL]DomR
RXDRDFRPSDQKDPHQWRSHOR&2175$7$17(
J SURYLGHQFLDU D LPHGLDWD FRUUHomR GDV GHILFLrQFLDV DSRQWDGDV SHOR &2175$7$17(
TXDQWRDRIRUQHFLPHQWRGRREMHWRFRQWUDWDGR
K SUHVWDU WRGRV RV HVFODUHFLPHQWRV TXH IRUHP VROLFLWDGRV SHOD ILVFDOL]DomR GR
&2175$7$17(FXMDVUHFODPDo}HVVHREULJDDDWHQGHUSURQWDPHQWH
LPDQWHUGXUDQWHDH[HFXomRGRFRQWUDWRHPFRPSDWLELOLGDGHFRPDVREULJDo}HVSRUHOH
DVVXPLGDVWRGDVDVFRQGLo}HVGHKDELOLWDomRHTXDOLILFDomRH[LJLGDVQDOLFLWDomR
MUHSDUDUFRUULJLUUHPRYHURXVXEVWLWXLUjVVXDVH[SHQVDVQRWRWDORXHPSDUWHRREMHWR
GR FRQWUDWR HP TXH VH YHULILFDUHP YtFLRV GHIHLWRV RX LQFRUUHo}HV UHVXOWDQWHV GRV SURGXWRV
HPSUHJDGRV
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
31 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&/È868/$6(;7$'2$03$52/(*$/
$ ODYUDWXUD GR SUHVHQWH &RQWUDWR GHFRUUH GR 3UHJmR 3UHVHQFLDO Qž UHDOL]DGD
FRPIXQGDPHQWRQRV'HFUHWRV0XQLFLSDLVQžHD/HLQž
&/È868/$6e7,0$'29$/25
2YDORUGRSUHVHQWH&RQWUDWRpHVWLPDGRHP5DVHUSDJRFRQIRUPH
HQWUHJDGRVSURGXWRV
&/È868/$2,7$9$'25($-867(
2YDORUHVWLSXODGRQDSURSRVWDLQLFLDOSRGHUiVHUUHDMXVWDGRHPFRQIRUPLGDGHFRPR$UW
LQFLVR,,DOtQHD³G´GD/HLQž
&/È868/$121$'23$*$0(172
2SDJDPHQWRVHUiHIHWXDGRHPPRHGDFRUUHQWHQDFLRQDOGHIRUPDSDUFHODGDGHDFRUGR
FRP D TXDQWLGDGH GR SURGXWR HQWUHJXH HRX VHUYLoR H[HFXWDGR PHGLDQWH HPLVVmR GH RUGHP
EDQFiULD HP IDYRU GD &2175$7$'$ HP DWp WULQWD GLDV DSyV D DSUHVHQWDomR GD 1RWD
)LVFDO)DWXUDDFRPSDQKDGDGDVUHTXLVLo}HVHPLWLGDVQDIRUPDGR(GLWDOGH3UHJmR3UHVHQFLDOQž
GHYLGDPHQWHDWHVWDGDSRUVHUYLGRUGD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
±+DYHQGRHUURQD1RWD)LVFDO)DWXUDRXFLUFXQVWkQFLDTXHDOLTXLGDomRGDGHVSHVDDTXHOD
VHUi GHYROYLGD H R SDJDPHQWR ILFDUi SHQGHQWH DWp TXH D &RQWUDWDGD SURYLGHQFLH DV PHGLGDV
VDQHDGRUDV 1HVWD KLSyWHVH R SUD]R SDUD R SDJDPHQWR LQLFLDUVHi DSyV D UHJXODUL]DomR GD
VLWXDomR HRX UHDSUHVHQWDomR GR GRFXPHQWR ILVFDO QmR DFDUUHWDQGR TXDOTXHU {QXV SDUD R
&RQWUDWDQWH
±2SDJDPHQWRGDVIDWXUDVTXDQGRKRXYHUUHDMXVWDPHQWRIDUVHiSRUPHLRGHGXDVIDWXUDV
XPD FRUUHVSRQGHQWH j SUySULD IDWXUD H RXWUD VXSOHPHQWDU UHIHUHQWH DR YDORU GR UHDMXVWDPHQWR
GHYLGRSRGHQGRDPEDVDVIDWXUDVWUDPLWDUFRQMXQWDPHQWHDFULWpULRGD&RQWUDWDQWH
&/È868/$'e&,0$'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±6HFUHWDULD0XQLFLSDOGD$GPLQLVWUDomR
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGH(GXFDomR
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH±*HVWmRGH6HUYLoRGH7UDQVSRUWH(VFRODU
)RQWH±5(&(GXFDomR±
)RQWH±5(&6DOiULR(GXFDomR±
8QLGDGH±)XQGR0XQLFLSDOGH$VVLVWrQFLD6RFLDO
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
32 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
2EMHWR$WLYLGDGH ± 6HUYLoR 6RFLRHGXFDWLYR H GH &RQYLYrQFLD SDUD HUUDGLFDomR GR WUDEDOKR
,QIDQWLO
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR%ROVD)DPtOLD
)RQWH
8QLGDGH±6HFUHWDULDGR7UDQVSRUWH7UkQVLWR(VWUDGDH5RGDJHP
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH6D~GH
&ODVVLILFDomR(FRQ{PLFD±2XWURV6HUYLoRVGH7HUFHLURV±3HVVRD-XUtGLFD
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± $o}HV ,QWHJUDGDV H $UWLFXODGDV HP 9LJLOkQFLD 6DQLWiULD FRP (QWLGDGHV
&LYLV
2EMHWR$WLYLGDGH±$WHQomRj6D~GHQRV6HUYLoRVGH0pGLDH$OWD&RPSOH[LGDGH
2EMHWR$WLYLGDGH±6HUYLoRGH$WHQomR%iVLFDHP6D~GH
2EMHWR$WLYLGDGH±$WHQomR(VSHFLDOL]DGDHP6D~GH0HQWDO
2EMHWR$WLYLGDGH±6HUYLoRGH$WHQGLPHQWR0yYHOGH8UJrQFLDH(PHUJrQFLD
2EMHWR$WLYLGDGH±6HUYLoRGH9LJLOkQFLD6DQLWiULD
2EMHWR$WLYLGDGH±6HUYLoRGH9LJLOkQFLD(SLGHPLROyJLFDH&RQWUROHGH'RHQoDV
)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
&/È868/$'e&,0$35,0(,5$'$9,*Ç1&,$('$9$/,'$'(
$YLJrQFLDGHVWHFRQWUDWRVHUiDWpDFRQWDUGDGDWDGHDVVLQDWXUDGR
&RQWUDWRSRGHQGRVHUSURUURJDGRDFULWpULRGD$GPLQLVWUDomR
&/È868/$'e&,0$6(*81'$'$66$1d®(6
3HODLQH[HFXomRWRWDORXSDUFLDOGRREMHWRFRQWUDWDGRD$GPLQLVWUDomRSRGHUiJDUDQWLGDD
SUpYLDGHIHVDDSOLFDUj&2175$7$'$DVVHJXLQWHVVDQo}HV
DDGYHUWrQFLD
E PXOWD GH XP SRU FHQWR DR GLD VREUH R YDORU GR FRQWUDWR SRU GLD GH DWUDVR QD
H[HFXomRHRXIRUQHFLPHQWRDWpRžYLJpVLPRGLD
F PXOWD GH YLQWH SRU FHQWR VREUH R YDORU GR FRQWUDWR D SDUWLU GR ž YLJpVLPR
SULPHLUR GLD SHOR DWUDVR QR IRUQHFLPHQWR HRX H[HFXomR IDFXOWDGD D UHVFLVmR FRQWUDWXDO VHP
SUHMXt]RGDVGHPDLVSHQDOLGDGHVSUHYLVWDVQD/HLQž
GSHORVPRWLYRVTXHVHVHJXHPSULQFLSDOPHQWHD&2175$7$'$HVWDUiVXMHLWDjPXOWD
WUDWDGDQHVWD&OiXVXOD
ƒ SHODUHFXVDLQMXVWLILFDGDGHUHFHEHUD1RWDGH(PSHQKRHDVVLQDUR&RQWUDWR
ƒ SHORDWUDVRQDHQWUHJDGRIRUQHFLPHQWRHPUHODomRDRSUD]RSURSRVWRHDFHLWRH
ƒ SHOD QmR HQWUHJD GR IRUQHFLPHQWR FDUDFWHUL]DQGRVH D IDOWD VH D HQWUHJD QmR VH
HIHWLYDUGHQWURGRVTXLQ]HGLDVTXHVHVHJXLUHPDRWpUPLQRGRSUD]RSURSRVWRHDFHLWR
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
33 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
H $ FULWpULR GD $GPLQLVWUDomR SRGHUmR VHU VXVSHQVDV DV SHQDOLGDGHV QR WRGR RX HP
SDUWHTXDQGRRDWUDVRGRIRUQHFLPHQWRGRVSURGXWRVIRUGHYLGDPHQWHMXVWLILFDGR
SHOD &2175$7$'$ H DFHLWR SHOD $GPLQLVWUDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD TXH IL[DUi
QRYRSUD]RHVWHLPSURUURJiYHOSDUDDFRPSOHWDH[HFXomRGDVREULJDo}HVDVVXPLGDV
&/È868/$'e&,0$7(5&(,5$'$5(6&,6­2
$LQH[HFXomRWRWDORXSDUFLDOGHVWH&RQWUDWRHQVHMDDVXDUHVFLVmRFRQIRUPHGLVSRVWRQRV
DUWLJRVDGD/HL
68%&/È868/$ 35,0(,5$ RV FDVRV GH UHVFLVmR FRQWUDWXDO VHUmR IRUPDOPHQWH
PRWLYDGRVQRVDXWRVGRSURFHVVRDVVHJXUDGRRFRQWUDGLWyULRHDDPSODGHIHVD
68%&/È868/$6(*81'$$UHVFLVmRGHVWH&RQWUDWRSRGHUiVHU
D GHWHUPLQDGD SRU DWR XQLODWHUDO H HVFULWR GD $GPLQLVWUDomR QRV FDVRV HQXPHUDGRV QRV
LQFLVRV , D ;,, H ;9,, GR DUWLJR GD /HL PHQFLRQDGD QRWLILFDQGRVH D &2175$7$'$ FRP D
DQWHFHGrQFLDPtQLPDGHWULQWDGLDVRX
E DPLJiYHO SRU DFRUGR HQWUH DV SDUWHV GHVGH TXH KDMD FRQYHQLrQFLD SDUD D
$GPLQLVWUDomRRX
FMXGLFLDOQRVWHUPRVGDOHJLVODomRYLJHQWHVREUHDPDWpULD
68%&/È868/$ 7(5&(,5$ D UHVFLVmR DGPLQLVWUDWLYD RX DPLJiYHO VHUi SUHFHGLGD GH
DXWRUL]DomRHVFULWDHIXQGDPHQWDGDGDDXWRULGDGHFRPSHWHQWH
&/È868/$'e&,0$48$57$±'235$=2(/2&$/'((175(*$'$0(5&$'25,$
)LFDHVWDEHOHFLGRTXHRSUD]RGHHQWUHJDGDPHUFDGRULDQmRVHUiVXSHULRUjKTXDUHQWD
HRLWRKRUDVFRQWDGRGRUHFHELPHQWRGD2UGHPGH)RUQHFLPHQWR6HUYLoRHTXHRORFDOGHHQWUHJD
GRVSURGXWRVRXH[HFXomRGRVVHUYLoRVVHUiQDVHGHGRPXQLFtSLR
&/È868/$'e&,0$48,17$'2)252
)LFD HOHLWR R )RUR GD &RPDUFD GH 9DOHQoD QR (VWDGR GD %DKLD SDUD GLULPLU TXDLVTXHU
G~YLGDVVXVFLWDGDVQDH[HFXomRGRSUHVHQWH&RQWUDWR
( SDUD YDOLGDGH GR TXH SHODV SDUWHV ILFRX DFHUWDGR ILUPDVH R SUHVHQWH LQVWUXPHQWR HP
WUrV YLDV GH LJXDO WHRU H IRUPD SDUD XP Vy HIHLWR GHSRLV GH OLGR H DFKDGR FRQIRUPH QD
SUHVHQoDGHGXDVWHVWHPXQKDVTXHRVXEVFUHYHPYDLSHODVSDUWHVDVVLQDGR
9DOHQoDGHGH
&RQWUDWDQWH
&2175$7$'$
BBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBB
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
34 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
(',7$/'(/,&,7$d­2
35(*­235(6(1&,$/1ž
2081,&,3,2 '(9$/(1d$(67$'2'$%$+,$ SRULQWHUPpGLRGD 3UHIHLWXUD0XQLFLSDO
GH 9DOHQoD DWUDYpV GR 35(*2(,52 2),&,$/ H (TXLSH GH $SRLR GHVLJQDGR SHOD 3RUWDULD
GHGHMDQHLURGHWRUQDS~EOLFRSDUDFRQKHFLPHQWRGRVLQWHUHVVDGRVTXHIDUi
UHDOL]DUSURFHGLPHQWROLFLWDWyULRQDPRGDOLGDGH³35(*­235(6(1&,$/´7LSR0(12535(d2
*/2%$/325/27(SHOR6,67(0$'(5(*,6752'(35(d26QRGLDGHMXOKRGH
jV KRUDV FRQIRUPH GHVFULWR QHVWH (GLWDO H VHXV DQH[RV GH FRQIRUPLGDGH FRP DV /HLV
)HGHUDLV Qƒ 'HFUHWRV 0XQLFLSDLV Qž H OHJLVODomR
YLJHQWH
2V HQYHORSHV FRQWHQGR D SURSRVWD GH SUHoR H RV GRFXPHQWRV GH KDELOLWDomR GHYHUmR VHU
HQWUHJXHV DR SUHJRHLUR jV KRUDV GR GLD VHWRU GH OLFLWDomR QD VHGH GHVWD
3UHIHLWXUD 6,78$'$ 3529,625,$0(17( $ 58$ &(&,/,$ 0(,5(/(6 1ž &(1752
9$/(1d$%$+,$$QWLJR&ROpJLR3DXOR)UHLUH
2VLQWHUHVVDGRVHPFRQKHFHUDtQWHJUDGRHGLWDOHVWHHVWDUiGLVSRQtYHOQRVLWLRHOHWU{QLFRGD
3UHIHLWXUD0XQLFLSDOZZZYDOHQFDEDLRRUJEUHFDVRRLQWHUHVVDGRTXHLUDRHGLWDOLPSUHVVRHVWH
GHYHUi VH GLULJLU D 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD ORFDOL]DGD D 5XD 0DUHFKDO )ORULDQR 3HL[RWR
Qž &HQWUR 9DOHQoD%DKLD PHGLDQWH SDJDPHQWR QR YDORU QmR UHHPEROViYHO 5 FLQTXHQWDUHDLVUHIHUHQWHDRVFXVWRVFRQIRUPHDUWLJR†žGD/HLQž
'22%-(72'$/,&,7$d­2
2SUHVHQWH3UHJmRWHPSRUREMHWRR5(*,6752'(35(d26SDUDHYHQWXDOFRQWUDWDomRGH
HPSUHVD HVSHFLDOL]DGD SDUD )251(&,0(172 '( 0$7(5,$/ 3$5$ 7(/()21,$ (
&$%($0(172 (6758785$'2 TXH VH GHVWLQDUmR jV GLYHUVDV 6HFUHWDULDV GR 0XQLFtSLR
FRQIRUPHHVSHFLILFDo}HVFRQVWDQWHVQRDQH[R,TXHLQWHJUDHVWH(GLWDO
REGISTRO DE PREÇOS
Lei Federal n° 8.666/93
"Art.15 inciso V parágrafo 4º - A existência de preços registrados não obriga a
Administração a firmar as contratações que deles poderão advir, ficando-lhe
facultada a utilização de outros meios, respeitada a legislação relativa as
licitações, sendo assegurado ao beneficiário do registro preferência em
igualdade de condições."
'$6&21',d®(6'(3$57,&,3$d­2
3RGHUmRSDUWLFLSDUGHVWH3UHJmRRVLQWHUHVVDGRVGRUDPRGHDWLYLGDGHSHUWLQHQWHDRREMHWR
GDFRQWUDWDomRTXHDWHQGHUHPDWRGDVDVH[LJrQFLDVFRQVWDQWHVGHVWH(GLWDOHVHXV$QH[RV
1mR SRGHUmR SDUWLFLSDU GD SUHVHQWH OLFLWDomR RV LQWHUHVVDGRV TXH VH HQTXDGUHP QDV
VHJXLQWHVKLSyWHVHVDVHJXLUHOHQFDGDV
7HQKDP VLGR GHFODUDGRV LQLG{QHRV SDUD OLFLWDU RX FRQWUDWDU FRP D $GPLQLVWUDomR 3~EOLFD
HQTXDQWR SHUGXUDUHP RV PRWLYRV GHWHUPLQDQWHV GD SXQLomR RX DWp TXH VHMD SURPRYLGD D
UHDELOLWDomR SHUDQWH D SUySULD DXWRULGDGH TXH DSOLFRX D SHQDOLGDGH TXH VHUi FRQFHGLGD VHPSUH
TXHRFRQWUDWDGRUHVVDUFLUD$GPLQLVWUDomRSHORVSUHMXt]RVUHVXOWDQWHVHDSyVGHFRUULGRRSUD]R
GD VDQomR DSOLFDGD FRP EDVH QR LQFLVR DQWHULRU LQFLVR ,9 GR DUW GD OHL GH GH
MXQKRGH
4XH VH HQFRQWUHP VRE IDOrQFLD FRQFRUGDWD FRQFXUVR GH FUHGRUHV GLVVROXomR RX
OLTXLGDomR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
35 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
4XH HP UHJLPH GH FRQVyUFLR TXDOTXHU TXH VHMD VXD IRUPD GH FRQVWLWXLomR VHMDP
FRQWURODGRUDVFROLJDGDVRXVXEVLGLiULDVHQWUHVL
(VWUDQJHLUDVTXHQmRIXQFLRQHPQR3DtV
4XHQmRGHWHQKDPDDWLYLGDGHSHUWLQHQWHHFRPSDWtYHOFRPRREMHWRGHVWH3UHJmR
$SDUWLFLSDomRQDSUHVHQWHOLFLWDomRILFDFRQGLFLRQDGDDRDWHQGLPHQWRDWRGDVDVH[LJrQFLDV
FRQVWDQWHVGHVWH(GLWDOHVHXVDQH[RVFRUUHQGRSRUFRQWDGDVHPSUHVDVLQWHUHVVDGDVWRGRVRV
FXVWRVGHFRUUHQWHVGDHODERUDomRHDSUHVHQWDomRGHVXDVSURSRVWDVQmRVHQGRGHYLGDQHQKXPD
LQGHQL]DomRjVOLFLWDQWHVSHODUHDOL]DomRGHWDLVDWRV
'2&5('(1&,$0(172)25$'26(19(/23(6
$SUHVHQWDU±VHGHYLGDPHQWHFUHGHQFLDGRVFRQIRUPHPRGHOR$QH[R,,,RVUHSUHVHQWDQWHV
OHJDLV GD HPSUHVD OLFLWDQWH RX VHXV SURFXUDGRUHV FRQVWLWXtGRV QD IRUPD GD OHL PXQLGRV GH
FHUWLILFDGRV GH KDELOLWDomR SUpYLD TXDQGR IRU R FDVR 7UDWDQGR±VH GH SURFXUDomR D PHVPD
GHYHUiFRQIHULUDPSORVSRGHUHVSDUDUHSUHVHQWDURXFRPILPHVSHFLILFRSDUDDSUHVHQWHOLFLWDomR
2UHSUHVHQWDQWHGHYHUiDSUHVHQWDURGRFXPHQWRGHLGHQWLILFDomR5*RXRXWURGRFXPHQWRRILFLDO
±'HYHUiRUHSUHVHQWDQWHGDHPSUHVDOLFLWDQWHDSUHVHQWDUMXQWDPHQWHFRPDFUHGHQFLDOD
'HFODUDomR GH PLFURHPSUHVD RX GH HPSUHVD GH SHTXHQR SRUWH REMHWLYDQGR H[HUFtFLR GD
SUHIHUrQFLD SUHYLVWD QD /HL &RPSOHPHQWDU Qž GH DFRUGR FRP R PRGHOR FRPSRVWR SHOR
$QH[R 9,, TXH GHYHUi VHU DSUHVHQWDGD IRUD GRV HQYHORSHV ³³ H ³´ MXQWDPHQWH FRP RV
GRFXPHQWRVGHFUHGHQFLDPHQWRVHQRGLDGHVLJQDGRSDUDRUHFHELPHQWRGRVHQYHORSHV
'$)250$'($35(6(17$d­2'26(19(/23(6³´H³´
'HFODUDGD DEHUWD j VHVVmR SHOR 3UHJRHLUR R V UHSUHVHQWDQWH V GD V OLFLWDQWH V
DSUHVHQWDUimR GHFODUDomR GDQGR FLrQFLD GH TXH FXPSUHP SOHQDPHQWH RV UHTXLVLWRV GH
KDELOLWDomR $QH[R 9 HP HQYHORSH SUySULR H HQWUHJDUimR RV (19(/23(6 /$&5$'26
FRQWHQGR DV SURSRVWDV GH SUHoRV H RV GRFXPHQWRV GH KDELOLWDomR QmR VHQGR DFHLWD D SDUWLU
GHVVHPRPHQWRDDGPLVVmRGHQRYRVOLFLWDQWHV
2V HQYHORSHV ³´ H ³´ FRQWHQGR UHVSHFWLYDPHQWH D SURSRVWD GH SUHoR H GRFXPHQWDomR
UHIHUHQWH j KDELOLWDomR GHYHUmR VHU HQWUHJXHV QD GDWD KRUiULR H ORFDO LQGLFDGRV QR SUHkPEXOR
GHVWHHGLWDOGHYLGDPHQWHODFUDGRVFRQVWDQGRGDIDFHGHFDGDTXDORVVHJXLQWHVGL]HUHV
D(19(/23(3523267$'(35(d26
35()(,785$081,&,3$/'(9$/(1d$%$+,$
35(*­235(6(1&,$/1ž
5$=­262&,$/(1ƒ'2&13-'2/,&,7$17(
E(19(/23('2&80(1726'(+$%,/,7$d­2
35()(,785$081,&,3$/'(9$/(1d$%$+,$
35(*­235(6(1&,$/1ƒ
5$=­262&,$/(1ƒ'2&13-'2/,&,7$17(
'$3523267$'(35(d2
$3URSRVWDGH3UHoRVGHYHUiVHUDSUHVHQWDGDHPXPDYLDLPSUHVVDUHGLJLGDFRPFODUH]D
HP OtQJXD SRUWXJXHVD VHP HPHQGDV VHP UDVXUDV RX HQWUHOLQKDV GHYLGDPHQWH GDWDGD H
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
36 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
DVVLQDGDQD~OWLPDIROKDHUXEULFDGDQDVGHPDLVSHORUHSUHVHQWDQWHOHJDOGDOLFLWDQWHQDIRUPDGR
$QH[R,,
1D3URSRVWDGH3UHoRVGHYHUmRFRQVWDUVRESHQDGHGHVFODVVLILFDomR
±5D]mR6RFLDOGDOLFLWDQWH
1žGR&13-0)
(QGHUHoRFRPSOHWR
7HOHIRQH
)D[SDUDFRQWDWR
1žGD&RQWDFRUUHQWHDJrQFLDHUHVSHFWLYR%DQFR
3UD]RGHHILFiFLDGDSURSRVWDRTXDOQmRSRGHUiVHULQIHULRUDVHVVHQWDGLDVFRUULGRV
DFRQWDUGDGDWDGHVXDDSUHVHQWDomR
8PD ~QLFD FRWDomR FRP SUHoRV XQLWiULRV WRWDLV H JOREDLV HP PRHGD FRUUHQWH QDFLRQDO
H[SUHVVRVHPDOJDULVPRVHSRUH[WHQVRVHPSUHYLVmRLQIODFLRQiULD(PFDVRGHGLYHUJrQFLDHQWUH
RV YDORUHV XQLWiULRV H WRWDLV VHUmR FRQVLGHUDGRV RV SULPHLURV H HQWUH RV YDORUHV H[SUHVVRV HP
DOJDULVPRHSRUH[WHQVRVHUiFRQVLGHUDGRHVWH~OWLPR
&RWDomR SRU LWHP FRP YDORUHV XQLWiULRV WRWDLV H JOREDLV FRP D PDUFD GRV SURGXWRV
FRWDGRVQRFDVRGHSURGXWRVLQGXVWULDOL]DGRVVRESHQDGHGHVFODVVLILFDomR
3UD]RGHIRUQHFLPHQWRH[HFXomRQmRVXSHULRUDGH]GLDVFRQWDGRGRUHFHELPHQWRGD
2UGHPGH)RUQHFLPHQWR6HUYLoR
1RVSUHoRVSURSRVWRVGHYHUmRHVWDULQFOXtGRVDOpPGROXFURWRGDVDVGHVSHVDVHFXVWRV
FRPRSRUH[HPSORWUDQVSRUWHOLPSH]DVHJXURVWULEXWRVGHTXDOTXHUQDWXUH]DHWRGDVDVGHPDLV
GHVSHVDV GLUHWDV RX LQGLUHWDV UHODFLRQDGDV FRP D SUHVWDomR GH VHUYLoRV REMHWR GD SUHVHQWH
OLFLWDomR
± 2V SUHoRV RIHUWDGRV SHUPDQHFHUmR IL[RV SHOR SUD]R GH XP DQR D FRQWDU GD GDWD GH
DVVLQDWXUDGD$WDGH5HJLVWURGH3UHoRV
$ DSUHVHQWDomR GDV SURSRVWDV LPSOLFDUi QD SOHQD DFHLWDomR SRU SDUWH GR OLFLWDQWH GDV
FRQGLo}HVHVWDEHOHFLGDVQHVWH(GLWDOHVHXV$QH[RV
6HUmRGHVFODVVLILFDGDVDVSURSRVWDVTXHQmRDWHQGHUHPDVHVSHFLILFDo}HVHH[LJrQFLDVGR
SUHVHQWH (GLWDO H GH VHXV $QH[RV H TXH DSUHVHQWHP RPLVV}HV LUUHJXODULGDGHV RX GHIHLWRV
FDSD]HVGHGLILFXOWDURMXOJDPHQWR
(P QHQKXPD KLSyWHVH SRGHUi VHU DOWHUDGR R FRQWH~GR GD SURSRVWD DSUHVHQWDGD VHMD FRP
UHODomRDSUHoRXQLWiULRSDJDPHQWRSUD]RRXTXDOTXHUFRQGLomRTXHLPSRUWHDPRGLILFDomRGRV
WHUPRVRULJLQDLV
'2-8/*$0(172'$63523267$6
$UWLJRR9,,,,;;;,;,,;9;9,;9,,H;;,,,GD/HLQR
$EHUWRVRVHQYHORSHVDVSURSRVWDVVHUmRUXEULFDGDVSHOR3UHJRHLURHHTXLSHGHDSRLR
/LGR RV SUHoRV R 3UHJRHLUR UHODFLRQDUi WRGDV DV SURSRVWDV HP RUGHP FUHVFHQWH (P
VHJXLGDFODVVLILFDUiDVGHPHQRUSUHoRJOREDOSRUORWH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
37 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
3DUDMXOJDPHQWRHFODVVLILFDomRGDVSURSRVWDVQDVHVVmRS~EOLFDVHUiDGRWDGRRFULWpULR
GH0(12535(d2*/2%$/325/27(REVHUYDGRVRVSUD]RVPi[LPRVSDUDIRUQHFLPHQWR
$SyVDDEHUWXUDGRVHQYHORSHVFRQWHQGRDVSURSRVWDVGHSUHoRVRDXWRUGDRIHUWDGHYDORU
PDLVEDL[RHRVGDVRIHUWDVFRPSUHoRVDWpGH]SRUFHQWRVXSHULRUHVjTXHODSRGHUmRID]HU
QRYRVODQFHVYHUEDLVHVXFHVVLYRVDWpDSURFODPDomRGRYHQFHGRU
$SyVDSUHVHQWDomRGDSURSRVWDQmRFDEHUiGHVLVWrQFLDVDOYRSRUPRWLYRMXVWRGHFRUUHQWH
GHIDWRVXSHUYHQLHQWHHDFHLWRSHOR3UHJRHLUR
1mRKDYHQGRSHORPHQRVWUrVRIHUWDVQDVFRQGLo}HVGHILQLGDVQRLWHPSRGHUmR
RV DXWRUHVGDV PHOKRUHV SURSRVWDV DWp R Pi[LPR GH WUrV RIHUHFHU QRYRV ODQFHV YHUEDLV H
VXFHVVLYRVTXDLVTXHUTXHVHMDPRVSUHoRVRIHUHFLGRV
1R FDVR GH HPSDWH QRV SUHoRV VHUmR DGPLWLGDV WRGDV DV SURSRVWDV HPSDWDGDV
LQGHSHQGHQWHPHQWHGRQ~PHURGHOLFLWDQWHV
2 SUHJRHLUR FRQYLGDUi LQGLYLGXDOPHQWH RV OLFLWDQWHV FODVVLILFDGRV GH IRUPD VHTHQFLDO D
DSUHVHQWDUODQFHVYHUEDLVDSDUWLUGRDXWRUGDSURSRVWDFODVVLILFDGDGHPDLRUSUHoRJOREDOSRUORWH
HRVGHPDLVHPRUGHPGHFUHVFHQWHGHYDORUJOREDOKDYHUiVRUWHLRHPFDVRGHHPSDWH
± 2V ODQFHV GHYHUmR VHU IRUPXODGRV SRU YDORU JOREDO SRU ORWH HP YDORUHV GLVWLQWRV H
GHFUHVFHQWHVLQIHULRUHVDSURSRVWDGHPHQRUSUHoRFRQVLGHUDQGRRYDORUWRWDOGRORWH
±2LQWHUYDORPtQLPRGHYDORUHQWUHRVODQFHVDVHUHPDSUHVHQWDGRVSHORVOLFLWDQWHVVHUi
GHILQLGRSHORSUHJRHLUR
±$GHVLVWrQFLDHPDSUHVHQWDUODQFHYHUEDOTXDQGRFRQYRFDGRSHORSUHJRHLURLPSOLFDUiD
H[FOXVmR GR OLFLWDQWH GD HWDSD GH ODQFHV YHUEDLV H QD PDQXWHQomR GR ~OWLPR SUHoR DSUHVHQWDGR
SHOROLFLWDQWHSDUDHIHLWRGHRUGHQDomRGDVSURSRVWDV
1mRSRGHUiKDYHUGHVLVWrQFLDGRVODQFHVRIHUWDGRVVXMHLWDQGRVHRSURSRQHQWHGHVLVWHQWH
jVSHQDOLGDGHVFRQVWDQWHVQRLWHPGHVWH(GLWDO
&DVRQmRVHUHDOL]DUHPODQFHVYHUEDLVVHUiYHULILFDGDDFRQIRUPLGDGHHQWUHDSURSRVWD
HVFULWDGHPHQRUSUHoRHRYDORUHVWLPDGRSDUDDFRQWUDWDomR
'HFODUDGD HQFHUUDGD D HWDSD FRPSHWLWLYD H RUGHQDGDV jV SURSRVWDV R SUHJRHLUR
H[DPLQDUi D DFHLWDELOLGDGH GD SULPHLUD FODVVLILFDGD TXDQWR DR REMHWR H YDORU GHFLGLQGR
PRWLYDGDPHQWHDUHVSHLWR
&RQVLGHUDGDDRIHUWDGHPHQRUSUHoRDFHLWiYHOVHKRXYHUSDUWLFLSDomRGH0LFURHPSUHVD
±0(RX(PSUHVDGH3HTXHQR3RUWH(33QRFHUWDPHVHUmRREVHUYDGDVDVGLVSRVLo}HVGD/HL
&RPSOHPHQWDUQž
6H D SURSRVWD GD 0((33 PHOKRU FRORFDGD IRU VXSHULRU HP DWp FLQFR SRU FHQWRGR
YDORUGROLFLWDQWHGHPHOKRURIHUWDVHUiFRQFHGLGRRSUD]RGHFLQFRPLQXWRVSDUDDSUHVHQWDU
SUHoRLQIHULRU
1D KLSyWHVH GD 0((33 PHOKRU FODVVLILFDGD QmR DSUHVHQWDU QRYD SURSRVWD VHUi
FRQYRFDGDDVHJXQGD0((33PHOKRUFODVVLILFDGDHDVVLPVXFHVVLYDPHQWHDWpTXHVHFKHJXH
jPDUJHPGHVXSHULRUDRYDORUGROLFLWDQWHFODVVLILFDGRHPžSULPHLUROXJDU
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
38 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
1mRKDYHQGRQHQKXPDSURSRVWDQDIDL[DGHDWpFLQFRSRUFHQWRVXSHULRUjPHOKRU
RIHUWDRXQmRKDYHQGRQRYDSURSRVWDGH0((33DSURSRVWDRULJLQiULDVHUiFRQVLGHUDGDFRPRD
PHOKRUFODVVLILFDGD
6HQGR DFHLWiYHO D SURSRVWD GH PHQRU SUHoR VHUi DEHUWR R HQYHORSH FRQWHQGR D
GRFXPHQWDomR GH KDELOLWDomR GR OLFLWDQWH TXH D WLYHU IRUPXODGR SDUD FRQILUPDomR GDV VXDV
FRQGLo}HVKDELOLWDWyULDV
&RQVWDWDGR R DWHQGLPHQWR GDV H[LJrQFLDV IL[DGDV QR HGLWDO R OLFLWDQWH VHUi GHFODUDGR
YHQFHGRUVHQGROKHDGMXGLFDGRRREMHWRGRFHUWDPH
6H D RIHUWD QmR IRU DFHLWiYHO RX VH R OLFLWDQWH GHVDWHQGHU jV H[LJrQFLDV KDELOLWDWyULDV R
SUHJRHLUR H[DPLQDUi D RIHUWD VXEVHTHQWH YHULILFDQGR D VXD DFHLWDELOLGDGH H SURFHGHQGR j
KDELOLWDomRGRSURSRQHQWHQDRUGHPGHFODVVLILFDomRHDVVLPVXFHVVLYDPHQWHDWpDDSXUDomRGH
XPD SURSRVWD TXH DWHQGD DR HGLWDO VHQGR R UHVSHFWLYR OLFLWDQWH GHFODUDGR YHQFHGRU H D HOH
DGMXGLFDGRRREMHWRGRFHUWDPH
1DV VLWXDo}HV SUHYLVWDV QRV VXELWHQV H R SUHJRHLUR SRGHUi QHJRFLDU
GLUHWDPHQWHFRPRSURSRQHQWHSDUDTXHVHMDREWLGRSUHoRPHOKRU
'D UHXQLmR ODYUDUVHi DWD FLUFXQVWDQFLDGD QD TXDO VHUmR UHJLVWUDGDV DV RFRUUrQFLDV
UHOHYDQWHV GHYHQGR D PHVPD DR ILQDO VHU DVVLQDGD SHOR 3UHJRHLUR H RV OLFLWDQWHV SUHVHQWHV
UHVVDOWDQGRVH TXH SRGHUi FRQVWDU j DVVLQDWXUD GD HTXLSH GH DSRLR VHQGROKHV IDFXOWDGR HVVH
GLUHLWR
'$+$%,/,7$d­2
$UWLJRR;,,,;,9GD/HLQRFFD/HLQž
2 HQYHORSH ³´ FRQWHQGR D GRFXPHQWDomR UHODWLYD j +DELOLWDomR GHYHUi FRQWHU
REULJDWRULDPHQWHVRESHQDGHLQDELOLWDomRGDOLFLWDQWHRVGRFXPHQWRVDVHJXLULQGLFDGRV
+$%,/,7$d­2-85Ë',&$
D&pGXODGH,GHQWLGDGHGRVVyFLRVLQFOXVLYHHPFDVRGHILUPDLQGLYLGXDO
E$WRFRQVWLWXWLYRHVWDWXWRRXFRQWUDWRVRFLDOHPYLJRUGHYLGDPHQWHUHJLVWUDGRHP
VH WUDWDQGR GH VRFLHGDGHV FRPHUFLDLV H DFRPSDQKDGR QR FDVR GH VRFLHGDGHV SRU
Do}HVGRFXPHQWRVGHHOHLomRGHVHXVDWXDLVDGPLQLVWUDGRUHV
F ,QVFULomR GR DWR FRQVWLWXWLYR QR FDVR GH VRFLHGDGH FLYLO DFRPSDQKDGD GH SURYD GD
GLUHWRULDHPH[HUFtFLR
G 'HFUHWR GH DXWRUL]DomR HP VH WUDWDQGR GH HPSUHVD RX VRFLHGDGH HVWUDQJHLUD HP
IXQFLRQDPHQWRQR3DtV
H7RGDVDVOLFLWDQWHVGHYHUmRDSUHVHQWDUDGHFODUDomRFRQIRUPHPRGHORGR$QH[R,9
DWHVWDQGRTXH
1mR H[LVWH HP VHX TXDGUR GH HPSUHJDGRV VHUYLGRUHV S~EOLFRV H[HUFHQGR
IXQo}HVGHJHUrQFLDDGPLQLVWUDomRRXWRPDGDGHGHFLVmR
,QH[LVWHIDWRVXSHUYHQLHQWHLPSHGLWLYRGHKDELOLWDomRQDIRUPDGR$UW†ž
GD/HL
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
39 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
1mRSRVVXLHPVHXTXDGURGHSHVVRDOHPSUHJDGRVFRPPHQRVGHDQRVHP
WUDEDOKRQRWXUQRSHULJRVRRXLQVDOXEUHHPHQRUGHDQRVHPTXDOTXHUWUDEDOKR
VDOYRQDFRQGLomRGHDSUHQGL]DSDUWLUGHDQRVQRVWHUPRVGRDUWž;;;,,,
GD&RQVWLWXLomR)HGHUDOHDUW9GD/HL
5(*8/$5,'$'(),6&$/75$%$/+,67$
D3URYDGH,QVFULomRQR&DGDVWUR1DFLRQDOGH3HVVRD-XUtGLFD&13-
E 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD )HGHUDO H 'tYLGD $WLYD GD 8QLmR
PHGLDQWH D DSUHVHQWDomR GH &HUWLGmR GH 4XLWDomR GH 7ULEXWRV H &RQWULEXLo}HV
)HGHUDLV H[SHGLGR SHOD 6HFUHWDULD GD 5HFHLWD )HGHUDO GR GRPLFLOLR RX VHGH GR
SURSRQHQWH
F 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD (VWDGXDO PHGLDQWH DSUHVHQWDomR GH
&HUWLGmR GH 5HJXODULGDGH )LVFDO H[SHGLGD SHOD 6HFUHWDULD GD )D]HQGD (VWDGXDO GR
GRPLFLOLRRXVHGHGRSURSRQHQWH
G 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD 0XQLFLSDO PHGLDQWH DSUHVHQWDomR GH
&HUWLGmR GH 5HJXODULGDGH )LVFDO H[SHGLGD SHOD 6HFUHWDULD GD )D]HQGD 0XQLFLSDO GR
GRPLFLOLRRXVHGHGRSURSRQHQWH
H 3URYD GH UHJXODULGDGH UHODWLYD DR )XQGR GH *DUDQWLD SRU 7HPSR GH 6HUYLoR )*76
GHPRQVWUDQGRDVLWXDomRUHJXODUQRFXPSULPHQWRGRVHQFDUJRVVRFLDLVLQVWLWXtGRVSRU
OHL
I 3URYD GH UHJXODULGDGH UHODWLYD D 6HJXULGDGH 6RFLDO MXQWR D 3UHYLGrQFLD 6RFLDO ,166
GHPRQVWUDQGRDVLWXDomRUHJXODUQRFXPSULPHQWRGRVHQFDUJRVVRFLDLVLQVWLWXtGRVSRU
OHL
J &HUWLGmR 1HJDWLYD GH )DOrQFLD H &RQFRUGDWD H[SHGLGD SHOR GLVWULEXLGRU GD VHGH GR
SURSRQHQWHH[SHGLGDDPHQRVGHQRYHQWDGLDVGDDEHUWXUDGDVSURSRVWDV
K$OYDUiGHORFDOL]DomRHIXQFLRQDPHQWRRXGRFXPHQWRHTXLYDOHQWH±HPLWLGRSHOR3RGHU
([HFXWLYR0XQLFLSDO
L$OYDUiGH9LJLOkQFLD6DQLWiULDGDVHGHGDOLFLWDQWH
M3URYDGHLQH[LVWrQFLDGHGpELWRVLQDGLPSOLGRVSHUDQWHD-XVWLoDGR7UDEDOKRPHGLDQWH
DDSUHVHQWDomRGHFHUWLGmRQHJDWLYDQRVWHUPRVGR7tWXOR9,,$GD&RQVROLGDomRGDV
/HLVGR7UDEDOKR
48$/,),&$d­27e&1,&$
D $SUHVHQWDomR GH QR PtQLPR GRLV DWHVWDGRV IRUQHFLGRV SRU SHVVRD MXUtGLFD GH
GLUHLWR S~EOLFR RX SULYDGRV FRPSURYDQGR D UHDOL]DomR GH WUDEDOKRV H[HFXomR GH
VHUYLoRV HRX IRUQHFLPHQWRV FRPSDWtYHLV HP FDUDFWHUtVWLFDV TXDQWLGDGHV H SUD]RV
FRPRREMHWRGHVWDOLFLWDomRFRQIRUPHPRGHORDQH[R9,
48$/,),&$d­2(&21Ð0,&2±),1$1&(,5$
D%DODQoR3DWULPRQLDOHGHPRQVWUDo}HVFRQWiEHLVGHH[HUFtFLRILQDQFHLURGRDQR
TXH FRPSURYHP D ERD VLWXDomR ILQDQFHLUD H RSHUDFLRQDO GD HPSUHVD YHGDGD D VXD
VXEVWLWXLomR SRU EDODQFHWHV RX EDODQoR SURYLVyULRV 1mR VHQGR D OLFLWDQWH REULJDGD D
SXEOLFDURVHXEDODQoRGHYHUiDSUHVHQWDUIRWRFySLDDXWHQWLFDGDGDSiJLQDGR/LYUR'LiULR
RQGH IRL WUDQVFULWR R UHIHULGR EDODQoR H D GHPRQVWUDomR GR UHVXOWDGR GR H[HUFtFLR (VWHV
GRFXPHQWRV GHYHUmR FRQWHU DV DVVLQDWXUDV GH SHOR PHQRV XP VyFLRJHUHQWH H GR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
40 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
FRQWDGRU UHVSRQViYHO DWUDYpV GR VHOR GH KDELOLWDomR SURILVVLRQDO GHYLGDPHQWH UHJLVWUDGR
QR &RQVHOKR 5HJLRQDO GH &RQWDELOLGDGHV GR (VWDGR RQGH RV PHVPRV IRUDP HIHWXDGRV
FRP RV UHVSHFWLYRV WHUPRV GH DEHUWXUD GH HQFHUUDPHQWR UHJLVWUR QD -XQWD &RPHUFLDO GR
(VWDGRGD6HGHGD/LFLWDQWHRXQR5HJLVWURGH7tWXORVH'RFXPHQWRV
E¬V6RFLHGDGHVHQTXDGUDGDVQRUHJLPHHVWDEHOHFLGRQD/HLQžGHGHGH]HPEUR
GH±/HLGDV0LFURHPSUHVDVHGDV(PSUHVDVGH3HTXHQR3RUWHQmRVHUiH[LJLGRR
%DODQoR 3DWULPRQLDO FRQIRUPH UHJH R $UW GD &RQVWLWXLomR )HGHUDO GHVGH TXH ILTXH
FRPSURYDGRRVHXHQTXDGUDPHQWR
7RGDV DV OLFLWDQWHV GHYHUmR DSUHVHQWDU GHQWUR GR HQYHORSH Qž RV GRFXPHQWRV
HVSHFLILFDGRV SDUD D SDUWLFLSDomR QHVWH 3UHJmR GHYHUmR VHU HQWUHJXHV SUHIHUHQFLDOPHQWH
QXPHUDGRV VHTHQFLDOPHQWH D ILP GH SHUPLWLU FHOHULGDGH QD FRQIHUrQFLD H H[DPH
FRUUHVSRQGHQWHV
6RESHQDGHLQDELOLWDomRWRGRVRVGRFXPHQWRVDSUHVHQWDGRVSDUDKDELOLWDomRGHYHUmRHVWDU
(P QRPH GD OLFLWDQWH H SUHIHUHQFLDOPHQWH FRP QXPHUR GR &13- H FRP HQGHUHoR
UHVSHFWLYR
DVHDOLFLWDQWHIRUDPDWUL]WRGRVRVGRFXPHQWRVGHYHUmRHVWDUHPQRPHGDPDWUL]RX
E VH D OLFLWDQWH IRU ILOLDO WRGRV RV GRFXPHQWRV GHYHUmR HVWDU HP QRPH GD ILOLDO H[FHWR
DTXHOHV GRFXPHQWRV TXH SHOD SUySULD QDWXUH]D FRPSURYDGDPHQWH IRUHP HPLWLGRV
VRPHQWHHPQRPHGDPDWUL]
FRVDWHVWDGRVGHFDSDFLGDGHWpFQLFDUHVSRQVDELOLGDGHWpFQLFDSRGHUmRVHUDSUHVHQWDGRV
HPQRPHHFRP&13-GDPDWUL]HRXGDVILOLDOLVGDOLFLWDQWH
'DWDGRV GRV ~OWLPRV FHQWR H RLWHQWD GLDV DWpD GDWD GH DEHUWXUD GD VHVVmR S~EOLFD
TXDQGRQmRWLYHUSUD]RHVWDEHOHFLGRSHORyUJmRFRPSHWHQWHH[SHGLGRU
D QmR VH HQTXDGUDP QR SUD]R GH TXH WUDWD R LWHP DQWHULRU RV GRFXPHQWRV FXMD YDOLGDGH p
LQGHWHUPLQDGDFRPRpRFDVRGRVDWHVWDGRVGHFDSDFLGDGHUHVSRQVDELOLGDGHWpFQLFD
2VGRFXPHQWRVSUHYLVWRVQHVWH(GLWDOSRGHUmRVHUDXWHQWLFDGRVSHORSUHJRHLURHSHODHTXLSH
GHDSRLRDSDUWLUGRRULJLQDOSUHIHUHQFLDOPHQWHHPPRPHQWRDQWHULRUDR3UHJmR
6HUmRDFHLWDVVRPHQWHFySLDVOHJtYHLV
1mRVHUmRDFHLWRVGRFXPHQWRVFXMDVGDWDVHVWHMDPUDVXUDGDV
2 3UHJRHLUR UHVHUYDVH R GLUHLWR GH VROLFLWDU R RULJLQDO GH TXDOTXHU GRFXPHQWR VHPSUH TXH
WLYHUG~YLGDHMXOJDUQHFHVViULR
2VGRFXPHQWRVQHFHVViULRVjKDELOLWDomRSRGHUmRVHUDSUHVHQWDGRVHPRULJLQDORXHPFySLD
DXWHQWLFDGD SRU FDUWyULR FRPSHWHQWH RX SRU TXDOTXHU VHUYLGRU RX HP SXEOLFDomR GD LPSUHQVD
RILFLDO RX HP FySLDV VLPSOHV GHVGH TXH DFRPSDQKDGDV GRV RULJLQDLV SDUD FRQIHUrQFLD SHOR
3UHJRHLUR
1mRVHUmRDFHLWRVSURWRFRORVGHHQWUHJDRXVROLFLWDo}HVGHGRFXPHQWRHPVXEVWLWXLomRDRV
GRFXPHQWRVUHTXHULGRVQRSUHVHQWH(GLWDOHVHXVDQH[RV
6H D GRFXPHQWDomR GH KDELOLWDomR QmR HVWLYHU FRPSOHWD H FRUUHWD RX FRQWUDULDU TXDOTXHU
GLVSRVLWLYRGHVWH(GLWDOHVHXV$QH[RVR3UHJRHLURFRQVLGHUDUiRSURSRQHQWHLQDELOLWDGR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
41 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
3RGHUiR3UHJRHLURGHFODUDUTXDOTXHUIDWRIRUPDOGHVGHTXHQmRLPSOLTXHGHVREHGLrQFLDj
OHJLVODomR H IRU HYLGHQWH D YDQWDJHP SDUD D $GPLQLVWUDomR GHYHQGR WDPEpP VH QHFHVViULR
SURPRYHUGLOLJrQFLDSDUDGLULPLUDG~YLGD
&RQVWDWDQGR DWUDYpV GD GLOLJrQFLD R QmR DWHQGLPHQWR DR HVWDEHOHFLGR R 3UHJRHLUR
FRQVLGHUDUiRSURSRQHQWHLQDELOLWDGR
7RGDV DV HPSUHVDV TXH HQVHMDU GHFODUDomR IDOVD RX TXH GHOD WHQKD FRQKHFLPHQWR QRV
WHUPRVGRDUWLJRGR&yGLJR3HQDOILFDUiVXMHLWRjVSHQDVGHUHFOXVmRGHXPDFLQFRDQRVVH
R GRFXPHQWR p S~EOLFR H UHFOXVmR GH XP D WUrV DQRV H PXOWD VH R GRFXPHQWR p SDUWLFXODU
LQGHSHQGHQWHGDSHQDOLGDGHHVWDEHOHFLGDQRDUWLJRžGD/HL)HGHUDOQž
±'26,67(0$'(5(*,6752'(35(d26
2 6LVWHPD GH 5HJLVWUR GH 3UHoRV UHJXODVH SHODV QRUPDV H SURFHGLPHQWRV SUHYLVWRV QR
'HFUHWR0XQLFLSDOQž
1RkPELWRGR6LVWHPDGH5HJLVWURGH3UHoRVDDGMXGLFDomRVLJQLILFDWmRVRPHQWHRUHJLVWUR
GRVSUHoRVRIHUWDGRVVHQGRTXHSDUDDSUHVHQWHFRQWUDWDomRVHUiUHGLJLGDDPLQXWDGRFRQWUDWRH
SRVWRRYDORUUHJLVWUDGRHPDWD
$H[LVWrQFLDGR5HJLVWURQmRREULJDD$GPLQLVWUDomRDHIHWLYDUDVFRQWUDWDo}HVSRUHVVHPHLR
ILFDQGROKH IDFXOWDGD D DTXLVLomR SRU RXWUDV PRGDOLGDGHV UHVSHLWDGD D OHJLVODomR UHODWLYD jV
OLFLWDo}HV VHQGR DVVHJXUDGR j GHWHQWRUD GD $WD R GLUHLWR GH SUHIHUrQFLD HP LJXDOGDGH GH
FRQGLo}HV
8PDYH]UHJLVWUDGRVRVSUHoRVD$GPLQLVWUDomRSRGHUiFRQYRFDUDGHWHQWRUDGR5HJLVWUR
D IRUQHFHU RV UHVSHFWLYRV PDWHULDLV H H[HFXWDU RV VHUYLoRV QD IRUPD H FRQGLo}HV IL[DGDV QR
SUHVHQWH(GLWDOHQD$WDGH5HJLVWURGH3UHoRV
'$,038*1$d­2'2$72&2192&$7Ï5,2
$WpGRLVGLDV~WHLVDQWHVGDGDWDIL[DGDSDUDUHFHELPHQWRGDVSURSRVWDVTXDOTXHUSHVVRD
SRGHUiVROLFLWDUHVFODUHFLPHQWRVSURYLGrQFLDVRXLPSXJQDURSUHVHQWHHGLWDO
&DEHUiDRSUHJRHLURGHFLGLUVREUHDSHWLomRQRSUD]RGHYLQWHHTXDWURKRUDV
$FROKLGDjSHWLomRFRQWUDRDWRFRQYRFDWyULRVHUiGHVLJQDGDQRYDGDWDSDUDDUHDOL]DomRGR
FHUWDPH
$ RFRUUrQFLD GH LPSXJQDomR GH FDUiWHU PHUDPHQWH SURWHODWyULR HQVHMDQGR DVVLP R
UHWDUGDPHQWR GD H[HFXomR GR FHUWDPH D DXWRULGDGH FRPSHWHQWH SRGHUi DVVHJXUDGR R
FRQWUDGLWyULR H DPSOD GHIHVD DSOLFDU D SHQD HVWDEHOHFLGD QR DUWLJR ž GD /HL Qž H
OHJLVODomRYLJHQWH
4XHP LPSHGLU SHUWXUEDU RX IUDXGDU DVVHJXUDGR R FRQWUDGLWyULR H D DPSOD GHIHVD D
UHDOL]DomRGHTXDOTXHUDWRGRSURFHGLPHQWROLFLWDWyULRLQFRUUHUiHPSHQDGHGHWHQomRGHGRLV
DWUrVDQRVHPXOWDQRVWHUPRVGRDUWLJRGD/HL
'265(&85626
$UWLJRR;9,,,;,;;;H;;,GD/HLQR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
42 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
'HFODUDGR R YHQFHGRU TXDOTXHU OLFLWDQWH SRGHUi PDQLIHVWDU PRWLYDGDPHQWH D LQWHQomR GH
UHFRUUHU TXDQGR OKH VHUi FRQFHGLGR R SUD]R GH WUrV GLDV SDUD DSUHVHQWDomR GDV UD]}HV GR
UHFXUVRILFDQGRRVGHPDLVOLFLWDQWHVGHVGHORJRLQWLPDGRVSDUDDSUHVHQWDUFRQWUDUD]}HVHPLJXDO
Q~PHUR GH GLDV TXH FRPHoDUmR D FRUUHU GR WpUPLQR GR SUD]R GR UHFRUUHQWH VHQGROKHV
DVVHJXUDGDYLVWDLPHGLDWDGRVDXWRV
$IDOWDGHPDQLIHVWDomRLPHGLDWDHPRWLYDGDGROLFLWDQWHLPSRUWDUiDGHFDGrQFLDGRGLUHLWRGH
UHFXUVRHDDGMXGLFDomRGRREMHWRGDOLFLWDomRSHORSUHJRHLURDRYHQFHGRU
2UHFXUVRFRQWUDGHFLVmRGR3UHJRHLURQmRWHUiHIHLWRVXVSHQVLYR
2 DFROKLPHQWR GH UHFXUVR LPSRUWDUi D LQYDOLGDomR DSHQDV GRV DWRV LQVXVFHWtYHLV GH
DSURYHLWDPHQWR
'HFLGLGRRVUHFXUVRVDDXWRULGDGHFRPSHWHQWHIDUiDDGMXGLFDomRGRREMHWRGDOLFLWDomRDR
OLFLWDQWHYHQFHGRU
2VDXWRVGRSURFHGLPHQWRSHUPDQHFHUmRFRPYLVWDIUDQTXHDGDDRVLQWHUHVVDGRVQR6HWRU
GH /LFLWDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD VLWXDGD D 7UDYHVVD *HQHUDO /DEDWXW 61 ±
&HQWUR9DOHQoD%DKLD
1D RFRUUrQFLD GH PDQLIHVWDomR RX LQWHUSRVLomR GH UHFXUVR GH FDUiWHU PHUDPHQWH
SURWHODWyULRHQVHMDQGRDVVLPRUHWDUGDPHQWRGDH[HFXomRGRFHUWDPHDDXWRULGDGHFRPSHWHQWH
SRGHUiDVVHJXUDGRRFRQWUDGLWyULRHDDPSODGHIHVDDSOLFDUDSHQDHVWDEHOHFLGDQRDUWLJRžGD
/HLQžHOHJLVODomRYLJHQWH
±'$$7$'(5(*,6752'(35(d26
± (QFHUUDGR R SURFHVVR OLFLWDWyULR SDUD 5HJLVWUR GH 3UHoRV D $GPLQLVWUDomR UHVSHLWDGD D
RUGHP FRQYRFDUi D DGMXGLFDWiULD H DV LQWHUHVVDGDV UHPDQHVFHQWHV GHVGH TXH HVWDV WHQKDP R
LQWHUHVVHHPDVVLQiODSHORSUHoRREWLGRSUD]RGHHQWUHJDHGHPDLVFRQGLo}HVGHIRUQHFLPHQWR
GD SULPHLUD FRORFDGD SDUD GHQWUR GR SUD]R GH FLQFR GLDV ~WHLV D FRQWDU GD GDWD GH
UHFHELPHQWRGDQRWLILFDomRDVVLQDUHPD$WDGH5HJLVWURGH3UHoRVFXMDPLQXWDLQWHJUDHVWHHGLWDO
$QH[R 9,,, H TXH DSyV SXEOLFDGD WHUi HIHLWR GH FRPSURPLVVR GH IRUQHFLPHQWR QDV FRQGLo}HV
HVWDEHOHFLGDVQRSUHVHQWHGRFXPHQWRHGLWDOtFLR
±4XDQGRDDGMXGLFDWiULDHDVGHPDLVLQWHUHVVDGDVDRVHUHPFRQYRFDGDVQmRDVVLQDUHPD
$WD GH 5HJLVWUR GH 3UHoRV QR SUD]R H FRQGLo}HV HVWDEHOHFLGRV VHUi IDFXOWDGR j $GPLQLVWUDomR
VHP SUHMXt]R GH VH DSOLFDU D VDQomR SUHYLVWD QHVWH HGLWDO FRQYRFDU DV OLFLWDQWHV VHJXLQWHV QD
RUGHPGHFODVVLILFDomRSDUDID]HOR
±)RUPDOL]DGDD$WDGH5HJLVWURGH3UHoRVGXUDQWHVXDYLJrQFLDDHPSUHVDGHWHQWRUDHVWDUi
REULJDGDDRVHXFXPSULPHQWREHPFRPRDRGHWRGDVDVGHPDLVFRQGLo}HVHVWDEHOHFLGDVQHVWH
HGLWDOVHPSUHMXt]RGHVHUHPDSOLFDGDVDVVDQo}HVFDEtYHLVFRQVWDQWHVGHVWHHGLWDO
±'235$=2'(9$/,'$'('$$7$
$$WDGH5HJLVWURGH3UHoRVWHUiYDOLGDGHGHXPDQRFRQWDGRDSDUWLUGDGDWDGHVXD
DVVLQDWXUDSRGHQGRVHUSURUURJDGRDFULWpULRGD$GPLQLVWUDomR
±'2)251(&,0(172((;(&8d­2
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
43 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
±2IRUQHFLPHQWRGRPDWHULDOHRXDH[HFXomRGRVHUYLoRVHUiHIHWXDGRDSyVDDVVLQDWXUDGR
FRQWUDWR PHGLDQWH HQFDPLQKDPHQWR SHOD 6HFUHWDULD FRPSHWHQWH GH 1RWD GH (PSHQKR TXH
FRUUHVSRQGH j DXWRUL]DomR GH HQWUHJD HRX H[HFXomR GHYHQGR QHOD FRQVWDU HVSHFLILFDo}HV GR
PDWHULDOHRXVHUYLoRTXDQWLWDWLYRSUD]RORFDOGHHQWUHJDHSUHoRVXQLWiULRHWRWDO
±'XUDQWHDYLJrQFLDGD$WDGH5HJLVWURGH3UHoRVVXDGHWHQWRUDILFDREULJDGDDIRUQHFHUR
PDWHULDOHRXH[HFXWDURVHUYLoRGHDFRUGRFRPRSUHoRUHJLVWUDGRQDVTXDQWLGDGHVLQGLFDGDVHP
FDGD1RWDGH(PSHQKR
± 2 0XQLFtSLR GH 9DOHQoD%$ QmR HVWi REULJDGR D DGTXLULU TXDOTXHU TXDQWLGDGH GR REMHWR
OLFLWDGR H LJXDOPHQWH D VROLFLWDU TXDOTXHU GRV VHUYLoRV ILFDQGR D VHX H[FOXVLYR FULWpULR GHILQLU D
TXDQWLGDGHHRPRPHQWRGDDTXLVLomRHH[HFXomRGDTXHOHVGHDFRUGRFRPDVQHFHVVLGDGHVGD
$GPLQLVWUDomR
±$GHWHQWRUDQmRSRGHUiVHPPRWLYRMXVWRGHYLGDPHQWHFRPSURYDGRHLQIRUPDGRUHFXVDU
VHDIRUQHFHURVPDWHULDLVHRXH[HFXWDURVVHUYLoRVVROLFLWDGRVSHOR0XQLFtSLRGH9DOHQoD%$
±2VPDWHULDOLVSURGXWRVVHUimRGHYROYLGRVRXVHUYLoRVVHUmRUHFXVDGRVQDKLSyWHVH
GHDSUHVHQWDULUUHJXODULGDGHVQmRFRUUHVSRQGHUjVHVSHFLILFDo}HVGD$WDGH5HJLVWURGH3UHoRV
RX HVWDU IRUD GRV SDGU}HV GHWHUPLQDGRV GHYHQGR VHU VXEVWLWXtGRV SHOD HPSUHVD GHWHQWRUD GD
$WDQRSUD]RPi[LPRGHTXDUHQWDHRLWRKRUDVDFRQWDUGDQRWLILFDomRVRESHQDGHDSOLFDomR
GDVSHQDOLGDGHVSUHYLVWDVQHVWHHGLWDO
±'235$=2(/2&$/3$5$(175(*$((;(&8d­2'266(59,d26
2V SURGXWRVVHUYLoRV VHUmR HQWUHJXHVH[HFXWDGRV GH XPD Vy YH] RX SDUFHODGDPHQWH
FRQIRUPH 2UGHP GH )RUQHFLPHQWR6HUYLoR QR SUD]R QmR VXSHULRU D GH] GLDV FRQWDGRV GD
GDWDGHUHFHELPHQWRGD6ROLFLWDomRGH)RUQHFLPHQWRHRX([HFXomR
2IDWXUDPHQWRGHYHUiVHUHPLWLGRSDUD
35()(,785$ 081,&,3$/ '( 9$/(1d$ LQVFULWD QR &13- VRE R Qž FRP
VHGHD7UDYHVVD*HQHUDO/DEDWXWVQžFHQWUR9DOHQoD%DKLDH
±'25(&(%,0(172'22%-(72
±&DVRSRUTXDOTXHUUD]mRQmRSRVVDVHUSURFHVVDGRRUHFHELPHQWRGHILQLWLYRQRPRPHQWR
GD HQWUHJD R REMHWR OLFLWDGR VHUi UHFHELGR SURYLVRULDPHQWH FRP HIHLWR LPHGLDWR SDUD SRVWHULRU
YHULILFDomR GH VXD FRQIRUPLGDGH FRP DV HVSHFLILFDo}HV FRQVWDQWHV QD 1RWD GH (PSHQKR H
UHVSHFWLYRGRFXPHQWRILVFDO
± 2 DFHLWHDSURYDomR GRV PDWHULDOLV H VHUYLoRV SHOR yUJmR OLFLWDQWH QmR H[FOXL D
UHVSRQVDELOLGDGHFLYLOGRVIRUQHFHGRUHVSRUYtFLRVGHTXDQWLGDGHRXTXDOLGDGHGRVPDWHULDOLV
H VHUYLoRV YHULILFDGDV SRVWHULRUPHQWH JDUDQWLQGRVH DR yUJmR OLFLWDQWH DV IDFXOGDGHV SUHYLVWDV
QRDUWGD/HLQž
&RPRFRQGLomRSDUDHPLVVmRGD³1RWDGH(PSHQKR´ROLFLWDQWHYHQFHGRUGHYHUiHVWDUFRP
D GRFXPHQWDomR REULJDWyULD YiOLGD SHUDQWH D )D]HQGD (VWDGXDO H DLQGD SHUDQWH D )D]HQGD
)HGHUDOD6HJXULGDGH6RFLDO,166HDR)XQGRGH*DUDQWLDSRU7HPSRGH6HUYLoR)*76
6H DV FHUWLG}HV UHIHULGDV QD IDVH GH KDELOLWDomR QmR FRPSURYDUHP D VLWXDomR UHJXODU GD
HPSUHVD DGMXGLFDWiULD D VHVVmR VHUi UHWRPDGD H RV GHPDLV OLFLWDQWHV FKDPDGRV QD RUGHP GH
FODVVLILFDomR SDUD ID]rOR QDV PHVPDV FRQGLo}HV GD SULPHLUD FRORFDGD REVHUYDGR TXH R
SUHJRHLUR H[DPLQDUi D DFHLWDELOLGDGH TXDQWR DR REMHWR VHP SUHMXt]R GD DSOLFDomR GDV VDQo}HV
FDEtYHLV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
44 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
$FRQWUDWDQWHILFDUiREULJDGDDDFHLWDUQDVPHVPDVFRQGLo}HVGHVWHHGLWDORVDFUpVFLPRV
RX VXSUHVV}HV TXH VH IL]HUHP QHFHVViULRV DWp YLQWH H FLQFR SRU FHQWR GR YDORU LQLFLDO
DWXDOL]DGRGRREMHWRDGMXGLFDGRGHYHQGRVXSUHVV}HVDFLPDGHVVHOLPLWHVHUUHVXOWDQWHGHDFRUGR
HQWUHDVSDUWHV
6HDOLFLWDQWHYHQFHGRUDQmRFXPSULURSUD]RHVWLSXODGRQHVWHHGLWDORXUHFXVDUVHDUHWLUDUD
³1RWD GH (PSHQKR´ VHP MXVWLILFDWLYD IRUPDOPHQWH DFHLWD SHOR 3UHIHLWR 0XQLFLSDO GH 9DOHQoD
GHFDLUi GR GLUHLWR GH IRUQHFHU RV REMHWRV DGMXGLFDGRV VXMHLWDQGRVH jV SHQDOLGDGHV GLVSRVWDV
QHVWH(GLWDOGH3UHJmR
$3UHIHLWXUD0XQLFLSDOGH9DOHQoDQRVWHUPRVSUHYLVWRVQHVWHHGLWDOGHYHUi
5HFHEHURVSURGXWRVHDFHLWDUDH[HFXomRGRVVHUYLoRVDGMXGLFDGRVQRVWHUPRVSUD]RV
TXDQWLGDGHTXDOLGDGHHFRQGLo}HVHVWDEHOHFLGDVQHVWHHGLWDO
2VSURGXWRVVHUYLoRVVHUmRUHFXVDGRVHGHYROYLGRVQDVVHJXLQWHVKLSyWHVHV
D 1RWD ILVFDO FRP HVSHFLILFDomR H TXDQWLGDGHV HP GHVDFRUGR FRP R GLVFULPLQDGR QD QRWD GH
HPSUHQKR
E(QWUHJXHVHPGHVDFRUGRFRPDVHVSHFLILFDo}HVGRVUHTXLVLWRVREULJDWyULRVGHVWHHGLWDO
F$SUHVHQWHPYtFLRVGHTXDOLGDGHRXLPSURSULHGDGHSDUDRXVR
2UHFHELPHQWRSURYLVyULRGRSURGXWRVHUYLoRDGMXGLFDGRQmRLPSOLFDVXDDFHLWDomR
2 UHFHELPHQWR GHILQLWLYR GDUVHi SHOR 6HUYLGRU QRPHDGR SHOD 3UHIHLWXUD SDUD
UHFHELPHQWR GRV SURGXWRV DSyV DYHULILFDomRGR FXPSULPHQWR GDVHVSHFLILFDo}HV GRV SURGXWRV
QRV WHUPRV GHVWH (GLWDO H VHXV DQH[RV H GD SURSRVWD DGMXGLFDWiULD QR SUD]R GH GRLV GLDV
~WHLVFRQWDGRVGRUHFHELPHQWRSURYLVyULR
(IHWXDU R SDJDPHQWR DSyV R UHFHELPHQWR GHILQLWLYR GRV SURGXWRV HRX H[HFXomR GRV
VHUYLoRVPHGLDQWHGHSyVLWREDQFiULRFKHTXHUHFLERRXHPPRHGDFRUUHQWHDWpRƒWULJpVLPR
GLD FRQWDGR D SDUWLU GR UHFHELPHQWR GD )DWXUD1RWD )LVFDO FRPXP H HOHWU{QLFD H GHYLGDPHQWH
DWHVWDGRSHOR6HWRUFRPSHWHQWHGD6HFUHWDULD0XQLFLSDO
'$66$1d®(6$'0,1,675$7,9$6
$UWLJRžGD/HLQR
H$UWLJRVHGD/HLQž
2GHVFXPSULPHQWRLQMXVWLILFDGRGDVREULJDo}HVDVVXPLGDVQRVWHUPRVGHVWHHGLWDOVXMHLWDD
OLFLWDQWHRXDFRQWUDWDGDDPXOWDVFRQVRDQWHRcaput H††GRDUWGD/HLQƒLQFLGHQWHV
VREUHRYDORUGD1RWDGH(PSHQKRQDIRUPDVHJXLQWH
6HPSUHMXt]RGDVVDQo}HVFRPLQDGDVQRDUW,,,,H,9GD/HLSHODLQH[HFXomR
WRWDORXSDUFLDOGRREMHWRDGMXGLFDGRD3UHIHLWXUD0XQLFLSDOGH9DOHQoDSRGHUiJDUDQWLGDSUpYLDH
DPSODGHIHVDDSOLFDUjFRQWUDWDGDPXOWDGHDWpGH]SRUFHQWRVREUHRYDORUDGMXGLFDGR
6H D DGMXGLFDWiULD UHFXVDUVH D UHWLUDU D QRWD GH HPSHQKR LQMXVWLILFDGDPHQWH RX VH QmR
DSUHVHQWDU VLWXDomR UHJXODU QR DWR GD IHLWXUD GD PHVPD JDUDQWLGD D SUpYLD H DPSOD GHIHVD
VXMHLWDVHjVVHJXLQWHVSHQDOLGDGHV
PXOWDGHDWpVREUHRYDORUFRQWUDWDGR
VXVSHQVmR WHPSRUiULD GH SDUWLFLSDU GH OLFLWDo}HV H LPSHGLPHQWR GH FRQWUDWDU FRP D
35()(,785$081,&,3$/'(9$/(1d$SRUSUD]RGHDWpGRLVDQRVH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
45 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
GHFODUDomRGHLQLGRQHLGDGHSDUDOLFLWDURXFRQWUDWDUFRPDDGPLQLVWUDomRS~EOLFD
$OLFLWDQWHDGMXGLFDWiULDRXFRQWUDWDGDTXHGHL[DUGHHQWUHJDURXDSUHVHQWDUGRFXPHQWDomR
IDOVDH[LJLGDSDUDRFHUWDPHHQVHMDURUHWDUGDPHQWRGDH[HFXomRGHVHXREMHWRQmRPDQWLYHUD
SURSRVWDIDOKDURXIUDXGDUQDH[HFXomRGRFRQWUDWRFRPSRUWDUVHGHPRGRLQLG{QHRRXFRPHWHU
IUDXGH ILVFDO JDUDQWLGD D SUpYLD H DPSOD GHIHVD ILFDUi LPSHGLGD GH OLFLWDU H FRQWUDWDU FRP R
0XQLFtSLRSHORSUD]RGHDWpFLQFRDQRVHVHPSUHMXt]RGDDomRSHQDOFRUUHVSRQGHQWHQDIRUPD
GDOHL
$PXOWDHYHQWXDOPHQWHLPSRVWDjFRQWUDWDGDVHUiDXWRPDWLFDPHQWHGHVFRQWDGDGDIDWXUDD
TXHIL]HUMXVDFUHVFLGDGHMXURVPRUDWyULRVGHXPSRUFHQWRDRPrV&DVRDFRQWUDWDGDQmR
WHQKD QHQKXP YDORU D UHFHEHU GHVWD 3UHIHLWXUD VHUOKHi FRQFHGLGR R SUD]R GH FLQFR GLDV
~WHLV FRQWDGRV GH VXD XOWLPD LQWLPDomR SDUD HIHWXDU R SDJDPHQWR GD PXOWD $SyV HVVH SUD]R
QmR VHQGR HIHWXDGR R SDJDPHQWR VHXV GDGRV VHUmR HQFDPLQKDGRV DR yUJmR FRPSHWHQWH SDUD
TXHVHMDLQVFULWDQD'LYLGD$WLYDGR0XQLFtSLRSRGHQGRDLQGDD3UHIHLWXUDSURFHGHUDFREUDQoD
MXGLFLDOGDPXOWD
$VPXOWDVSUHYLVWDVQHVWDVHomRQmRH[LPHPDOLFLWDQWHHRXDGMXGLFDWiULDGDUHSDUDomRGRV
HYHQWXDLVGDQRVSHUGDVRXSUHMXt]RVTXHVHXDWRSXQtYHOYHQKDFDXVDUDRyUJmR
6RPHQWH VHUi FRQFHGLGD SURUURJDomR GR SUD]R SDUD R IRUQHFLPHQWR GR REMHWR QR WRGR RX
HP SDUWH FDVR D HPSUHVD HIHWLYDPHQWH GHPRQVWUH H FRPSURYH HP SHGLGR IXQGDPHQWDGR IDWR
VXSHUYHQLHQWH LPSUHYLVtYHO RX GH GLItFLO SUHYLVmR LPSHGLWLYR GD HQWUHJD QR SUD]R HVWLSXODGR QD
SURSRVWD
'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±)XQGR0XQLFLSDOGH(GXFDomR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± )XQFLRQDPHQWR GD 5HGH GH (GXFDomR %iVLFD ± (QVLQR GH -RYHQV H
$GXOWRV
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD,QIUDHVWUXWXUDH8UEDQLVPR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR'HVHQYROYLPHQWRH3ODQHMDPHQWR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD,QG~VWULD&RPpUFLRH6HUYLoR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
46 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH6D~GH
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD$GPLQLVWUDomR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR0HLR$PELHQWH
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULDGD)D]HQGD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULDGD&XOWXUD(VSRUWHH/D]HU
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR'HSDUWDPHQWRGH
&XOWXUD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH$VVLVWrQFLD6RFLDO
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGR)XQGR
2EMHWR$WLYLGDGH±6HUYLoRVGH3URWHomR6RFLDO%iVLFDj)DPtOLD
2EMHWR$WLYLGDGH ± 6HUYLoRV GH 3URWHomR H $WHQGLPHQWR (VSHFLDOL]DGR D )DPtOLDV H
,QGLYtGXRVFRP'LUHLWRV9LRODGRV
2EMHWR$WLYLGDGH±6HUYLoR6RFLRHGXFDWLYRHGH&RQYLYrQFLDSDUD(UUDGLFDomRGR7UDEDOKR
,QIDQWLO
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR%ROVD)DPtOLD
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR68$6
)RQWH
8QLGDGH±*DELQHWHGD3UHIHLWD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGR*DELQHWH
)RQWH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
47 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
8QLGDGH±6HFUHWDULD0XQLFLSDOGR7XULVPR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD(VSHFLDOGD3HVFD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGD6HFUHWDULD
)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
'$6',6326,d®(6*(5$,6
$UW†žH$UWLJR†RGD/HL
eIDFXOWDGDDR3UHJRHLURRX$XWRULGDGH6XSHULRUHPTXDOTXHUIDVHGDOLFLWDomRDSURPRomR
GHGLOLJrQFLDGHVWLQDGDDHVFODUHFHURXFRPSOHPHQWDUDLQVWUXomRGRSURFHVVRYHGDGDDLQFOXVmR
SRVWHULRUGHGRFXPHQWRRXLQIRUPDomRTXHGHYHULDFRQVWDUQRDWRGDVHVVmRS~EOLFD
$ DXWRULGDGH FRPSHWHQWH SDUD GHWHUPLQDU D FRQWUDWDomR SRGHUi UHYRJDU D OLFLWDomR SRU
UD]}HVGHLQWHUHVVHS~EOLFRGHULYDGRGHIDWRVXSHUYHQLHQWHGHYLGDPHQWHFRPSURYDGRSHUWLQHQWHH
VXILFLHQWHSDUDMXVWLILFDUWDOFRQGXWDGHYHQGRDQXOiODSRULOHJDOLGDGHGHRItFLRRXSRUSURYRFDomR
GHTXDOTXHUSHVVRDPHGLDQWHDWRHVFULWRHIXQGDPHQWDGR
$DQXODomRGRSURFHGLPHQWRLQGX]jGRFRQWUDWRRXQRWDGHHPSHQKR
2VOLFLWDQWHVQmRWHUmRGLUHLWRjLQGHQL]DomRHPGHFRUUrQFLDGDDQXODomRGRSURFHGLPHQWR
OLFLWDWyULRUHVVDOYDGRRGLUHLWRGRFRQWUDWDGRGHERDIpGHVHUUHVVDUFLGRSHORVHQFDUJRVTXHWLYHU
VXSRUWDGRQRFXPSULPHQWRGRFRQWUDWR
2VSURSRQHQWHVDVVXPHPWRGRVRVFXVWRVGHSUHSDUDomRHDSUHVHQWDomRGHVXDSURSRVWDH
D 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD QmR VHUi HP QHQKXP FDVR UHVSRQViYHO SRU HVVHV FXVWRV
LQGHSHQGHQWHPHQWHGDFRQGXomRRXGRUHVXOWDGRGRSURFHVVROLFLWDWyULR
2V SURSRQHQWHV VmR UHVSRQViYHLV SHOD ILGHOLGDGH H OHJLWLPLGDGH GDV LQIRUPDo}HV H GRV
GRFXPHQWRVDSUHVHQWDGRVHPTXDOTXHUIDVHGDOLFLWDomR
1mRKDYHQGRH[SHGLHQWHRXRFRUUHQGRTXDOTXHUIDWRVXSHUYHQLHQWHTXHLPSHoDDUHDOL]DomR
GR FHUWDPH QD GDWD PDUFDGD D VHVVmR VHUi UHGHVLJQDGD SDUD R GLD KRUD H ORFDO GHILQLGR H
QRYDPHQWHSXEOLFDGDQD,PSUHQVD2ILFLDO
1D FRQWDJHP GRV SUD]RV HVWDEHOHFLGRV QHVWH (GLWDO H VHXV $QH[RV H[FOXLUVHi R GLD GR
LQtFLR H LQFOXLUVHi R GR YHQFLPHQWR 6y VH LQLFLDP H YHQFHP RV SUD]RV HP GLDV GH H[SHGLHQWH
QRUPDOQD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
2 GHVDWHQGLPHQWR GH H[LJrQFLDV IRUPDLVQmR HVVHQFLDLV QmRLPSRUWDUi QR DIDVWDPHQWR GR
OLFLWDQWH GHVGH TXH VHMDP SRVVtYHLV DV DIHULo}HV GDV VXDV TXDOLILFDo}HV H DV H[DWDV
FRPSUHHQV}HVGDVXDSURSRVWDGXUDQWHDUHDOL]DomRGDVHVVmRS~EOLFDGR35(*­2
$VQRUPDVTXHGLVFLSOLQDPHVWHSUHJmRVHUmRVHPSUHLQWHUSUHWDGDVHPIDYRUGDDPSOLDomR
GDGLVSXWDHQWUHRVLQWHUHVVDGRVVHPFRPSURPHWLPHQWRGDVHJXUDQoDGRIXWXURFRQWUDWR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
48 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
4XDOTXHU SHGLGR GH HVFODUHFLPHQWR HP UHODomR D HYHQWXDLV G~YLGDV QD LQWHUSUHWDomR GR
SUHVHQWH (GLWDO H VHXV $QH[RV GHYHUi VHU HQFDPLQKDGR SRU HVFULWR DR 3UHJRHLUR D 3UHIHLWXUD
0XQLFLSDO GH 9DOHQoD VLWXDGD D 7UDYHVVD *HQHUDO /DEDWXW VQ &HQWUR ± 9DOHQoD%DKLD GDV
jVKDWpGRLVGLDV~WHLVDQWHVGDGDWDGHDEHUWXUDGR35(*­2
$KRPRORJDomRGRUHVXOWDGRGHVWDOLFLWDomRQmRLPSOLFDUiGLUHLWRjFRQWUDWDomR
$RVFDVRVRPLVVRVDSOLFDPVHDVGLVSRVLo}HVFRQVWDQWHVGD/HLH
'HFUHWRV0XQLFLSDLVQžH
6mRSDUWHVLQWHJUDQWHVLQGLVVRFLiYHLVHDWUHODGDVDRFRQWH~GRGHVWH(GLWDORVDQH[RVDWD
GHUHJLVWURGHSUHoRVFXMRWHRUYLQFXODWRWDOPHQWHRVOLFLWDQWHV
$1(;2,±(VSHFLILFDo}HVGRVSURGXWRVHRXPDWHULDLV
$1(;2,,±0RGHORGH3URSRVWDGH3UHoRV
$1(;2,,,±0RGHORGH&DUWDGH&UHGHQFLDPHQWR
$1(;2 ,9 ± 0RGHOR GH GHFODUDomR GH IDWRV VXSHUYHQLHQWH TXH QmR HPSUHJD PHQRUHV GH DQRVHPWUDEDOKRQRWXUQRVHQmRSRVVXLHPTXDGURGHSHVVRDOVHUYLGRUS~EOLFRH[HUFHQGRIXQomR
WpFQLFDFRPHUFLDLVGHJHUrQFLDDGPLQLVWUDomRRXWRPDGDGHGHFLVmRLQFLVR,,,GRDUWžGD/HL
$1(;2 9 ± 0RGHOR GH GHFODUDomR GDQGR FLrQFLD GH TXH FXPSUHP RV UHTXLVLWRV SDUD D
KDELOLWDomR
$1(;29,±0RGHORGHDWHVWDGRGHFDSDFLGDGHWpFQLFD
$1(;29,,±0RGHORGH'HFODUDomRGH0LFUR(PSUHVDH(PSUHVDGH3HTXHQR3RUWH
$1(;29,,,±0LQXWDGD$WDGH5HJLVWURGH3UHoRV
$1(;2,;0RGHORGH0LQXWDGH&RQWUDWRSDUD)RUQHFLPHQWR([HFXomR
9DOHQoD%$GHMXOKRGH
0,&+(/$3$5(&,'23,172
$SURYDGR
$66(6625,$-85Ë',&$
3UHJRHLUR
3RUWDULDQžGH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
49 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
Lote:
Item
1
Código
1
137328
2
13673
3
139574
4
139251
$1(;2,
7(502'(5()(5Ç1&,$
MATERIALPERMANENTEDETELEFONIA
DescriçãoDetalhada
APARELHO DE FAX COM TELEFONE NA COR PRETA
APARELHO DE FAX KXFT 932 NA COR PRETA A PAPEL
TÉRMICOCOMINDENTIFICADORDECHAMADAS110
APARELHO,telefonico,comfio,paramesaouparede,
conectorespadraoAmericanoeouTelebras,teclasde
Mute,Pause,RadialeFlashminimode250ms,modo
dediscagemTomePulso,memoriadoultimonumero
chamado,campainhaeletronicacomnominimode02
niveis de volume, peso do aparelho de 400 a 700 g,
GarantiadoFabricantedenominimo01ano.
APARELHO,telefonico,semfio,frequenciade mínima
de2.4GHzdelongoalcance:basecomumaparelhoe
mais uma extensao com base compacta,
intercomunicacao e transferencia de chamada entre
fones,teclaselecionavelLiga/Desliga,Identificadorde
chamadas DTMF, sons/volumes polifonicos, sistema
Vivavoz, agenda para numeros no minimo 30
memorias de discagem rapida, 40 de canais de busca
automatica, funcao Hold, Mute, Redial, Flash, Page,
minimo de 65 mil cod. de seguranca. Sistema anti
ruidosDiscagemtom/pulso,tecnologiadeRealcede
Voz, Registro de chamadas atendidas/nao atendidas,
tempo min. da bateria 2 X AAA NiMH 650 mAh em
espera 120 horas Tempo minimo da bateria em
conversacao 4 horas, Garantia do Fabricante minima
de 06 meses. O manual em idioma em portugues,
Tensao bivolt(110e220 volts), assistencia tecnica
prestada no Estado da Bahia, Rotulagem contendo,
nome do produto, marca do fabricante, frequencia e
tensaonominal.
CENTRAL TELEFÔNICA, COM TERMINAL INTELIGENTE,
CONFIGURAÇÃO MÍNIMA: 02 TRONCOS ANALÓGICOS
E 04 RAMAIS (ANALÓGICOS E/OU DIGITAIS);
CONFIGURAÇÃOMÁXIMA:04TRONCOSANALÓGICOS,
12 RAMAIS; (ANALÓGICOS E/OU DIGITAIS)³ E ATÉ 02
ACESSÓRIOSOPCIONAIS(01PLACAVOIP²,ETHERNET²,
CORREIO DE VOZ¹², PLACA DE COMUNICAÇÃO¹² OU
MODEM¹²).¹CONSULTE DISPONIBILIDADE COM NOSSO
CANAL COMERCIAL, ²OPCIONAL; ³NO MÁXIMO 08
RAMAISDIGITAIS.
Unidade
Qtde
UND
2
UND
80
UND
36
UND
3
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
50 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
5
6
7
Lote:
Item
CENTRAL TELEFÔNICA, COM TERMINAL INTELIGENTE,
CONFIGURADA VIA REDE¹ OU VIA SERIAL;
CONFIGURAÇÃO MÍNIMA: 02 TRONCOS ANALÓGICOS
E 04 RAMAIS (ANALÓGICOS E/OU DIGITAIS);
CONFIGURAÇÃO MÁXIMA: PRIMEIRA OPÇÃO 30
TRONCOS DIGITAIS, 06 TRONCOS ANALÓGICOS, 32
RAMAIS (24 ANALÓGICOS E 08 DIGITAIS) E ATÉ 03
ACESSÓRIOSOPCIONAIS(01PLACAVOIP²,ETHERNET²,
CORREIO DE VOZ¹², PLACA DE COMUNICAÇÃO¹² OU
MODEM¹²). SEGUNDA OPÇÃO 08 TRONCOS
ANALÓGICOS, 32 RAMAIS (24 ANALÓGICOS E 08
DIGITAIS)EATÉ03ACESSÓRIOSOPCIONAIS(01PLACA
VOIP², ETHERNET², CORREIO DE VOZ¹², PLACA DE
139246 COMUNICAÇÃO¹²OUMODEM¹²).
113008 FIOrígidoparatelefone
TELEFONE DIGITAL SEM FIO MULTI RAMAL DIGITAL
VEM EM UMA EMBALAGEM ESPECIAL CONTENDO
TELEFONE + 3 RAMAIS. POSSUI UM DESIGN
AVANÇADO, IDENTIFICADOR DE CHAMADAS, VIVA
VOZ E A TECNOLOGIA MULTI RAMAL DIGITAL (DECT
6.0) QUE POSSIBILITA MELHOR QUALIDADE DE VOZ E
EXPANSÃOPARAATÉ5RAMAIS.GARANTIADE1ANO.
139954 CONTENDOTODOSOSITENSPARAINSTALAÇÃO.
1
2
2
Código
139866
139863
3
13501
4
5
6
139797
138679
139210
7
138692
CABEAMENTOESTRUTURADODEREDE
DescriçãoDetalhada
ADAPTADOR2P+TNBR14136PARAPADRÃOVELHO
ADAPTADORPARATOMADA2P+TNBR14136.
ALICATE, de clipagem com cabo isolado, tamanho 18
cm, para ser utilizado em conectores RJ11 e RJ45.
Embalagem com dados de identificacao do produto e
marcadofabricante.
CABO ENGATE RÁPIDO P/ NOBREAK CONEXÃO PARA
BATERIAEXTERNA.
CABOFLEXÍVELP/TELEFONE2PARESMETRO
CABOFLEXÍVELPARATELEFONE10PARESMETRO
CABOUTPMULTILAN4pCAT5E.CATEGORIA:U/UTP
4 PARES TRANÇADOS COMPOSTOS DE CONDUTORES
SÓLIDOS DE COBRE NU, 24 AWG, ISOLADOS EM
POLIETILENO ESPECIAL. COR PADRÃO: AZUL CLARO.
CAPA EXTERNA: PVC NA OPÇÃO CMX. EMBALAGEM:
CAIXA FASTBOX EM LANCE DA PADRÃO DE 305
METROS. MACARRÇÃO SEQUENCIAL MÉTRICA
DECRESCENTE (3050M), QUE FACILITA A
VISUALIZAÇÃO DA QUANTIDADE RESTANTE NA CAIXA
E NO CÁLCULO DOS LANCES PARA INSTALAÇÃO
DIÂMETRO NOMINAL: 4,8 MM. MASSA LÍQUIDA: 26
KG/KM. NVP (VELOCIDADE NOMINAL DE
UND
M
2
200
UND
5
Unidade
UND
UND
Qtde
70
40
UND
4
UND
M
M
1
530
100
M
15
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
51 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
PROPAGAÇÃO):68%
8
9
10
11
139233
138699
138700
138688
12
13
15800
138684
14
138564
15
139859
16
127042
CAIXACOMTOMADA,LINHAX,RJ11.
CANALETAS30X30
CANALETAS50X50CORBRANCAUNIDADE
CONECTORFÊMEAMULTILANCAT5eBR
CONECTOR, RJ45 macho CAT 5e EIA/TIA, corpo em
termoplastico transparente de alto impacto nao
propagante a chamas com capa azul, 08 contatos em
cobreberiloecamadadeouroem50micros
CONECTORESRJ11,04VIAS.
Estabilizador com potência mínima de 300va; BIVOLT
com saída fixa em 115v; 04 tomadas padrão
NBR14136;LEDnopainelfrontalindicandosituaçãoda
redeelétrica;portafusívelexterno;botãoliga/desliga
embutido; garantia mínima do fabricante de 01 (um)
ano com possibilidade de expansão da mesma sem
custoadicional
FILTRO, DE LINHA, BIVOLT. MÍNIMO DE 6 TOMADAS,
COM REBAIXO E SUPERFÍCIE PROTETORA, COM 2
POLOSETERRA,CONFORMEPADRÃO DANBR14136.
DEVEM PERMITIR A REMOÇÃO E INTRODUÇÃO DOS
PLUGUES,EVITANDOQUESESEPAREMDASTOMADAS
DURANTE UTILIZAÇÃO, MÍNIMO DE1,30M, BOTÃO
LIGA/DESLIGA EMBUTIDO DIRETAMENTE NO FILTRO,
COM INDICAÇÃO LUMINOSA, COM FUSÍVEIS, COM
FILTROS ELETRÔNICOS, 10 A, DE COBRE OU LIGA DE
COBRE, INDICADO PARA INFORMÁTICA. O PRODUTO
DEVERA EXIBIR, DE FORMA NÍTIDA, NOME E MARCA
DO FABRICANTE, A TENSÃO E A CORRENTE MÁXIMA,
CONFORMEPORTARIA27/00DOINMETRO.
FITA, isolante, alta fusao, antichama, cor preta, alta
aderencia, dimensao 19mm x 20m. Embalagem: em
rolo.
UND
UND
UND
UND
70
207
50
100
UND
UND
800
50
UND
30
UND
33
UND
101
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
52 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
17
18
19
20
21
22
23
24
25
FONTE, DE ALIMENTACAO, CHAVEADA, PADRAO
ATX12V (P4) DIMENSOES PADRAO ATX, POTENCIA DE
PICO 500 W, MINIMO DE 6 CONECTORES HD/CD, 2
CONECTORESSATANATIVOE2P/DISQUETE/ZIPSEM
DERIVACAO,ENTRADA110/220V+/10%,TOMADA
AUXILIAR PARA MONITOR. TIPO CHAVEADO; PADRAO ATX12V PARA MICROS PENTIUM 4 E
COMPATIVEIS; SUPORTAR 10 PERIFERICOS SEM
DERIVACAO ( 6 HDS/ CD 2 SATA E 2 DRIVES/ZIP ); 1
CONECTOR PADRAO ATX C 24 PINOS; 1 CONECTOR
+12V DE 4 PINOS PARA PLACASMAE BASEADAS EM
PENTIUM 4; 1 CONECTOR DE FORCA AUXILIAR (P14
COM 6 PINOS) PARA PLACASMAE BASEADAS EM
PENTIUM 4; SUPORTAR POTENCIA DE PICO NAO
INFERIORA500W;SUPORTARPOTENCIACONTINUA
DE NO MINIMO 180W; SUPORTAR CORRENTES DE
NOMINIMODE20AEM3,3V,30AEM5V,15AEM
+12V,0,5AEM5V,0,8AEM12V,2,5AEM5VSB;
PROTECAOELETRONICACONTRACURTOSEMTODAS
AS SAIDAS; VENTILADOR EXAUSTOR TIPO "BALL
BEARING" DIMENSIONADO PARA SUPORTAR A
DISSIPACAO DA POTENCIA MAXIMA FORNECIDA. 139971 TENSAODEENTRADA
GRAMPO ISOLADO COM PREGO DE AÇO
GALVANIZADO PARA FIOS PARALELOS E MANCADOS
128574 1416
138691 GUIADECABO1u19hrzC/TAMPA
MIKROTIK RB/751 RB751 5 PORT 10/100
139791 SWITCH/ROUTERSOHOWITH2.4GHZ802.11N.
NAS NETWOEK STORAGE 1X2 200D DE 4TB, COM 2
139788 DHSDE2TB*COMSAIDARJ45.
139591 PARAFUSOM5X16P/PORCAGAIOLA.
138690 PATCHPANEL24PscCAT5eMULTILAN
138698 PORCAGAIOLA
RÉGUA 8 TOMADAS PADRÃO NBR 14136 1U PARA
138697 RACK
UND
160
CX
UND
4
5
UND
9
UND
UND
UND
UND
4
10
5
10
UND
6
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
53 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
26
139973
27
127461
28
138709
29
138707
SEVIDORDEREDEGABINETE:BAIASEXTERNAS:9DE
5.25" / 1 DE 3.5"BAIAS INTERNAS: 9 DE 5.25"/4 DE
3.5" COM USO DE ADAPTADORES VENTILADOR
INCLUÍDO:1FRONTALDE12CMPORTASFRONTAIS:4
USB/2 MINIJACK 3,5MM (P2) PARA ÁUDIO E
MICROFONESLOTSDEEXPANSÃO:500X432X210MM
COMPATÍVELCOM:PLACASÃEATX/MIDIATX/MICRO
ATX. FONTE: COMPATÍVEL COM PADRÃO ATX12V
V2.31DIMENSÃO5,9"(W)X3.4"(H)X5.5"(L);150M(W)
X86MM (A) X140MM (L)MODULARNÃOPOTÊNCIA
450WATTS80PLUSNÃO APLICÁVELATXCONECTOR
1 EPS CONECTOR 1 PCIE CONNECTOR2 4 PIN
CONNECTOR PERIFÉRICA4 SATA CONECTOR 4 FLOPPY CONNECTOR 2 MTBF100.000 HORAS.
PROCESSADORFREQUÊNCIADETRABALHOEMMODO
NORMALDE3,3GHZEEMMODOTURBODE3,7GHZ
SOQUETE LGA 1155 NÚMERO DE NÚCLEOS04 NÚMERO DE THREADS08 TAMANHO CACHE
L2:4X256KB TAMANHO CACHE L3:8MB (MÍNIMO) VELOCIDADEDOBARRAENTO(BUSSPEED):5GT/SDMI
STE DE INSTRUÇÕES: 64 BIT. PLACA MÃE: ATX DE
ALTA PERFORMANCE, SOQUETE LGA 1155. 04 SLOTS
DDR31600MHZCOMSUPORTE
SWITCH(16PORTAS10/100/1000)BIVOLT,TODASAS
PORTAS SUPORTAM A FUNÇÃO MDI/MDIX,
ELIMINANDO A NECESSIDADE DE CABOS CROSSOVER
OUPORTASDEUPLINK.OSWITCHÉPLUGANDPLAYE
CADAPORTAPODESERUTILIZADACOMOPORTASDE
USOGERALOUPARAUPLINKEPODESERFACILMENTE
CONECTADO A UM SERVIDOR, UM HUB OU SWITCH,
USANDO UM CABO DIRETO OU CROSSOVER. SUPORTA ENDEREÇO MAC AUTOAPRENDIZAGEM E
AUTO ENVELHECIMENTO SUPORTA IEEE 802.3X
CONTROLE DE FLUXO PARA MODO FULL DUPLEX E
CONTRAPRESSÃOPARAOMODOHALFDUPLEXLEDS
INDICADORES PARA MONITORAMENTO DE ENERGIA,
LINK, ATIVIDADE DESIGN CASO DE PLÁSTICO, DE
MESA OU DE PAREDE. FONTE DE ALIMENTAÇÃO
EXTERNAADAPTADOR.
SWITCH 24 PORTAS EMPILHAVEL 10/100/1000 NÃO
GERENCIÁVEL
SWITCH 8 PORTAS 10/100 MBPS COM NEGOCIAÇÃO
DE VELOCIDADE AUTOMÁTICA. FONTE DE
ALIMENTAÇÃO EXTERNA BIVOLT AUTOMÁTICA.
GABINETE COM ADAPTADOR PARA FIXAÇÃO EM
PAREDE. CONECTORES RJ45 METÁLICOS. GUIA DE
INSTALAÇÃOEMPORTUGUÊS.AUTOMDI/MDIXPARA
DETECÇÃO AUTOMÁTICA DO PADRÃO DO CABO
(NORMAL/CROSSOVER). PAINEL FRONTAL COM LEDS
INDICADORES.
UND
1
UND
9
UND
6
UND
31
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
54 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
30
31
32
Lote:
Item
1
2
3
TESTADOR ELETRÔNICO DE CABEAMENTO DE REDES
DE COMPUTADOR; TESTA ENTRELAÇAMENTO 1, 2, 3,
4, 5, 6, 7, 8 E G; VERIFICA SE OS CABOS ESTÃO
CONECTADOSDEFORMACORRETAETAMBÉMASUA
POLARIZAÇÃO; BOTÃO DE POSIÇÃO (LIGADO,
DESLIGADO); PESO: 0,16 KG. ALIMENTAÇÃO: BATERIA
138705 9VCONEXÕES:RJ45ERJ11.
138678 TOMADAFÊMEAP/INSTALAÇÃOTELEFÔNICA
138689 TOMADAP/CONECTORRJ452PscFURUKAWA
3 MATERIALPERMANENTEDEINFORMÁTICA
Código
DescriçãoDetalhada
138695 BANDEJAFIXAREFORÇADAP/RACKP=770HITOP
138696 BANDEJAMÓVELREFORÇADAP/RACKP=770HITOP
BATERIAESTACIONÁRIAPARANOBREAK(SMS)TAMPA
SELADA
COM
SISTEMA
DE
LABIRINTO,
PROPORCIONANDO MAIOR SEGURANÇA AO MEIO
AMBIENTE. FILTRO ANTICHAMA. LIGA DE
CHUMBOCÁLCIOPRATA. SEPARADORES DE
POLIETILENO MICROPOROSO DE ALTA RESISTÊNCIA
MECÂNICA. INDICADOR DE TESTE (CHARGE EYE),
PERMITINDO
IMEDIATA
VISUALIZAÇÃO
DAS
CONDIÇÕESDABATERIAPARATESTE,ORIENTANDOO
SEU DIAGNÓSTICO. APLICAÇÕES: NOBREAK, LUZ DE
EMERGÊNCIA, TELECOM, SISTEMAS DE SEGURANÇA,
TVACABO,CERCASELÉTRICAS,ENERGIASOLAR,PABX,
SISTEMA FOTOVOLTAICO, CADEIRA DE RODAS, SOM
AUTOMOTIVO, MOTOR DE PARTIDA, EMBARCAÇÕES,
ETC.ESPECIFICAÇÕES:[email protected]ºC(AH):10H
54 / 20H 60 / 100H 70; DIMENSÕES (MM):
COMPRIMENTO 24,4 / LARGURA 17,5 / ALTURA 139982 17,5;PESO:14,7KG
UND
UND
UND
4
50
40
Unidade
UND
UND
Qtde
5
2
UND
6
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
55 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
4
5
6
COMPUTADOR/PC COM INTEL CORE i5 4Gb 1Tb LED 18,5" CorPreto Processador Modelo Intel®
Core™ i5 3ª Geração Velocidade3,0 GHz. Memória
Cache6MB.
MonitorTipoLEDPolegadas18,5 "Resolução1366x768 Formato de tela Widescreen Driver Leitura DVD CDGravaçãoDVDCDMemória4GbBarramentoda
memória DDR3. Clock da memória 1333. HDD
Capacidade 1 Tb Velocidade de rotação HD 7200
RPM. Interface do HD SATA Sistema Operacional
Linux
PlacaderedeSimPlacadevídeointegradaIntel®HD
Graphics 2500. Placa mãe LOGIN LOG H61H2M2.
AnodelançamentodaPlacamãe2012.Dispositivos
onboard Placa Mãe Áudio, Lan e Vídeo. ProcessadorescompatíveisPlacamãeIntelCoreda2ª
e3ªGeração.Limiteupgradedememóriaplacamãe
até 16GB 1066/1333 Mhz. Fabricante do chipset
Placa mãe Intel. Chipset Intel H61. Teclado PS2 Mouse USB Alimentação Bivolt Conexões
FrontaisUSB.Traseiras4portasUSB;PS2;RJ45.
140139 PesoPesodoproduto12,9kg.
COPIADORA MULTIFUNCIONAL MONOCROMÁTICA DE
REDE. Impressora multifuncional com possibilidades
de impressão cópia, digitalização e transmissão e
recebimentodefax;velocidadede impressão40ppm;
impressão de 1ª pagina em até 08 (oito) segundos;
ciclo mensal de produção de 75.000 páginas;
qualidade de impressão mínima de 1200 x 1200 dpi;
painel de comando através de tela sensível ao toque,
mínima de 3,4"; Velocidade do processador interno
mínimode76mhz;recursodeimpressãoporeprint;
conectividade através de (1USB; 1HOST USB; 1
ETHERNET GIGABIT; 1Telecom; 1Telefone); memória
padrão mínima de 248Mb; scaner com sistema de
alimentaçãodefolhasADFDUPLEX;tensãomínimade
220 volts; garantia mínima do fabricante de 01 (um)
139942 ano.
DATA SHOW 2.200 ANSI LUMENS LCD,SDGA(800 X
600)PINCEL,VIDEO,COMPOSTO,SUPER
VIDEO,RGB;VIDEOCOMPONENTE,AUDIOVIDAÚTILDA
LÂMPADA
2000H
(3000
H
MODO
ECONÔMICA)PROJEÇÃO
FRONTAL
TETO
E
RETROPOSIÇÃO,EFEITO TRAPÉZIO DIGITAL,NÍVEL DE
RUIDOS DE 29 DB,ALIMENTAÇÃO DE 100 A 240 V
137329 (MARCALG)
UND
1
UND
8
UND
10
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
56 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
7
17607
8
17608
9
137327
10
139943
ESTABILIZADOR, de tensao, potencia nominal minima
de
1000VA,
tensao
de
entrada
bivolt
automatica(115/220 volts), com as seguintes
caracteristicas. tensao de saida:115 volts. tipo de
estabilizacao eletronica. correcao de tensao de saida
eletronica. frequencia nominal:60Hz. variacao de
tensao de entrada +/15%. variacao de tensao de
saida +/6%. nao induzir distorcao harmonica. minimo de tomadas de saida :04(quatro). certificado
doINMETRO.atenderaNBR14373.
ESTABILIZADOR, de tensao, potencia nominal minima
de 500 VA, tensao de entrada bivolt automatica
(115/220volts),comasseguintescaracteristicas:tipo
de estabilizacao eletronica correcao de tensao na
saida eletronica tensao de saida de 115 volts maxima variacao de tensao de entrada permitida +/
15% frequencia nominal de 60 Hz numero de
tomadas de saida: minima de 04 rendimento com
carganominalmaiorque90%regulacaodesaidade+
ou6%naoinduzirdistorcaoharmonicacertificado
doINMETROatenderanormabrasileiraNBR14373
FRAGMENTADORADEPAPEL/CD/CARTÃOCOMCESTO
DELIXO.VOLTAGEM;220V;QUANTIDADEDEFOLHAS:12
FOLHAS PADRÃO 75G;TIPO DE CORTE;TIRAS DE
6,4MM;FRAGMENTA
CD:SIM;FRAGMENTA
CARTÃO:SIM;
VOLUME
DE
CESTO:13
LITROS;ABERTURA:220MM;CHAVE
SELETORA:3POSIÇÕES;(OFF/AUTO/REVERSO);TEMPO
DEFRAGMENTAÇÃO:2,5MUNCONTINUO;TEMPODE
DESCANSO :15 MIN APROXIMADAMENTE. NÍVEL DE
SEGURANÇA: 02. DIMENSÕES (COM CESTO):
280X146X331MM.PESOS(COMCESTO):1,6KgBIVOLT
IMPRESSORA a laser / led, monocromática, 19 ppm,
600 dpi, 16 MB, interface paralela ou USB, interface
Ethernet10/100,10.000paginas/mes.Tecnologiade
impressão por eletrofotografia a laser ou LED; Resolução real mínima: 600 x 600 dpi; Velocidade
mínima de 19 ppm (papel carta 600 dpi); Memoria
mínima 16 MB; Tipos de papel: carta, legal,
executivo, A4, envelopes e transparências; Uma
interface paralela padrão IEEE1284 ou uma interface
USB (incluir cabo); Uma interface Ethernet 10/100
(externa ou interna); Incluir software para
gerenciamento remoto.; Suportar impressão de
10.000 paginas / mês; Entrada de papel para no
mínimo250folhas;Tensãodeentrada110V+/10%;
Manuais de instalação, configuração e operação; Garantiaintegralde1anocomassistênciatécnica"on
site" e solução do problema ou reposição do
equipamentodefeituosoemate2diasuteis,contados
apartirdodiaútilseguinteaodiadochamado.
UND
177
UND
185
UND
1
UND
54
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
57 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
11
12
13
IMPRESSORACOMREDE,ATÉ35PPMTECNOLOGIADE
IMPRESSÃO: LASER VELOCIDADE DE IMPRESSÃO: EM
PRETO E BRANCO (CARTA): ATÉ 35 PPM SAÍDA DA
PRIMEIRA PÁGINA; VOLUME MENSAL DE PÁGINAS
RECOMENDADO5: DE 750 A 3.000 PÁGINAS.
RESOLUÇÃO DE IMPRESSÃO: EM PRETO E BRANCO
(ÓTIMO): ATÉ 1200X1200DPI; EM PRETO E BRANCO
(NORMAL) RECURSO DE IMPRESSÃO MÓVEL.
ALIMENTAÇÃO DE PAPEL: ENTRADA: BANDEJA 2 DE
ENTRADA COM CAPACIDADE PARA 250 FOLHAS;
SAÍDA: ATÉ 150 FOLHAS, ATÉ 10 ENVELOPES, ATÉ 75
TRANSPARÊNCIAS. TIPOS DE MÍDIA: PAPEL (SULFITE,
LEVE,PESADO,COMUM,COLORIDO,TIMBRADO,PRÉ
IMPRESSO, PRÉPERFURADO, RECICLADO, ÁSPERO);
ENVELOPES; ETIQUETAS; TRANSPARÊNCIAS; CARTÃO
TAMANHOS DE MÍDIA: CARTA, OFÍCIO, EXECUTIVO,
105X148A216X356MM(8,5X13POL.)GRAMATURAS
DE MÍDIA: BANDEJA 1:60 A 163 G/M² (16 A 43 LB)
(DIRETO DO TRAJETO DO PAPEL PARA MÍDIA
ESPECIAL);CONECTIVIDADE:INTERFACES:1USB2.0DE
ALTA VELOCIDADE, 1 REDE GIGABIT ETHERNET
10/100/1000. RECURSOS DE REDE: PORTA DE REDE
139975 GIGABITETHERNET10/100/1000E
IMPRESSORA
INKJET
MULTIFUNCIONAL
E
MULTIFUNCIONAL)/JATO
DE
TINTA/PHOTO
137322 SMART/WIRELESS/PRETA/BIVOLT
IMPRESSORA MONOCROMÁTICA PRO 400 M401n
LASER 128 GbTecnologia de impressão Laser Velocidade do Processador 800 MHz Velocidade de
ImpressãoPreto:8SegundosQualidadedeImpressão
Até1200x1200dpiCicloMensalAté50.000páginas
Monitor LCD de 2 linhas (texto e gráficos) Conectividade Eprint Conectividade: 1 USB 2.0 de
alta velocidade / 1 rede Ethernet 10/100/1000T Padrão (Gigabit Ethernet incorporada) Requisitos de
Sistema Microsoft® Windows® 7 (32 bit/64 bit),
Vista® (32 bit/64 bit): Processador de 1 GHz 32 bit
(x86)ou64bit(x64),1GBdeRAM(32bit)ou2GBde
RAM(64bit),400MBde espaçoem discorígido,CD
ROM/DVDROM ou Internet, porta USB ou de rede;
Windows®XP32SP2(32bit):ProcessadorPentium®de
233 MHz, 512 MB de RAM, 400 MB de espaço em
disco,CDROM/DVDROM,portaUSBouderede;Mac
OS X v 10.5, v 10.6, v 10.7; Processador PowerPCG4,
G5, ou Intel® Core™; Disco rígido de 500 MB; CD
ROM/DVDROM ou Internet; USB ou Rede 140138 EspecificaçõesdeMe
UND
27
UND
6
UND
1
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
58 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
14
15
IMPRESSORAMULTIFUNCIONAL3EM1(COPIADORA,
IMPRESSORA E SCANNER ) Tecnologia de jato de
tintaMicroPiezo®de4cores(CMYK)Até5760x1440
dpideresoluçãootimizadaemdiversostiposdepapel
Cartuchosdetintaindividuais.Resistentesàaguaem
papéis especiais Resistentes à luz por mais de 100
anos Tamanho da gota de tinta 3 picolitros Velocidade 3 Máxima de impressão Em Preto 26 e
em Cores 13 ppm Normal de impressão Preto 6,2
ppm e cores 3,1 ppm Máxima de cópia Preto em
aprox.5seg.ecoloridoemaprox.10seg.Capacidade
de papel Bandeja com alimentação automática de
papel Bandeja de saída 30 folhas Manuseio de
papel Folhas individuais 10 x 15 cm (4" x 6"), 20 x 25
cm(8"x10"),carta,legal,ofício(21,6x35,6cm),A4,
A5, A6, B5 Tipos Suporta diferentes papéis; papel
normal e bond Envelopes No.10, DL, C6, 200 mm x
132 mm Tipos Normal, Bond e papéis de alta
gramaturaTipoMesaplanacomsensorCIScolorido
140137 ÁreadedigitalizaçãoMá
IMPRESSORA MULTIFUNCIONAL, a jato de tinta.
Principais Característica: Tecnologia de impressão:
Jatodetinta,térmicovisorgráficomonocromáticode
2"conectividadepadrão:1USB2.0;802.11b/g/nsem
fio capacidade de impressão móvel linguagem
standarddeimpressora:PCL3GUI,PCL3melhorado
quantidade de cartuchos de impressão: 4 (1 de cada,
preto,ciano,magenta,amarelo)tiposdetinta:àbase
de corantes (colorido), a base de pigmentos (preto) resolução de fax: preto (padrão): 200 x 200 dpi velocidade do fax: 33,6 kbps funcionalidades de fax:
remarcação automática, envio de fax adiado velocidade de digitalização cor (foto 4 x 6): 25 seg. tipo de digitalização/tecnologia: base plana,
alimentador automático de documentos, cis Digitalização em cores Modos de entrada para
digitalização: Painel frontal (digitalização e cópia),
Software Solution. Formatos dos arquivos
digitalizados: bitmap (.bmp), JPEG (.Jpg), PNG (.png),
139976 TIFF(.tif),PDF(.pdf),PDFpesquisável(.
UND
1
UND
45
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
59 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
16
17
IMPRESSORA WORKFORCE M105 Especificações
Técnicas Tecnologia de Impressão Tecnologia
exclusiva
EPSON
Micropiezo
Resolução Máxima de Impressão 1440 x 720 dpi Velocidade de Impressão 35 ppm em preto Interface USB 2.0 Wifi Capacidade de Entrada de
Papéis 100 folhas de papel A4 (Bandeja Traseira) CapacidadedeSaídadePapel30folhasTamanhosde
Papel
portador
A4,A5,A6,B5,10x15cm(4x6pol.),13x18cm(5x7pol.),
9x13cm (3.5x5pol.), Carta (8 1/2x11pol.), Oficio (8
1/2x14pol.), Meia Carta (52x8 1/2pol.), 13x20cm
(5x8pol.),20x25cm(8x10pol.),16:9wide,100x148mm
Envelopes: #10 (4 1/8x9 1/2pol.), DL (110x220mm),
6162mm)
Impressão Duplex Manual Compatibilidade Windows XP/XP Professional x64 Edition/Vista/7/8,
Mac OS X 10.5.8, 10.6.x, 10.7.x, 10.8.x Consumíveis
RefildetintaPreto:774ItensInclusos1impressora
TanquedeTintamonocromática1refildetintaPreto+
1refildetintaPretoadicionalCabodealimentação
140129 CDdeinstalaçãoeSoftwaresEp
MICRO COMPUTADOR Processador 2 Core com
frequência mínima de 3.3GHz e Cache de 4Mb, 4
threads; Placa Mãe compatível Socket 1155, com 2
slots de memoria RAM DD3, 2 slot PCIe 2.0 x1, 1 slot
PCIe 2.0 x16, 1 x PCI, 10 x USB 2.0 port(s) (6 at back
panel, black, 4 at midboard), 4 x SATA 3Gb/s ou
superior, placa de rede 10/100/1000, vídeo e som
integrados;6GBdememoriaRAMDDR31333Mhzou
superior,HDde500GB7200RPM;Gabinetetorrecom
no mínimo 3 baias com fonte real de 350w ou
superior, Gravador de DVD; Monitor LCD 18,5";
teclado USB (padrão ABNT2) com teclas alta; mouse
ótico 2 botões com scrooll USB; Garantia de 1 ano
prestadapelofabricantenoestadodaBahia.Todosos
139978 componentesdevemsercompatíveis
UND
1
UND
13
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
60 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
18
19
20
MICRO COMPUTADOR Processador 4 Core com
frequência mínima de 3.4 GHz e Cache de 6Mb,Placa
MãecompatívelSocket1155,com2slotsdememoria
RAM DD3, 2 slot PCIe 2.0 x1, 1 slot PCIe 2.0 x16, 1 x
PCI, 10 x USB 2.0 port(s) (6 at back panel, black, 4 at
midboard), 4 x SATA 3Gb/s, 2 x SATA 6Gb/s com
suporte a RAID, placa de rede 10/100/1000, vídeo e
som integrados; 8 GB de memoria RAM DDR 3
1333Mhzousuperior,HDde1TB7200RPM;Gabinete
torrecomnomínimo3baiascomfonterealde400w
ou superior, Gravador de DVD; Monitor LCD 18,5";
teclado USB (padrão ABNT2) com teclas alta; mouse
ótico 2 botões com scrooll USB; Garantia de 1 ano
prestada pelo fabricante no estado da Bahia.
139979 Todososcomponentesdevemsercompatíveis.
MICRO COMPUTADOR PROCESSADOR 2 CORE COM
FREQUÊNCIA MÍNIMA DE 2.6 GHZ E CACHE DE 3MB
OU SUPERIOR, 2 THREADS; PLACA MÃE COMPÁTIVEL
SOCKET1155,COM2SLOTSDEMEMORIARAMDD3,2
SLOT PCIE 2.0X1,1 SLOT PCIE 2.0X16, 1XPCI, 10X USB
2.0 PORT(S) (6 AT BACK PANEL, BLACK, 4 AT MID
BOARD), 4 X SATA 3GB/S OU SUPERIOR, PLACA DE
REDE 10/100/1000, VÍDEO E SOM INTEGRADOS; 4 GB
DEMEMORIARAMDDR31333MHZOUSUPERIOR,HD
DE 500 GB 7200RPM; GABIENTE TORRE COM NO
MÍNIMO3BAIAS,GRAVADORDEDVD;MONITORLCD
18,5"; TECLADO USB (PADRÃO ABNT2) COM TECLAS
ALTA; MOUSE ÓTICO 2 BOTÕES COM SCROOLL USB;
GARANTIADE1ANOPRESTADAPELOFABRICANTENO
ESTADODABAHIA.TODOSOSCOMPONENTESDEVEM
139977 SERCOMPATÍVEIS.
MONITOR. TAMANHO DO ECRÃ 21,5" (16:9); TIPO
(WIDE VIEWING ANGLE) ÂNGULO DE VISÃO AMPLO
LED;BRILHO250CD/M²;RÁCIODECONTRASTEMEGA
? DCR (STATIC 1 000:1); RESOLUÇÃO 1 920X 1 080;
TEMPO DE RESPOSTA 5MS (GTG); ÂNGULO DE VISÃO
(HORISONTAL/VERTICAL)
178º/178º;
CORES
139794 SUPORTADAS16,7M.
UND
9
UND
132
UND
1
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
61 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
21
22
MULTIFUNCIONAL
IMPRESSORA/COPIADORA/SCANNER LASER JETPRO/
MONOCROMÁTICA. IMPRESSÃO EM ATÉ 19ppm
CARTA/18ppm A4 E SAÍDA DA PRIMEIRA EM 8,5seg. MÉDIA DE 1500 IMPRESSÕES COM 5% DA PÁGINA
COBERTA. CONECTIVIDADE: INTERFACES: PORTA USB
2.0 DE ALTA VELOCIDADE SISTEMAS OPERACIONAIS:
MICROSOFT WINDOWS7;WINDOWS VISTA;WINDOWS
XP; WINDOWS SERVER2003; MAC OSx V 10.4 OU
SUPERIOR. 1 BANDEJA DE SAÍDA. 1 CARTUCHO DE
IMPRESSÃOPRETODEINICIAÇÃOHPLASERJETCE285A
PARA 700 IMPRESSÕES 1 GUIA DE INSTALAÇÃO 1
FOLHETO DE SUPORTE 1 GUIA DE GARANTIA (
QUANDO APLICÁVEL ) 1 CABO DE ALIMENTAÇÃO
ALTURA: 25cm LARGURA: 41cm PROFUNDIDADE:
26cm VOLTAGEM: 110V DIMENSÕES: (IxPxA)
139991 415x265x250mmPESO:7Kg
NoBreak 1.4kva Interativo: regulação ONLINE.
Estabilizador interno: com 4 estágios de regulação.
Tomadas: 5 Tomadas no padrão NBR14136 (padrão
novo de tomadas) Filtro de linha interno. Microprocessado: microprocessador RISC de alta
velocidade com memória Flash, integrando diversas
funções periféricas, aumentando a confiabilidade e o
desempenho
do
circuito
eletrônico.
Função TRUE RMS Auto teste: ao ser ligado, o
equipamento autoexecuta uma rotina de testes em
seus
circuitos
internos.
Battery Saver: evita consumo desnecessário,
prolongando a vida útil da bateria. Gerenciador de
Baterias: informa quando a bateria precisa ser
substituída. Recarregador Strong Charger: permite a
recarga das baterias mesmo com níveis muito baixos
de
carga.
Recarga automática das baterias em 4 estágios
(mesmo com o nobreak desligado). Inversor
sincronizado com a rede (sistema PLL).
Formadeondasenoidalporaproximação:retangular
139984 PWMcontroledelarguraeamplitude.Circuito
UND
8
UND
45
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
62 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
23
139974
24
139980
25
26
138694
139667
NOBREAK; INTERATIVO: REGULAÇÃO ONLINE. ESTABILIZADOR INTERNO: COM 4 ESTÁGIOS DE
REGULAÇÃO. 5 TOMADAS NO PADRÃO NBR
14136(PADRÃO NOVO DE TOMADAS); FILTRO DE
LINHAINTERNO.MICROPROCESSADORRISCDEALTA
VELOCIDADE DE MEMÓRIA FLASH, INTEGRANDO
DIVERSAS FUNÇÕES PERIFÉRICAS, AUMENTANDO A
CONFIABILIDADE E O DESEMPENHO DO CIRCUITO
ELETRÔNICO. FUNÇÃO TURE RMS; AUTO TESTE: AO
SER LIGADO, EQUIPAMENTO AUTOEXECUTA UMA
ROTINA DE TESTES EM SEUS CIRCUITOS INTERNOS. BATTERY SAVER: EVITA CONSUMO DESNECESSÁRIO,
PROLONGANDO A VIDA ÚTIL DA BATERIA. GERENCIADOR DE BATERIAS: INFORMA QUANDO A
BATERIAPRECISASERSUBSTITUÍDA.RECARREGADOR
STRONG CHARGER: PERMITE A RECARGA DAS
BATERIAS MESMO COM NÍVEIS MUITO BAIXOS DE
CARGA.RECARGAAUTOMÁTICADASBATERIASEM4
ESTÁGIOS (MESMO COM O NOBREAK DESLIGADO). INVERSORSINCRONIZADOCOMREDE(SISTEMAPLL).
FORMA DE ONDA SENOIDAL POR APROXIMAÇÃO:
RETANGULAR PWM CONTROLE DE LARGURA E
AMPLITUDE. CIRCUITO DESMAGNETIZADOR DC
START:PERMITESERLIGAD
Notebook PROCESSADOR 2.53GHz, 4Threads, 3M
cache ou superior, com SISTEMA OPERACIONAL
Windows 7 ou 8 na versão Profissional em Português
préinstalado, memoria 4GB DDR3 1333MHz (2x2GB),
Tela True Life WLED (1366x768) 14 polegadas com
Webcam, Placa de Vídeo integrada Intel HD Graphic,
Disco RigidoSATA de 500GB (7200RPM) ou superior,
Placa de Rede Integrada 10/100/1000, Gravador de
DVD/CDDualLayer(UnidadeDVD+/RW8x),Audiode
Alta Definição 2.0, Placa Wireless (802.11n),
Bluetooth,Bateriade6células.
RACKFECHADO1944ux770mmP/PISOPRETOIHI
TOP
RACKFECHARDEPAREDE7US
UND
5
UND
27
UND
UND
2
5
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
63 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
27
28
Lote:
Item
ROTEADOR, SEM FIO (WIRELESS), PADRÃO 802.11N
(300 MBPS), 2.4 E 5 GHZ, ANTENAS MÚLTIPLAS
(MIMO), 4 PORTAS LAN 1000BASET INTEGRADAS,
GARANTIA1ANOFREQUÊNCIADEOPERAÇÃODENO
MÍNIMO 5 GHZ VELOCIDADE MÍNIMA 300 MBPS, SUPORTE A TECNOLOGIAS IEEE 802.11G, 802.11B,
802.11N ANTENA EXTERNA QUE SE UTILIZE DO
MIMO (MULTIPLEINPUT MULTIPLEOUTPUT) ALCANCEMÍNIMOINTERNO100M,EXTERNO400M
SUPORTE BROWSERS INTERNET EXPLORER 5.0 OU
SUPERIOR E MOZILA FIREFOX 2.0 OU SUPERIOR POSSUIR INDICATIVOS DE ESTADOS DE CONEXÕES E
FUNCIONALIDADESCOMCONTROLEDEPOTENCIADE
TRANSMISSÃOSUPORTARCRIPTOGRAFIAWPAAES
SUPORTARCONTROLEDEACESSOPELOMACADDRESS
SUPORTEAMULTCASTSWITCHINTEGRADODENO
MÍNIMO 4 PORTAS ETHERNET 10/100/1000 GARANTIA MÍNIMA DE 1 ANO EMBALAGEM COM
DADOSDEIDENTIFICAÇÃODOPRODUTOEMARCADO
139784 FABRICANTE.
SWITCH, 24 PORTAS, ETHERNET, GERENCIAVEL,
EMPILHAVEL,
10/100BASETX;AUTOSENSING,
2
PORTASCOMBO1000BASET,255VLANS,8KMAC,8.8
GBPS, 6.5 ;MPPS, 16 MB MEMORIA, 4 RMON, COM
ACESSÓRIOS PARA MONTAGEM RACK 19 POL.; 24
PORTAS 10/100BASETX, AUTO NEGOCIAVEIS,
GERENCIAVEL, EMPILHAVEL, POSSUIR KITS DE
FIXACAO PARA INSTALACAO EM RACK DE 19"; POSSUIR UM MINIMO DE 2 PORTAS COMBO
1000BASET / SFP E 24 PORTAS; 10/100BASETX; ARQUITETURA
STACKABLE,
PERMITINDO
EMPILHAMENTODENOMINIMO32EQUIPAMENTOS;
POSSUIRLEDSDEIDENTIFICACAODEATIVIDADESDE
STATUS DO SISTEMA, DE CADA PORTA, E DE
ALIMENTACAO; INTERFACE DE CONSOLE
COMPATIVEL COM O PADRAO EIA/TIA232; TENSAO
DE ALIMENTACAO INTERNA DE 110/220 V, 60 HZ,
COMCHAVEAMENTOAUTOMATICO;SUPORTEPARA
FONTEDEALIMENTACAOREDUNDANTE;PORTARIEEE
802.3; SUPORTAR IEEE 802.3U; SUPORTAR
AUTONEGOCIACAOEMTODASASPORTAS;SUPORTAR
HALF/FULL DUPLEX EM TODAS AS PORTAS; SUPORTAR IEEE 802.3X CONTROLE DE FLUXO EM
138708 OPERACOESFULLDUPLEX;SUPORT
Código
4 ELETROELETRÔNICOS
DescriçãoDetalhada
UND
16
UND
9
Unidade
Qtde
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
64 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
1
2
ANTENA PARABOLICA COMPLETA; COM DISCO DE
ALIMENTADOR, BENGALO, CALHA, TELAS PARABÓLA,
ALIMENTADOR, FIO, BASE, CONECTOR, RECEPTOR.
CARACTERÍSTICAS
DO
RECEPTOR:
FREQÜÊNCIA DE ENTRADA: 950 A 2050 MHZ
SISTEMA
BANDA
C
ANALÓGICO
CAPACIDADE
PARA
60
CANAIS
ÁUDIO
FIXO
5.8MHZ
SAÍDA DE VÍDEO CONECTOR RCA E CANAL VHF 3/4
PROGRAMAÇÃO AUTOMÁTICA PARA TODOS OS
SISTEMAS: LNBF MONOPONTO/MULTIPONTO, CHAVE
COAXIAL, CHAVE SW (+5/0V), POLAR ROTOR
(CONSULTE MANUAL DO RECEPTOR PARA DETALHES)
CONSUMO 10W LIGADO E 5,5W EM STAND BY
TENSÃO DE ENTRADA AUTOMÁTICA 90~260VAC
TOMADA TRASEIRA, LIGUE E DESLIGUE SUA TV (
MÁX.
CONSUMO
DA
TV
EM
300W)
TIMER PARA DESLIGAR O RECEPTOR E A TOMADA
TRASEIRA EM 30, 60 OU 90 MINUTOS.
ENTRADA PARA SINAL DE ANTENA LOCAL
TECLASDEMUDANÇADECANALELIGA/DESLIGANO
PAINEL
CONTROLE REMOTO PARA TODAS AS FUNÇÕES DO
RECEPTOR
COM NO MINIMO 1 ANO DE GARANTIA DO
FORNECEDOR.
109984 INSTALAÇAOINCLUSA.
APARELHO
DE
DVD
COM
ENTRADA
106644 USB,MICROFONE,MP3,CDEDVD220VOLTS
UND
5
UND
110
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
65 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
3
140111
4
132115
5
140136
6
116127
CALCULADORAGRANDE12DÍGITOSCOMFITAIDEAL
PARAEMPRESASESCRITÓRIOSETC;Calculadoracom
impressão em duas cores (2,1 linhas/segundo);BIG
DISPLAY de 12 dígitos fluorescentes (azul);Teclado
profissional;Cálculo de preço;De custo;De venda,
margem, média; Contador de registros;Impressão de
DATA e HORA;Teclas Subtotal e Total
Geral;Configuração de casas decimais ( F63210
A);Tecla inversora de sinal ( /);Tecla de
arredondamento para cima para baixo ou
desligado;Quatro operações %; tecla "duplo
zero";Alimentação :Corrente alternada ( ACfixa na
calculadora ) ou 4 pilhas AA;Embalagem caixa;Cor
branca;GARANTIA
CÂMARA DIGITAL 14.1 MEGAPIXELS + CARTÃO DE
MEMÓRIA16GB,ELEGANTEELEVE,POSSUIFUNÇÕES
INTELIGENTES ALÉM DE OFERECER AS TECNOLOGIAS
SMILE SHUTTER E FACE DETECTION, ESTÁ CÂMARA
RECONHECE A CENA A SER FOTOGRAFA
AUTOMATICAMENTE E SE AJUSA SOZINHA COM O
AUTO.
Decibelímetro Dígital Datalogger Conexão Usb Calibrado Display: 4 digitos com iluminação e barra
gráficaNorma:IEC616721tipo2,ANSIS1.4Tipo2
Precisão:
±1,4dBo
Níveis
de
escala:
Baixa: 30dB a 130dB Media: 50dB a 100dB Alta:
80dB a 130dB Auto: 30dB a 130dBo Escala de
frequencia: 31,5HZ a 8kHz Escala dinâmica: 50dB Indicação de sobreescala Indicação de subescala Indicação de valor máximo MAX e mínimo MIN. Ponderaçãodetempo: Rápida (FAST):125mSLenta
(SLOW):1sPonderação:AeCFunção:DataLogger
Saída:USBNíveisdealarme:AjustáveisMicrofone:
Condensador de eletreto de ½ polegada Resolução:
0,1dB Atualização do visor: 2 vezes por segundo Saídaanalogica:AC/DC,AC=1Vrms;DC=10mV/dB
Dimensões: 278mm x 76mm x 50mm Peso: 350g Acessórios
fornecidos:
Protetor de vento Software Cabo USB Tripé Chave de ajuste (tipo fenda) Bateria 9 Volts Adaptador 9 volts (eliminador de bateria) Maleta
paratransp
DVD PLAYER KARAOKÊ COM MARCAÇÃO DE PONTO
MP3,REPRODUZDISCOSDVD,VCD,SVCD,DVCD,CDR,
MP3, PLAYER/JPEG, KARAOKÊ COM MARCAÇÃO DE
PONTO E ENTRADA PARA 02 MICROFONES, DISPLAY
COLORIDO,BIVOLT,ACOMPANHA01MICROFONE.
UND
15
UND
13
UND
1
UND
5
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
66 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
7
8
9
Filmadora 220 Wts Filmadora portátil, com zoom
óptico mínimo de 65x, sistema de gravação de áudio
Dolby Digital 2.0, luz auxiliar embutida, monitor LCD
de 2,7 polegadas, zoom digital mínimo de 1750x,
suporte a mídia de gravação SDHC, unidade de
armazenamento interna mínima de 72Gb, sistema de
cargadebateriaAC/DCeUSB,distânciafocalmínima
139983 def=1,75mm101,8mm,tendocomoconteúdo
GPS NAVEGADOR, PORTÁTIL, TELA LCD DE 4.3
POLEGADAS,TOUCHSCREEN,RECEPTORDETVDIGITAL
ISDBT, PADRÃO BRASILEIRO, FORMATO WIDE SCREEN
16:9,PROCESSADOR468MHZ,MEMÓRIARAM64MB
DDR2, CARTAO DE MEMORIA MICRO SD,
TRANSMISSORFM,LEITORDEJPG(IMAGENS),LEITOR
DE EBOOKS, JOGOS INCLUÍDOS, MAPA DO BRASIL
ATUALIZADO,+ DE 3000 CIDADES INCLUSAS + DE
80.000 KM E ESTRADAS, SUPORTA OUTROS
NAVEGADORES, PONTOS DE INTERESSE POI´S,
DESBLOQUEADO,
REVESTIMENTO
EM
FINO
ACABAMENTO,ENTRADAFONEDEOUVIDO,ENTRADA
USB, ENTRADA CARTÃO, MICRO SD, ANTENA
EMBUTIDA, ALTOFALANTE EMBUTIDO, APOIO PARA
MESA,ACOMPANHA: CARREGADOR ELETRÔNICO OU
PILHAS RECARREGÁVEIS, CABO USB, CANETA
TOUCH,CARTAO DE MEMÓRIA ( COM NAVEGADOR
INSTALADO), SUPORTE COM VENTOSA, MANUAL EM
PORTUGUÊS,CAIXAORIGINAL,GARANTIAMINIMADE
28500 UMANO.
GravadordeÁudiodigitalportátilDR05Queofereça
gravação de alta qualidade em um design leve e
compacto que qualquer um possa usar ,perfeito para
músicos, professores, jornalistas, e mais.DR05 que
grave arquivo WAV ou MP3 com taxas de ATÉ 24
BITS/96KHZemcartõesmicroSDoumicroSDHCpara
armazenamento confiável, sem saltos. Com cartão de
02GB,com microfone íntegros que capture áudio
estéreo nítido ,enquanto uma entrada mic /linha
estéreo de 3,5mm deixa você conectar microfones
139985 externosefontesdesom
UND
14
UND
1
UND
14
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
67 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
10
139876
11
18305
12
13
102780
14431
GRAVADOR,DEDVD/CDRW,EXTERNO,INTERFACEE
ALIMENTAÇÃO USB 3.0 PADRÕES DVD +/R, DVD +/
RW, DVD DL, CDR/RW, COMPATÍVEL COM PC,
GARANTIA1ANO.UNIDADEEXTERNA;CAPACIDADE
DE BOOT PELO CD / DVD.; CAPACIDADE PARA
GRAVARDVDCOMATE8,5GB(DOUBLELAYER)ECDR
COMATE700MB..;COMPATIBILIDADECOMDVD+R,
DVDR,DVD+RW,DVDRW,CDRCDRW;SUPORTAR
LEITURA E GRAVAÇÃO DE DVD A 8X.; SUPORTAR
LEITURADE CDA24XINTERFACE USB3.0;BUFFER
COMCAPACIDADENÃOINFERIORA2MEGABYTES.;
INCLUIR MANUAIS DE INSTALAÇÃO E OPERAÇÃO
ORIGINAIS. ; INCLUIR CABO LÓGICOS / DE
ALIMENTAÇÃO COMPATÍVEL COM OS PADRÕES
SUPORTADOS. ALIMENTAÇÃO EXCLUSIVAMENTE
PELA USB (NÃO DEVE NECESSITAR DE FONTE
EXTERNA); NÃO SERÁ ACEITA SOLUÇÃO COMPOSTA
DE UNIDADE DE DVD INTERNO + GAVETA DE
FABRICANTESDIFERENTES.;GARANTIAMÍNIMADE1
ANO.
GRAVADOR, de DVD / CDRW, interno, interface EIDE
ATAPI,padroesDVD+/R,DVD+/RW,CDR/RW,com
software compativel com PC. Unidade interna; Compatibilidade com DVD ROM, DVD VIDEO, DVD+R,
DVDR, DVD+RW, DVDRW, CDR CDRW, CDDA. ; Suportar as seguintes velocidades de gravacao: CDR:
40x,CDRW:24x,DVD+R:4x,DVDR:8x,DVD+RW:
4x,DVDRW:4xSuportarasseguintesvelocidadesde
leitura:CDROM:32x,DVDROM:12x,DVD+RW:4x
Interface: EIDE ATAPI.; Buffer com capacidade nao
inferior a 2 megabytes com tecnologia Buffer
Underrun ou equivalente Incluir softwares para
masterizacaodeDVDeCDcompativeiscomWindows
9x/2000/XP ou posterior com respectivas licencas
originais. Incluir manuais de instalacao e operacao
originais.Garantiaminimade1ano.
MÁQUINA FOTOGRÁFICA, CÂMERA DIGITAL DSLR
ALPHA SLTA37K (16.1 MP) C/ LENTE SAL1855 1855
MM, FILMA EM FULL HD, FOTO PANORÂMICA 3D,
SENSOR CMOS E BATERIA RECARREGÁVEL; GRAVAR
FILMES EM FULL HD COM AUTO FOCO; DISPARO
CONTÍNUO DE 7 QUADROS POR SEGUNDO, COM
FOCAGEM AUTOMÁTICA, GARANTINDO O REGISTRO
DE TODOS OS DETALHES DE UMA CENA EM
MOVIMENTO; TEM MONITOR DE LCD DE 3
POLEGADAS;MODODEFLASH.CARTÃODEMEMÓRIA
32G
PilharecarregávelAA2500mahcycleenergyB2E.BT
UND
4
UND
18
UND
UND
1
30
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
68 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
14
15
16
ROTULADOR, ELETRÔNICO, SISTEMA DE IMPRESSÃO
EM ALTO RELEVO; FABRICADA EM MATERIAL
PLÁSTICO E IMPERMEÁVEL; PORTÁTIL, ALIMENTAÇÃO
PILHAS OU BATERIAS; UTILIZA FITAS PLÁSTICAS
139767 AUTOADESIVASDE9A12MM.
TABLET ANDROID 4.0, WIFI 3G Ice Cream
Sandwich;Display7polegadascapacitivo;Resoluçãoda
Tela (pixels) 800x480 (16:9);Processador Boxchip A13
1.2Ghz;Memória RAM 512MB DDR3;Memória Interna
4GB(Expansívelaté32GBMicroSD);GSensor;Sistema
OperacionalCompatívelWindowsXP/Vista/7,Linux2.4
ou Mac OS10.4 (ou acima);Idiomas Multilinguas
(Português, Inglês, Espanhol, etc.);Suporte Microsoft
Officeparaandroid(WordeExcel);Suporta3Gatravés
de modem externo;modelos de modem: Huawei (
E153 WCDMA; E156G WCDMA; E220 WCDMA; E1750
WCDMA)
ZTE
(MF110
WCDMA;
AC2736
CDMA2000)WiFi 802.11b/g;Câmera Frontal 2.0MP
por software;Gravador de vídeo;Formato de gravação
WAV;FocoAutomático;EditordeImagens;Entradapara
fone de ouvido P2 3.5mm;Músicas Formato:
MP3,AAC,OGG,WAV,APE,FLAC,AMR,WMA;Vídeos
Formato: AVI,MPG,VOB,.MKV,FLV,TS/TP,H264,MPRC
4,RMVB,DIVX,MPEG2;
Fotos Formato: JPEG,GIF,PNG,BMP;Leitor de Livros e
Revistas(EBook)Formato:PDF;SNR>80dB;Frequência
140083 deResposta20Hz~20KHz;USB
Televisor 32" Led * Full HD Conversor digital
integradoResolução:1366x768Taxadeatualização:
120Hz Clear Motion Tempo de Resposta: mega
contrastePotênciadeáudiototal:10wx2Sistema
de TV: NTSC, PALM, PALN, ISDBTB Conexões: 3
HDMI, 2 USB, 1 Saída de áudio (Mini Jack), 1 Entrada
deVideoComponente(Y/Pb/Pr),1EntradadeVideo/
AudioComposto,1Saidadeáudio(Óptica),1Entrada
de Audio Digital (Mini Jack), 1 Ethernet (LAN), 2
28573 EntradadeRF(Terrestre/Cabo)
UND
1
UND
800
UND
1
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
69 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
17
18
TV 22" LCD HDTV (1366 X 768 PIXELS)DIAGONAL
VISUAL
APROXIMADA
(CM)54.8
CM.CONEXÕES:ENTRADAS USB (1 LATERAL);VÍDEO
COMPOSTO(1 LATERAL + 1 TRASEIRA);VÍDEO
COMPONENTE (1 TRASEIRA);HDMI (2 TRASEIRAS);
ÁUDIO ANALÓGICO(1 LATERAL + 2 TRASEIRAS);SAÍDA
DE ÁUDIO DIGITAL (1 TRASEIRA)ENTRADA
HDMI,CONSUMO (KW/H)ELÉTRICO EM STAND BY MENOS DE 1.0 W/ELÉTRICO EM USO 50WCOR
PRETO.NÃO PORTATIL, NÃO RECARREGÁVEL, NÃO
GRAVA PROGRAMAS,CONTROLE REMOTO UNIFICADO
COM TV/DVD,IDIOMAS DO MENU:PORTUGUÊS,
ESPANHOL
E
INGLÊS,TIMER
ON/OFF,SLEEPTIMER,CANAIS 180, BLOQUEIO DE
CANAIS,SISTEMA EM CORES NTSC, PAL M, PAL
N.RESOLUÇÃO
1366X768,CONTRASTE,BRILHO,PIP
(PICTURE IN PICTURE),PROGRESSIVE SCAN,MENU NA
TELA,ZOOM,POTÊNCIA DE ÁUDIO 5W+5W,SOM
ESTEREO,SAP,CLOSED
CAPTION,SURROUND,DOLBY
DIGITAL,FREQUÊNCIA 60HZ,BIVOLT,GARANTIA DO
128542 FORNECEDOR12MESES
TV DE 32 POLEGADAS LED, SMART ENERGY SAVING
PLUS: FUNÇÃO QUE PROPORCIONA ECONOMIA DE
ENERGIA ATRAVÉS DO AJUSTE DO NÍVEL DO BRILHO
DA TV INTELLIGENT SENSOR: AJUSTA A IMAGEM NA
TELA QUANDO HÁ MUDANÇAS NA ILUMINAÇÃO DA
SALA, PARA QUE VOCÊ EXPERIMENTE A
ORIGINALIDADE DA IMAGEM CLEAR VOICE 2.0:
AUMENTA AUTOMATICAMENTE SOM DA VOZ
HUMANA, QUANDO HÁ RUÍDO DE FUNDO PICTURE
WIZARD 2.0: FÁCIL AJUSTE DA QUALIDADE DE
IMAGEM TAIS COMO NÍVEL DE PRETO, COR DA
TONALIDADE, NITIDEZ E NÍVEIS DE LUZ DE FUNDO
TAMANHODATELA32"FULLHDCONVERSORPARA
TV DIGITAL INTEGRADO, ESTÉREO FUNÇÃO SAP
ENTRADA USB ENTRADA HDMI 1TIMER ON,TIMER
OFF,CONTROLE
REMOTO
220V
RESOLUÇÃO 1920 X 1080 BRILHO 360 CD/M²
CONTRASTE DINÂMICO 4.000.000:1 POTÊNCIA DE
ÁUDIO
TOTAL
(RMS)
20W DIMENSÕES S/ BASE (LXAXP) MM 746,0 X
462,0X35,5PESOS/BASE(KG):8,2DIMENSÕESC/
BASE (LXAXP) MM 746,0 X 528,0 X 204,0 PESO C/
BASE (KG) 9,7 CONSUMO DE ENERGIA 80W
(IEC62087)CORPRETOTENSÃO/VOLTAGEMBIVOLT
135058 CO
UND
15
UND
30
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
70 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
Lote:
Item
5 PEQUENOSDISPOSITIVOS
DescriçãoDetalhada
ADAPTADOR,DEREDE,SEMFIOPADRÃO(WIRELESS),
PADRÃO802.11G(WIFI),EMDISPOSITIVO,PORTÁTIL,
COM CONECTOR USB TIPO PENDRIVE, COM ANTENA
INTEGRADA, SEGURANÇA WEP 64/128 E WPA. ADAPTADORTIPOPENDRIVECOMINTERFACEDEREDE
WIFI COM CONECTOR USB 2.0; ATENDER AOS
PADRÕESIEEE802.11G,IEEE802.11B;IMPLEMENTAR
SEGURANÇA DE DADOS COM CRIPTOGRAFIA WEP DE
64/128BITSEWPA;ADERENTEAOSESQUEMASDE
MODULAÇÃODBPSK,DQPSK,CCK,EOFDM;ALCANCE
DE ATE 100 METROS "INDOOR" E ATE 400 METROS
"OUTDOOR"INDICADOPELOFABRICANTE.;ANTENA
INTERNA INTEGRADA ; INTERVALO DE FREQUÊNCIA:
2.42.497 GHZ;SUPORTAR REDE LOCALEMMODO
ADHOC (PONTO A PONTO SEM ACCESS POINT); SUPORTAR MODO ESTRUTURADO (COMUNICAÇÕES
DE REDES COM FIO VIA ACCESS POINT COM
ROAMING); POSSUIR LED INDICATIVO DE LINK E
ATIVIDADE; MÉTODO DE ACESSO CSMA/CA; INCLUIR SER FORNECIDO COM TODO O SOFTWARE
NECESSÁRIO AO FUNCIONAMENTO DE ACORDO COM
OS PADRÕES DE SEGURANÇA E COMUNICAÇÃO DE
139970 DADOSEXIGIDOS,EMCDORI
Código
1
2
139860
3
139968
4
139972
5
139887
6
139886
CABO, USB 2.0; (PARA IMPRESSORA); CONECTORES
AM/BM,COMPRIMENTO1,80M.
COOLERORIGINAL1155,SOCKETCOMPATÍVEIS:INTEL
LGA 1156/1155 PROCESSADORES COMPATÍVEIS:
INTEL CORE I3, I5 E I7 VOLTAGEM DE ENTRADA: 12V
DCPOTÊNCIA:1.4VVELOCIDADEDOCOOLER:2200+
10%RPMNIVELDERUIDO:25+110%DBA.
COOLER PARA PROCESSADOR SOCKET 775, BASE DE
ALUMUNIO, TENSÃO 12V, CONSUMO 4W,
VELOCIDADE 2200RPM, FLUXO DE AR 40,9 CFM,
RUIDO25DB,DIMENSÕES:9,5X9,5X2,5CM.
DISCO,RÍGIDO(HD),INTERFACESATA3GB/S(SATA2),
CAPACIDADE500GB,BUFFER8MB,7200RPM,TMA9
MS,COMCABOSLOGICOEDEALIMENTAÇÃO.
DISCO,RÍGIDO,(HDD),INSTALAÇÃOINTERNA,SATAII,
7200RPM,UMTERABYTE,COMCABOS,GARANTIADE
1ANO.DISCOINTERNO.;INTERFACEPADRÃOSATA
II.; VELOCIDADE 7200 RPM.; CAPACIDADE NAO
FORMATADAMÍNIMADEUMTERABYTE.;FORNECER
CABO LOGICO SATA E CABO Y DE ALIMENTAÇÃO
(DERIVADOR).; GARANTIA MÍNIMA DE 1 ANO DADA
PELOFABRICANTE.
Unidade
Qtde
UND
30
UND
30
UND
56
UND
40
UND
34
UND
7
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
71 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
7
139783
8
140116
9
139782
10
134747
11
139875
12
139911
13
139884
14
139883
15
139885
DISCO, RÍGIDO, HD EXTERNO, PORTÁTIL, INTERFACE
INTERNA SATA, 2 TB DE CAPACIDADE DE
ARMAZENAMENTO, INTERFACE EXTERNA USB 3.0,
COMPATÍVEL COM USB 1.1, PLUG AND PLAY, PARA
USO COM WINDOWS, LINUX E MAC ALIMENTAÇÃO
ATRAVÉSDEUSB,SEMUSODEELIMINADOR.
FITA PARA CALCULADORA 12 DÍGITOS TP CV 19 CAIXA C/ 12 UNIDADES COMPATÍVEL C/ A MÁQ.
TEXPRINT,13MMX4M
FITAPARA ROTULADORELETRÔNICO, COMPRIMENTO
8METROS,LARGURA9MMCOR:LETRAPRETASOBRE
FUNDODOURADO.
HD 500 GB,Capacidade: 500GB Uso em Computador:
Desktop Interface: Sata Tamanho do buffer DRAM:
16MB Velocidade de rotação: 5400 RPM Voltagem:
5V±5%,+12V±10%
KIT PLACA MÃE+PROCESSADOR+MEMÓRIA; PROCESSADOR2CORECOMFREQUÊNCIAMÍNIMADE
2.6GHZ ECACHEDE3MBOU SUPERIOR,2THREADS;
PLACAMÃECOMPÁTIVELSOCKET1155,COM4SLOTS
DEMEMÓRIARAMDDR3,2SLOTPCIE2.0PORT(S)(6
ATBACKPANEL,BLACK,4ATMIDBOARD),4XSATA3
GB/S OU SUPERIOR, PLACA DE REDE 10/100/1000,
VÍDEO E SOM INTEGRADOS; 4 GB DE MEMÓRIA RAM
DDR31333MHZ.
LEITOR, de codigo de barras, com fio, fonte de luz a
Laser, conexao via cabo, interface USB, padrao de
leituraemvarreduralinhaunicaSuportarleitorados
seguinte padroes de simbologia: intercalado 2 de 5,
code2de5,code11,code39,Capacidadedeleitura
de barras na distancias de ate 25 cm. Indicadores
luminosos e sonoros de reconhecimento de codigo Garantiaminimade01ano.
MEMORIA, TIPO DDR2 SDRAM, PADRAO PC25300,
667 MHZ, NAO ECC, COM SPD, MODULO COM 2 GB,
GARANTIA1ANODADAPELOFABRICANTE.
MEMORIA, TIPO DDR1 SDRAM, PADRAO PC25300,
667 MHZ, NAO ECC, COM SPD, MODULO COM 1 GB,
GARANTIA5ANOSDADAPELOFABRICANTE.
MEMORIA, TIPO SDRAM DDR3 1333 MHZ, 1.5V,
PADRÃO PC310600, NÃO ECC, 240 PINOS, DUAL
CHANNEL,CASLATENCY9,TIMING99924,KITCOM
2MÓDULOSDIMMDE4GIGABYTESCADA,GARANTIA
1ANO.KITCOM2MÓDULOSDIMMDE4GIGABYTES
CADA,TOTALIZANDO8GIGABYTES.;TIPODDR31333
MHZ, 1.5V.; PADRÃO PC310600.; NÃO ECC.; 240
PINOS,DUALCHANNEL.;CASLATENCY9,TIMING99
924.; O NOME DO FABRICANTE E CONFIGURAÇÃO
DA MEMÓRIA DEVERÁ CONSTAR NO SPD DA
MEMÓRIA FORNECIDA.; EMBALAGEM LACRADA
UND
5
UND
12
UND
10
UND
5
UND
62
UND
3
UND
40
UND
17
UND
85
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
72 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
ORIGINAL DO FABRICANTE. ; GARANTIA INTEGRAL
PELO PERÍODO DE 1 ANO, DADA PELO FABRICANTE,
COMPROVADA ATRAVÉS DE DOCUMENTAÇÃO
PERTINENTE.
16
9080
17
18
138566
139981
19
139832
20
139888
MOUSE ÓPTICO, padrao USB, 2 botoes, 1 roda de
rolagem(scroll),comconversorparaPS/2.Conector
USBcomconversorparaPS/2.Resolucaominima400
dpi. 2 (dois) botoes + roda de rolagem (scroll) com
rolagem da tela manual ou automatica, selecionavel
por click na roda de rolagem. Incluir software e
drivers para plena funcionalidade nos Windows que
dao suporte a interface USB. Corpo ergonomico,
desenhosimetricoparausopordestrosecanhotos,na
cor beje, gelo ou branco. Instrucoes de operacao e
instalacaoemportugues.
PENDRIVE16GB,UNIDADEDEARMAZENAMENTODE
DADOS VIA USB 2.0 COM CAPACIDADE PARA 16GB;
ESTRUTURACOMPOSTAPORCAPADEMETAL,DEVERÁ
POSSUIRSISTEMAINTERNOQUEPERMITAPROTEÇÃO
NATIVA DOS DADOS ATRAVÉS DE SENHA
CRIPTOGRAFADADE128BITS
PlacadeVídeoLGBPCIe*
TECLADO,PARAMICROCOMPUTADORPC,107TECLAS
LAYOUT PADRAO ABNT2 ESTENDIDO, CONECTOR
USB.LAYOUTABNT2ESTENDIDOCOMTECLASPARA
WINDOWS. CONECTOR USB. CONSTRUIDO EM
TERMOPLASTICO DE COR UNICA MINIMO DE 107
TECLAS EM ANGULO RETO, COM GRAVACAO
PERMANENTE (A LASER OU TRANSFERENCIA A
QUENTE) DAS LETRAS E SIMBOLOS.; TECLAS
BACKSPACE E ENTER DE TAMANHO DUPLO; BLOCO
NUMERICO SEPARADO DAS DEMAIS; AS TECLAS
POWEROFFESLEEP,SEEXISTIREM,DEVEMESTAREM
BLOCO SEPARADO DO BLOCO QUE CONTEM AS
TECLAS INSERT E DELETE. ACIONAMENTO POR
MEMBRANA CAPACITIVA COM RETORNO TACTIL; CURSO DE ACIONAMENTO MINIMO DE 3,5
MILIMETROS; DISTANCIA ENTRE TECLAS DE NO
MINIMO5MILIMETROS(NOTOPO);REGULAGEMDE
INCLINACAO.; INDICATIVO LUMINOSO NO TECLADO
DOSTATUSDASFUNCIONALIDADESNUMLOCKECAPS
LOCKGARANTIADE1ANO.
TESTADOR DE FONTE DE ALIMENTAÇÃO FONTE
SUPORTADAS:ATX2.0EANTERIORESVOLTAGENSDE
TEXTE: +3.3V; +5V E +12V TIPO DE CONECTORES
SUPORTADOS: MOLEX, FLOPPY, SATA, P4, 20PIN, 24
PIN; CONEXÔES, 01 X ATX 2024 PINOS; 01 X MOLEX;
01XSATA;01XFLOPPY;01X4PIN12V.
UND
170
UND
UND
235
1
UND
195
UND
4
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
73 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
Lote:
Item
6 FERRAMENTASEACESSÓRIOS
DescriçãoDetalhada
ASPIRADOR DE PÓ, ELÉTRICO, PORTÁTIL, COM
FUNÇÃO JATEAMENTO. POTENCIA E BICOS
ESPECIALMENTE
DESENVOLVIDOS
PARA
139890 INFORMÁTICA.TENSÃO220VOLTS
139245 BROCADEVÍDIADE¹/2X30
138701 BUCHANº6COMPARAFUSOS
139213 BUCHAS7COMPARAFUSOS
KIT DE FERRAMENTAS, CAIXA COM 141 PEÇAS DE
FERRAMENTAS, ACOMPANHADAS DE UMA MALETA
RESISTENTE, INTES A DISPOSIÇÃO: PREGOS,
MARTELO, PARAFUSOS, BUCHAS, CHAVES, ALICATES,
SOCKETS, ESTILETE, ENTRE OUTROS. CONTEÚDO DA
EMBALAGEM: 1 MARTELO. 1 TRENA 1 FITA
ISOLANTE.1SUPORTEDESOQUETE.9SOQUETE¼
5MMA13MM.1TRENADE3METROS1ESTILETE.
1 CHAVE DE FENDA. 1 CHAVE PHILIPS. 1 CHAVE
CATRACA.1SOCKETDE8MMA15MM.1CHAVEDE
BOCA8MM.1CHAVEDEBOCA10MM.1CHAVEDE
BOCA 11MM. 1 CHAVE DE BOCA 12MM. 1 CHAVE
DE BOCA 13MM. 1 CHAVE DE BOCA 14MM. 1
CHAVE HALEN 3MM. 1 CHAVE HALEN 4MM. 1
CHAVE HALEN 5MM. 1 CHAVE HALEN 6MM. 4
CHAVE DE PRECISÃO. 4 BITS FENDA. 1 MINI TORK
3MM. 1 MINI TORK 4MM. 1 MINI TORK 5MM. 1
MINITORK6MM.1MINITORK7MM.1MINITORK
8MM.1MINITORK9MM.64PREGOSPEQUENOS.
10 PARAFUSOS 5MM. 10 BUCHAS 5MM. 5
139969 PRESILHAS.
LIMPA, CONTATO, CIRCUITO ELÉTRICO E ELETRÔNICO
EMBALAGEM: AEROSSOL COM 300 ML, COM DADOS
DE IDENTIFICAÇÃO DO PRODUTO, MARCA DO
FABRICANTE, DATA DE FABRICAÇÃO E PRAZO DE
139889 VALIDADE
PASTA TÉRMICA PENETRAÇÃO (MM/10 S): 265295
OU2202250(1/10MM).CONSISTÊNCIANLGI2OU3
EXUDAÇÃO: 0,4 % CONDUTIVIDADE TÉRMICA
(W/MK):1,2W/MK(NORMATÉCNICAISO8301:1991)
PONTO DE GOTA: INEXISTENTE COR: BRANCA 139878 SOLUBILIDADEEMÁGUA:0,04G/100ML.
Código
1
2
3
4
5
6
7
Lote:
Item
7 BALANÇADIGITAL
DescriçãoDetalhada
BALANÇA DIGITAL 220 W, CAPACIDADE DE PESAGEM
15KG;DIVISÃO2GDE0KGATÉ6KG;5GDE6,005KG
ATÉ15KG;30KGDIVISÃO5GDE0KGATÉ15KG;10G
139336 DE 15,010 KG ATÉ 15 KG;PRATO DE PESAGEM AÇO
Código
1
Unidade
Qtde
UND
UND
UND
UND
4
1
400
300
UND
2
UND
6
UND
30
Unidade
Qtde
UND
1
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
74 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
INOXIDÁVEL.CANALETAS PARA ESCOAMENTO DE
LÍQUIDOS.
2
Lote:
Item
Código
1
Lote:
Item
2
8 CARROSPARAARMAZENAGEM
DescriçãoDetalhada
CARRO ARMAZEM DE CARGA COM 2 RODAS DE 9"
140752 COMRODASMACISASCOMCAPACIADADE300KG
9 SERVIDORDEREDE
DescriçãoDetalhada
GABINETE;BAIASEXT:9de5.25"/1de3.5"BAIASINT:
9 de 5.25"/ 4 de 3.5" C/ USO DE
ADAPT.VENT:FRONTAL 12 CM PORTAS FRONT:4USB
MINIJACK 3,5mm P2 P/ ÁUDIO E MIC SLOTS EXP:
7pci DIM: 500 x 432 x 210 mm COMP.PLACAS MÃE
ATX / MIDI ATX / MICRO ATX\FONTE COMP.PADRÃO
ATX12V v2.31 DIM: 5,9"(W) x 3,4"(H) x 5.5"(L);
150mm(W) x 86mm(A) x 140mm(L); MODULAR NÃO
POT.450W80PLUSNÃOAPLICÁVELATXCON.1EPS
CON.1PCIE CON.2 4 PIN CON.PERIF.4 SATA
CONEC.4FLOPPY
CONECTOR
2
MTBF100.000H\PROC:FREQ:TRABMODONORMAL3,3
GHz MODO TURBO 3.7GHz SOQUETE LGA 1155Nº
DE NÚCLEOS 4Nº DE THREADS 08TAM.CACHE L2:
4x256KBTAM.CACHEL3:8MB(
MÍNIMO
)
VELOC.BARRA.
(BUS
SPEED):5GT/s
DMISET
INST.64bit\ATXALTAPERF.SOQUETELGA11554DDR3
1600 MHz C/ SUP. 32Gb\PL.MÃE VGA
138527 64Mb;MEM.DDR38MbGRAFICOS;6SATA;8USB;
Código
1
BALANÇA DIGITAL 220W,COM CAPACIDADE DE 300
KG, DIVISÕES DE 100G; PLATAFORMA DE 550 X 390
MM; C/COLUNA DE 1,20M E RODAS; FUNÇÃO TARA;
DISPLAY6DÍGITOS;PESAGEMMÍNIMADE1KG;SAÍDA
108349 PARAIMPRESSORA.
MÓDULO EXTERNO DE BATERIA ESTACIONÁRIA DE
141259 40AhCOMPATÍVELCOMNOBREAKCÓD:139974
UND
1
Unidade
Qtde
UND
3
Unidade
Qtde
UND
2
UND
2
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
75 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,,
SDSHOWLPEUDGRGDHPSUHVD
02'(/23523267$'(35(d26
/LFLWDomR1ž309%$0RGDOLGDGH35(*­235(6(1&,$/7,320(12535(d2*/2%$/
325/27(
6HVVmR3~EOLFDjVKRUDV
/RFDO6HWRUGH/LFLWDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDVLWXDGDD7UDYHVVD*HQHUDO/DEDWXW61
&HQWUR9DOHQoD±%DKLD
,'(17,),&$d­2'$352321(17(
5D]mR6RFLDOBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&13-BBBBBBBBBBBBBBBBBBBBBBBBBB
2SWDQWHSHOR6,03/(6"6LP1mR
(QGHUHoRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
%DLUUR&LGDGHBBBBBBBBBBBBBBBBBBBBBBBBBBBBB&(3BBBBBBBBBBBBBBBBBBB
7HOHIRQH)D[BBBBBBBBBBBBBBBBBBBBBBBBB
%DQFR&RQWD%DQFiULDBBBBBBBBBBBBBBBBBBBBBBB
1RPHHQžGD$JrQFLDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
,WHP 4WGH 8QLG
'HVFULomR
0DUFD
9DORU
9DORU7RWDO
0RGHOR
8QLWiULR
$ HPSUHVD GHFODUD TXH HVWmR LQFOXVDV QR YDORU FRWDGR WRGDV DV GHVSHVDV
FRPPmRGHREUDHEHPFRPRWRGRVRVWULEXWRVHHQFDUJRVILVFDLVVRFLDLVWUDEDOKLVWDVSUHYLGHQFLiULRVH
FRPHUFLDLV
(VWDQGR GH DFRUGR FRP RV WHUPRV GR DWR FRQYRFDWyULR H FRP D OHJLVODomR QHOH LQGLFDGD SURSRPRV RV
YDORUHVDFLPDFRPDYDOLGDGHGDSURSRVWDGHBBBBBBBBBGLDVH3UD]RGH([HFXomRLPHGLDWRDFRQWDUGD
2UGHPGH6HUYLoRFRQIRUPHHGLWDO
/RFDOHGDWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&DULPERGDHPSUHVD$VVLQDWXUDGRUHVSRQViYHO
2EV 6HUmR GHVFODVVLILFDGDV DV SURSRVWDV TXH DSUHVHQWDUHP FRWDo}HV FRQWHQGR SUHoRV H[FHVVLYRV
VLPEyOLFRVGHYDORU]HURRXLQH[HTtYHLVQDIRUPDGDOHJLVODomRHPYLJRURXDLQGDTXHRIHUHoDPSUHoRV
RXYDQWDJHQVEDVHDGDVQDVRIHUWDVGRVGHPDLVOLFLWDQWHV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
76 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,,,
0RGHORGH&DUWDGHFUHGHQFLDPHQWR
3DSHO7LPEUDGRGDHPSUHVD
¬
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
7,320(12535(d2*/2%$/325/27(
,QGLFDPRV R D 6U D BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU D GD FpGXOD GH
LGHQWLGDGH QžBBBBBBBBBBBBBBBBBBBBBBBB yUJmR H[SHGLGRU BBBBBBBBBBBBBBBBBBBBBB FRPR
QRVVR UHSUHVHQWDQWH OHJDO QD /LFLWDomR HP UHIHUrQFLD SRGHQGR UXEULFDU D GRFXPHQWDomR GH
+$%,/,7$d­2 H GDV 3523267$6 PDQLIHVWDU SUHVWDU WRGRV RV HVFODUHFLPHQWRV j QRVVD
3URSRVWD LQWHUSRU UHFXUVRV GHVLVWLU GH SUD]RV H UHFXUVRV HQILP SUDWLFDU WRGRV RV DWRV
QHFHVViULRVDRILHOFXPSULPHQWRGRSUHVHQWH&UHGHQFLDPHQWR
$WHQFLRVDPHQWH
QRPHHIXQomRQDHPSUHVD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
77 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,9
02'(/2'('(&/$5$d­2
3DSHOWLPEUDGRGDHPSUHVD
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
'(&/$5$d­2
$BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQVFULWDDR&13-Qž
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBSRULQWHUPpGLRGHVHXUHSUHVHQWDQWHOHJDORD6UD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU D GD &DUWHLUD GH
,GHQWLGDGHQžBBBBBBBBBBBBBBBBBBHGR&3)QžBBBBBBBBBBBBBBBBBBBBBBBBB'(&/$5$VRE
DV SHQDV GD OHL TXH DWp D SUHVHQWH GDWD LQH[LVWHP IDWRV LPSHGLWLYRV SDUD VXD KDELOLWDomR QR
SUHVHQWH SURFHVVR OLFLWDWyULR FLHQWH GD REULJDWRULHGDGH GH GHFODUDU RFRUUrQFLDV SRVWHULRUHV H
SDUD ILQV GR GLVSRVWR QR LQFLVR 9 GR DUW GD /HL Qž GH GH MXQKR GH DFUHVFLGR
SHOD /HL Qž GH GH RXWXEUR GH TXH QmR HPSUHJD PHQRU GH GH]RLWR DQRV HP
WUDEDOKR QRWXUQR SHULJRVR RX LQVDOXEUH H QmR HPSUHJD PHQRU GH GH]HVVHLV DQRV UHVVDOYD
HPSUHJD PHQRU D SDUWLU GH TXDWRU]H DQRV QD FRQGLomR GH DSUHQGL] H TXH QmR SRVVXL HP VHX
TXDGUR GH SHVVRDO VHUYLGRUHV S~EOLFRV H[HUFHQGR IXQo}HV WpFQLFDV FRPHUFLDLV GH JHUrQFLD
DGPLQLVWUDomRRXWRPDGDGHGHFLVmRLQFLVR,,,GRDUWžGD/HL
/RFDOHGDWD
$VVLQDWXUDHLGHQWLILFDomRGRUHVSRQViYHOSHODHPSUHVD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
78 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29
3DSHOWLPEUDGRGDHPSUHVD
0RGHOR GH 'HFODUDomR GDQGR FLrQFLD GH TXH FXPSUH SOHQDPHQWH RV UHTXLVLWRV GH
KDELOLWDomR)25$'26(19(/23(6³´H³´
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
'HFODUDPRVHPDWHQGLPHQWRDRSUHYLVWRQRLWHPGRHGLWDOGH3UHJmRQƒ309%$
TXH FXPSULPRV SOHQDPHQWH RV UHTXLVLWRV GH KDELOLWDomR H[LJLGRV SDUD SDUWLFLSDomR QR SUHVHQWH
FHUWDPH
/RFDOHGDWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$VVLQDWXUDHFDULPER
UHSUHVHQWDQWHOHJDO
2EV$VHUHQWUHJXHMXQWRFRPRVHQYHORSHVHTXDQGRGHFODUDGDDEHUWDDVHVVmRSHOR
SUHJRHLUR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
79 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,
02'(/2'($7(67$'2'(&$3$&,'$'(7e&1,&$
7LPEUHORJRPDUFDGDHPSUHVDHPLWHQWH±&13-
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDWHVWDSDUDRVGHYLGRVILQVTXHD
(PSUHVDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
FRP
VHGH
QD
BBBBBBBBBBBBBBBBBBBBBBB IRUQHFHXIRUQHFH RV SURGXWRV $%$,;2 5(/$&,21$'26 VHQGR
FXPSULGRUDGRVSUD]RVHWHUPRVILUPDGRVQDFRQWUDWDomRQmRKDYHQGRFRQWUDDPHVPDQHQKXP
UHJLVWURTXHDGHVDERQH
5HODomRGRVSURGXWRVIRUQHFLGRV
D
E
F
/RFDOH'DWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1RPHFRPSOHWRSRUH[WHQVRGRUHVSRQViYHOSHOD3HVVRD-XUtGLFDHPLWHQWHGHVWHDWHVWDGR
HVXDDVVLQDWXUD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
80 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,,
02'(/2'('(&/$5$d­2'(
0,&52(035(6$((035(6$'(3(48(123257(
7LPEUHORJRPDUFDGDHPSUHVDHPLWHQWH±&13-
$
35()(,785$081,&,3$/'(9$/(1d$
5()5(*­235(6(1&,$/1ž309%$
$HPSUHVDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQVFULWDQR&13-0)VRERQž
BBBBBBBBBBBBBBBBBBBBBBB
SRU
VHX
UHSUHVHQWDQWH
OHJDO
RD
6UD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU GD &pGXOD GH ,GHQWLGDGH Qž
BBBBBBBBBBBBBBBBBBBHGR&3)0)QžBBBBBBBBBBBBBBBBBBBBGHFODUDVREDVSHQDVGDOHH
VHP SUHMXt]R GDV SHQDOLGDGHV SUHYLVWDV QHVWH HGLWDO TXH p ³PLFURHPSUHVD RX HPSUHVD GH
SHTXHQR SRUWH´ QRV WHUPRV GR HQTXDGUDPHQWR SUHYLVWR D /HL &RPSOHPHQWDU Qž GH GH
GH]HPEUR GH TXH FRQKHFH QD tQWHJUD H HVWi SRUWDQWR DSWD D H[HUFHU R GLUHLWR GH
SUHIHUrQFLDFRPRFULWpULRGHGHVHPSDWHQRSUHJmRSUHVHQFLDOQž309%$
/RFDOH'DWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1RPHFRPSOHWRSRUH[WHQVRGRUHVSRQViYHOSHOD3HVVRD-XUtGLFDHPLWHQWHGHVWHDWHVWDGRHVXD
DVVLQDWXUD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
81 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,,,
0,187$'$$7$'(5(*,6752'(35(d26'235(*­235(6(1&,$/1ž
$RV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBD
35()(,785$
081,&,3$/'(9$/(1d$FRPVHGHD7UDYHVVD*HQHUDO/DEDWXWVQžHIRURHP9DOHQoD%DKLD
LQVFULWDQR&13-VRERQžR3UHJRHLURQRVWHUPRVGR'HFUHWR0XQLFLSDOQž
GHGHIHYHUHLURGH'HFUHWRQžGHGHMXOKRGHHGRV'HFUHWRV
GHGHDJRVWRGHLQWHJUDQWHVGRSUHVHQWHDMXVWHGLDQWHGRGLVSRVWRQRDUWLJRGD/HL
Qž GH GH MXQKR GH H GHPDLV QRUPDV OHJDLV DSOLFiYHLV HP IDFH GD FODVVLILFDomR
GDV 3URSRVWDV DSUHVHQWDGDV UHVROYH 5(*,675$5 35(d26 SDUD HYHQWXDO FRQWUDWDomR GH
HPSUHVD HVSHFLDOL]DGD SDUD )251(&,0(172 '( 0$7(5,$/ 3$5$ 7(/()21,$ (
&$%($0(172 (6758785$'2 TXH VH GHVWLQDUmR jV GLYHUVDV 6HFUHWDULDV GR
0XQLFtSLR GH DFRUGR DV FRQGLo}HV H HVSHFLILFDo}HV FRQVWDQWHV QR 7HUPR GH 5HIHUrQFLD H
GHPDLV GLVSRVLo}HV IL[DGDV QHVWH (GLWDO H VHXV $QH[RV GXUDQWH R SHUtRGR GH YDOLGDGH GD
SUHVHQWH $7$ '( 5(*,6752 '( 35(d26 RIHUHFLGRV SHODV HPSUHVDV
FODVVLILFDGDVHPSULPHLUROXJDUSDUDRVLWHQVDEDL[R
GLVFULPLQDGRV H SHODV HPSUHVDV UHPDQHVFHQWHV H
QDRUGHPVXFHVVLYDGHFODVVLILFDomRREVHUYDGDVDVFRQGLo}HVGR(GLWDOTXHUHJH
R3UHJmR3UHVHQFLDOQž
,7(0 '(6&5,d­2
81,'$'( 48$17
35(d2
'(7(1725$
81,7È5,2
&/È868/$,±'2635$=26(35(d26
3UD]RGHHQWUHJDGRVPDWHULDLVHRXH[HFXomRGRVVHUYLoRVQmRVXSHULRUDGH]GLDVFRQWDGR
GRUHFHELPHQWRGD2UGHPGH)RUQHFLPHQWR6HUYLoR
$ SUHVHQWH $WD WHP YDOLGDGH GH XP DQR D SDUWLU GD GDWD GH VXD DVVLQDWXUD SRGHQGR VHU
SURUURJDGDjFULWpULRGD$GPLQLVWUDomR
2VSUHoRVUHJLVWUDGRVVHUmRIL[RVHLUUHDMXVWiYHLVGXUDQWHDYLJrQFLDGDSUHVHQWH$WDGH5HJLVWUR
GH3UHoRV
$V HPSUHVDV GHWHQWRUDV GR UHJLVWUR DVVXPHP R FRPSURPLVVR GH IRUQHFHU RV SURGXWRV
VROLFLWDGRV H H[HFXWDU RV VHUYLoRV QDV TXDQWLGDGHV GHILQLGDV QRV SHGLGRV D VHUHP
HPLWLGRV SHOR 0XQLFtSLR GH 9DOHQoD%$ SHORV SUHoRV UHJLVWUDGRV H QDV FRQGLo}HV
FRQVWDQWHVGRHGLWDOGXUDQWHRSUD]RGHYDOLGDGHGHVWD$WDGH5HJLVWURGH3UHoRV
'XUDQWHDYLJrQFLDGD$WDGH5HJLVWURGH3UHoRVDVHPSUHVDVGHWHQWRUDVGHYHUimRDFDGD
IDWXUDHPLWLGDFRPSURYDUVXDVUHJXODULGDGHVSHUDQWHR6LVWHPDGH6HJXULGDGH6RFLDO,166H
R)XQGRGH*DUDQWLDSRU7HPSRGH6HUYLoR)*76
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
82 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&/È868/$,,±'$&2175$7$d­2
$ FRQWUDWDomR FRP RV IRUQHFHGRUHV UHJLVWUDGRV VHUi IRUPDOL]DGD SHOR 0XQLFtSLR GH 9DOHQoD SRU
LQWHUPpGLR GH LQVWUXPHQWR FRQWUDWXDO HPLVVmR GH QRWD GH HPSHQKR GH GHVSHVD DXWRUL]DomR GH
FRPSUDRXRXWURLQVWUXPHQWRKiELOFRQIRUPHRDUWGD/HLQžGH
$ H[LVWrQFLD GH 3UHoRV 5HJLVWUDGRV QmR REULJD R 0XQLFtSLR D ILUPDU DV FRQWUDWDo}HV TXH HOHV
SRGHUmRDGYLU
1DKLSyWHVHGR)251(&('25SULPHLURFODVVLILFDGRWHUVHXUHJLVWURFDQFHODGRQmRDVVLQDUQmR
DFHLWDURXQmRUHWLUDURFRQWUDWRQRSUD]RHFRQGLo}HVHVWDEHOHFLGDVSRGHUmRVHUFRQYRFDGRVRV
IRUQHFHGRUHV UHPDQHVFHQWHV QD RUGHP GH FODVVLILFDomR SDUD ID]rOR HP LJXDO SUD]R H QDV
FRQGLo}HVSURSRVWDVSHORSULPHLURFODVVLILFDGRLQFOXVLYHTXDQWRDRSUHoRLQGHSHQGHQWHPHQWHGD
FRPLQDomRSUHYLVWDQR$UWLJRGD/HL
2EVHUYDGRVRVFULWpULRVHFRQGLo}HVHVWDEHOHFLGRVQRHGLWDOR0XQLFtSLRSRGHUiFRPSUDUGHPDLV
GHXPIRUQHFHGRUUHJLVWUDGRVHJXQGRDRUGHPGHFODVVLILFDomRGHVGHTXHDVUD]}HVGHLQWHUHVVH
S~EOLFR MXVWLILTXHP H TXH R SULPHLUR FODVVLILFDGR QmR SRVVXD IRUQHFLPHQWR FRPSDWtYHO FRP R
VROLFLWDGRSHOR0XQLFtSLRREVHUYDGRjVFRQGLo}HVGRHGLWDOHR3UHoR5HJLVWUDGR
$ILVFDOL]DomRVHUiH[HUFLGDSHOD6HFUHWDULDVROLFLWDQWH
&/È868/$,,,±'$(175(*$
$V HQWUHJDV HRX H[HFXomR GRV VHUYLoRV VHUmR HIHWXDGRV FRQIRUPH VROLFLWDomR GR 0XQLFtSLR
VHQGRTXHRSUD]RGHHQWUHJDH[HFXomRQmRVHUiVXSHULRUjGH]GLDVDSyVRUHFHELPHQWRGD
1RWDGH(PSHQKR
&DVRRVSURGXWRVQmRFRUUHVSRQGDPDRH[LJLGRSHORHGLWDORIRUQHFHGRUGHYHUiSURYLGHQFLDUQR
SUD]RPi[LPRGHDWpTXDUHQWDHRLWRKRUDVDVXDVXEVWLWXLomRYLVDQGRDRDWHQGLPHQWRGDV
HVSHFLILFDo}HVVHPSUHMXt]RGDLQFLGrQFLDGDVVDQo}HVSUHYLVWDVQRHGLWDOHQD/HL
&/È868/$,9±'$66$1d®(6
3HODLQH[HFXomRWRWDORXSDUFLDOGRREMHWRFRQWUDWDGRD$GPLQLVWUDomRSRGHUiJDUDQWLGDD
SUpYLDGHIHVDDSOLFDUj&2175$7$'$DVVHJXLQWHVVDQo}HV
DDGYHUWrQFLD
E PXOWD GH XP SRU FHQWR DR GLD VREUH R YDORU GR FRQWUDWR SRU GLD GH DWUDVR QD
H[HFXomRHRXIRUQHFLPHQWRDWpRžYLJpVLPRGLD
F PXOWD GH YLQWH SRU FHQWR VREUH R YDORU GR FRQWUDWR D SDUWLU GR ž YLJpVLPR
SULPHLUR GLD SHOR DWUDVR QR IRUQHFLPHQWR HRX H[HFXomR IDFXOWDGD D UHVFLVmR FRQWUDWXDO VHP
SUHMXt]RGDVGHPDLVSHQDOLGDGHVSUHYLVWDVQD/HLQž
GSHORVPRWLYRVTXHVHVHJXHPSULQFLSDOPHQWHD&2175$7$'$HVWDUiVXMHLWDjPXOWD
WUDWDGDQHVWD&OiXVXOD
ƒ SHODUHFXVDLQMXVWLILFDGDGHUHFHEHUD1RWDGH(PSHQKRHDVVLQDUR&RQWUDWR
ƒ SHORDWUDVRQDHQWUHJDGRIRUQHFLPHQWRHPUHODomRDRSUD]RSURSRVWRHDFHLWRH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
83 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
ƒ SHOD QmR HQWUHJD GR IRUQHFLPHQWR FDUDFWHUL]DQGRVH D IDOWD VH D HQWUHJD QmR VH
HIHWLYDUGHQWURGRVTXLQ]HGLDVTXHVHVHJXLUHPDRWpUPLQRGRSUD]RSURSRVWRHDFHLWR
H $ FULWpULR GD $GPLQLVWUDomR SRGHUmR VHU VXVSHQVDV DV SHQDOLGDGHV QR WRGR RX HP
SDUWH TXDQGR R DWUDVR GR IRUQHFLPHQWR GRV SURGXWRV IRU GHYLGDPHQWH MXVWLILFDGR SHOD
&2175$7$'$ H DFHLWR SHOD $GPLQLVWUDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD TXH IL[DUi QRYR
SUD]RHVWHLPSURUURJiYHOSDUDDFRPSOHWDH[HFXomRGDVREULJDo}HVDVVXPLGDV
&/È868/$9±'$5(6&,6­2&2175$78$/
$LQH[HFXomRWRWDORXSDUFLDOGHVWH&RQWUDWRHQVHMDDVXDUHVFLVmRFRQIRUPHGLVSRVWRQRVDUWLJRV
DGD/HL
&DVRD&RQWUDWDQWHQmRVHXWLOL]HGDSUHUURJDWLYDGHUHVFLQGLUD$WDGH5HJLVWURGH3UHoRVDVHX
H[FOXVLYR FULWpULR SRGHUi VXVSHQGHU D VXD H[HFXomR HRX VXVWDU R SDJDPHQWR GDV )DWXUDV DWp
TXH D &RQWUDWDGD FXPSUD LQWHJUDOPHQWH D FRQGLomR FRQWUDWXDO LQIULQJLGD VHP SUHMXt]R GD
LQFLGrQFLDGDVVDQo}HVSUHYLVWDVQRHGLWDOHQD/HL
$UHVFLVmRSRGHUiVHU8QLODWHUDO$PLJiYHORX-XGLFLDOQRVWHUPRVHFRQGLo}HVSUHYLVWDVQR$UWLJR
GD/HL
&/È868/$9,±'2&$1&(/$0(172'25(*,6752'(35(d26
25HJLVWURGH3UHoRVGRIRUQHFHGRUSRGHUiVHUFDQFHODGRJDUDQWLGDSUpYLDGHIHVDQRSUD]RGH
FLQFRGLDV~WHLVDFRQWDUGRUHFHELPHQWRGDQRWLILFDomRQDVVHJXLQWHVKLSyWHVHV
,±3HOR0XQLFtSLR
D2IRUQHFHGRUQmRFXPSULUDVH[LJrQFLDVFRQWLGDVQR(GLWDORX$WDGH5HJLVWURGH3UHoRV
E 2 IRUQHFHGRU GHU FDXVD j UHVFLVmR DGPLQLVWUDWLYD GH FRQWUDWR GHFRUUHQWH GR 5HJLVWUR GH
3UHoRVSRUXPGRVPRWLYRVHOHQFDGRVQR$UWLJRGD/HLQž
F2V3UHoRV5HJLVWUDGRVVHDSUHVHQWDUHPVXSHULRUHVDRVSUDWLFDGRVQRPHUFDGR
G3RUUD]}HVGHLQWHUHVVHS~EOLFRGHYLGDPHQWHIXQGDPHQWDGRQDIRUPDGR,QFLVR;,,GR$UWLJR
GD/HLQžHDOWHUDo}HVSRVWHULRUHV
,,±3HOR)RUQHFHGRUTXDQGRPHGLDQWHVROLFLWDomRSRUHVFULWRFRPSURYDUHVWDULPSRVVLELOLWDGRGH
FXPSULUDVH[LJrQFLDVGRLQVWUXPHQWRFRQYRFDWyULRTXHGHXRULJHPDR5HJLVWURGH3UHoRV
2 FDQFHODPHQWR VHUi SUHFHGLGR GH 3URFHVVR $GPLQLVWUDWLYR D VHU H[DPLQDGR SHOR 0XQLFtSLR
VHQGRTXHDGHFLVmRILQDOGHYHUiVHUIXQGDPHQWDGD
$ VROLFLWDomR GR )251(&('25 SDUD FDQFHODPHQWR GR 5HJLVWUR GH 3UHoRV QmR GHVREULJD GR
IRUQHFLPHQWR GRV SURGXWRV DWp D GHFLVmR GR 0XQLFtSLR D TXDO GHYHUi VHU SURODWDGD QR SUD]R
Pi[LPRGHWULQWDGLDV
&/È868/$9,,±'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
84 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
8QLGDGH±)XQGR0XQLFLSDOGH(GXFDomR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± )XQFLRQDPHQWR GD 5HGH GH (GXFDomR %iVLFD ± (QVLQR GH -RYHQV H
$GXOWRV
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD,QIUDHVWUXWXUDH8UEDQLVPR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR'HVHQYROYLPHQWRH3ODQHMDPHQWR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD,QG~VWULD&RPpUFLRH6HUYLoR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH6D~GH
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD$GPLQLVWUDomR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR0HLR$PELHQWH
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULDGD)D]HQGD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULDGD&XOWXUD(VSRUWHH/D]HU
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
85 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR'HSDUWDPHQWRGH
&XOWXUD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH$VVLVWrQFLD6RFLDO
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGR)XQGR
2EMHWR$WLYLGDGH±6HUYLoRVGH3URWHomR6RFLDO%iVLFDj)DPtOLD
2EMHWR$WLYLGDGH ± 6HUYLoRV GH 3URWHomR H $WHQGLPHQWR (VSHFLDOL]DGR D )DPtOLDV H
,QGLYtGXRVFRP'LUHLWRV9LRODGRV
2EMHWR$WLYLGDGH±6HUYLoR6RFLRHGXFDWLYRHGH&RQYLYrQFLDSDUD(UUDGLFDomRGR7UDEDOKR
,QIDQWLO
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR%ROVD)DPtOLD
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR68$6
)RQWH
8QLGDGH±*DELQHWHGD3UHIHLWD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGR*DELQHWH
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR7XULVPR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD(VSHFLDOGD3HVFD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGD6HFUHWDULD
)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
&/È868/$9,,,±'2)252
)LFD HOHLWR R IRUR GD &RPDUFD GH 9DOHQoD%$ SDUD GLULPLU G~YLGDV H TXHVW}HV RULXQGDV GD
SUHVHQWH $WD GH 5HJLVWUR GH 3UHoRV FRP H[FOXVmR GH TXDOTXHU RXWUR SRU PDLV SULYLOHJLDGR TXH
VHMD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
&13-1ž[[[[[[[[[[[[[[
(QGHUHoR[[[[[[[[[[[[[[
5HSUHVHQWDQWH[[[[[[[[[[[[[[[[
5*[[[[[[[
&3)[[[[[[[[[[[
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
86 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
&13-1ž[[[[[[[[[[[[[[
(QGHUHoR[[[[[[[[[[[[[[
5HSUHVHQWDQWH[[[[[[[[[[[[[[[[
5*[[[[[[[
&3)[[[[[[[[[[[
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
87 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,;
0,187$&2175$721ž;;;;;;;;;;;;
&2175$72 3$5$ )251(&,0(172 3$5&(/$'2 '( 352'8726 28
(;(&8d­2 '( 6(59,d26 48( (175( 6, &(/(%5$0 $ 35()(,785$
081,&,3$/
'(
9$/(1d$
(
$
$35()(,785$081,&,3$/'(9$/(1d$FRPVHGHHIRURHP9DOHQoD%DKLDLQVFULWD
QR&13-VRERQžQHVWHDWRUHSUHVHQWDGDSRUVXD3UHIHLWD-8&e/,$6286$
'2 1$6&,0(172 EUDVLOHLUD FDVDGD SRUWDGRU GD FDUWHLUD GH LGHQWLGDGH Qž 663%$H&3)QžUHVLGHQWHHGRPLFLOLDGRQD5XD&LGDGHGR5LRGH-DQHLURQž
/RWHDPHQWR 1RYR +RUL]RQWH 9DOHQoD%DKLD QR XVR GH VXDV DWULEXLo}HV FRPR 3UHIHLWD H D
HPSUHVD
HVWDEHOHFLGD
D
&13- QžUHVROYHP FHOHEUDU R
SUHVHQWH &RQWUDWR VXMHLWDQGRVH DV SDUWHV jV QRUPDV SUHYLVWDV QD /HL H DOWHUDo}HV
SRVWHULRUHV GH DFRUGR FRP R TXH FRQVWD QD 3UHJmR 3UHVHQFLDO Qž PHGLDQWH DV
&OiXVXODVHRX&RQGLo}HVVHJXLQWHV
&/È868/$35,0(,5$'22%-(72
2 SUHVHQWH FRQWUDWR WHP SRU REMHWR D FRQWUDWDomR GH HPSUHVD GR UDPR SDUD
IRUQHFLPHQWRGH )251(&,0(172'(0$7(5,$/3$5$7(/()21,$(&$%($0(172
(6758785$'2 TXH VH GHVWLQDUmR jV GLYHUVDV 6HFUHWDULDV GR 0XQLFtSLR GH DFRUGR DV
FRQGLo}HV H HVSHFLILFDo}HV FRQVWDQWHV QR 7HUPR GH 5HIHUrQFLD H GHPDLV GLVSRVLo}HV IL[DGDV
QHVWH(GLWDOHVHXV$QH[RV
68%&/È868/$Ò1,&$±9LQFXODPVHDRSUHVHQWHFRQWUDWRR3UHJmR3UHVHQFLDOQž
$WD GH 5HJLVWUR GH 3UHoRV EHP FRPR D SURSRVWD GD FRQWUDWDGD DPERV FRP VHXV $QH[RV H
GHPDLV GRFXPHQWRV RV TXDLV VH FRQVWLWXHP HP SDUWHV LQWHJUDQWHV GHVWH LQVWUXPHQWR
LQGHSHQGHQWHPHQWHGHWUDQVFULomR
&/È868/$6(*81'$'25(*,0('((;(&8d­2
2REMHWRGHVWHFRQWUDWRVHUiUHDOL]DGRSRUH[HFXomRLQGLUHWDVRERUHJLPHGHPHQRUSUHoR
JOREDOSRUORWH
&/È868/$7(5&(,5$'2$80(172286835(66­2
1RLQWHUHVVHGD$GPLQLVWUDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDRREMHWRGHVWH&RQWUDWR
SRGHUi VHU DXPHQWDGR RX VXSULPLGR DWp R OLPLWH GH YLQWH H FLQFR SRU FHQWR FRQIRUPH
GLVSRVWRQRDUWLJRSDUiJUDIRVžHžGD/HLQž
68%&/È868/$ 35,0(,5$ $ &2175$7$'$ REULJDVH D DFHLWDU QDV PHVPDV
FRQGLo}HV OLFLWDGDV RV DFUpVFLPRV RX VXSUHVV}HV TXH VH IL]HUHP GH DWp YLQWH H FLQFR SRU
FHQWRGRYDORUFRQVWDQWHGDSURSRVWDGHYLGDPHQWHDWXDOL]DGDGHFRQIRUPLGDGHFRPRGLVSRVWRQD
&OiXVXOD'pFLPD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
88 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
68%&/È868/$6(*81'$QHQKXPDFUpVFLPRRXVXSUHVVmRSRGHUiH[FHGHURVOLPLWHV
HVWDEHOHFLGRVQRSDUiJUDIRDQWHULRUVDOYRVHDVVXSUHVV}HVUHVXOWDUHPGHDFRUGRFHOHEUDGRHQWUH
RVFRQWUDWDQWHVFRQIRUPH$UWSDUiJUDIRžLQFLVR,,GD/HL
68%&/È868/$ 7(5&(,5$ DV HYHQWXDLV PRGLILFDo}HV GRV WHUPRV GHVWH &RQWUDWR
SRGHUmR VHU DOWHUDGRVFRP DV GHYLGDV MXVWLILFDWLYDV QRVFDVRV UHIHULGRV QR $UWLJR GD /HLQž
PHGLDQWH7HUPR$GLWLYR
&/È868/$48$57$'$62%5,*$d®(6'2&2175$7$17(
'XUDQWHDYLJrQFLDGHVWH&RQWUDWRR&2175$7$17(GHYHUi
DDFRPSDQKDUILVFDOL]DUHFRQIHULURVSURGXWRVVHUYLoRVRUDFRQWUDWDGRV
E HIHWXDU R SDJDPHQWR SHORV SURGXWRVVHUYLoRV GH DFRUGR FRP R HVWDEHOHFLGR QD
&OiXVXOD1RQDH
FUHMHLWDUQRWRGRRXHPSDUWHVRIRUQHFLPHQWRH[HFXomRHPGHVDFRUGRFRPRFRQWUDWR
&/È868/$48,17$'$62%5,*$d®(6'$&2175$7$'$
&DEHUi j &RQWUDWDGD HQTXDQWR YLJRUDU HVWH &RQWUDWR DOpP GDV REULJDo}HV GR 7HUPR GH
5HIHUrQFLDDVGHPDLVTXHVHVHJXHP
DUHDOL]DURIRUQHFLPHQWRRXH[HFXomRGRVHUYLoRDRUHVSRQViYHOGR6HWRUGD3UHIHLWXUD
0XQLFLSDOGHVWH0XQLFtSLRVHJXLQGRFURQRJUDPDGHHQWUHJD
E DSUHVHQWDU DQWHV GR IDWXUDPHQWR TXDGUR GHPRQVWUDWLYR GRV IRUQHFLPHQWRV SDUD
FRQIURQWRGHLQIRUPDo}HV
FFRPXQLFDUGHLPHGLDWRHSRUHVFULWRj&RQWUDWDQWHTXDOTXHUWLSRGHLUUHJXODULGDGHTXH
RFRUUDGXUDQWHDYLJrQFLDGHVWH&RQWUDWR
G IRUQHFHU DR &RQWUDWDQWH GH IRUPD UHJXODU H QDV TXDQWLGDGHV UHTXLVLWDGDV RV
SURGXWRVVHUYLoRVOLFLWDGRV
H DUFDU FRP RV {QXV UHIHUHQWHV DR IRUQHFLPHQWR RUD FRQWUDWDGR GHVGH R SDJDPHQWR GH
HQFDUJRVWUDEDOKLVWDVFRPHUFLDLVILVFDLVHSUHYLGHQFLiULRVQmRWUDQVIHULQGRSDUDD&RQWUDWDQWHD
UHVSRQVDELOLGDGHSRUVHXSDJDPHQWRQHPRQHUDURREMHWRGRFRQWUDWR
I UHVSRQGHU SHORV GDQRV FDXVDGRV GLUHWDPHQWH j $GPLQLVWUDomR RX D WHUFHLURV
GHFRUUHQWHVGHVXDFXOSDRXGRORQmRLQFOXLQGRRXUHGX]LQGRHVVDUHVSRQVDELOLGDGHjILVFDOL]DomR
RXDRDFRPSDQKDPHQWRSHOR&2175$7$17(
J SURYLGHQFLDU D LPHGLDWD FRUUHomR GDV GHILFLrQFLDV DSRQWDGDV SHOR &2175$7$17(
TXDQWRDRIRUQHFLPHQWRGRREMHWRFRQWUDWDGR
K SUHVWDU WRGRV RV HVFODUHFLPHQWRV TXH IRUHP VROLFLWDGRV SHOD ILVFDOL]DomR GR
&2175$7$17(FXMDVUHFODPDo}HVVHREULJDDDWHQGHUSURQWDPHQWH
LPDQWHUGXUDQWHDH[HFXomRGRFRQWUDWRHPFRPSDWLELOLGDGHFRPDVREULJDo}HVSRUHOH
DVVXPLGDVWRGDVDVFRQGLo}HVGHKDELOLWDomRHTXDOLILFDomRH[LJLGDVQDOLFLWDomR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
89 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
MUHSDUDUFRUULJLUUHPRYHURXVXEVWLWXLUjVVXDVH[SHQVDVQRWRWDORXHPSDUWHRREMHWR
GR FRQWUDWR HP TXH VH YHULILFDUHP YtFLRV GHIHLWRV RX LQFRUUHo}HV UHVXOWDQWHV GRV SURGXWRV
HPSUHJDGRV
&/È868/$6(;7$'2$03$52/(*$/
$ ODYUDWXUD GR SUHVHQWH &RQWUDWR GHFRUUH GR 3UHJmR 3UHVHQFLDO Qž UHDOL]DGD
FRPIXQGDPHQWRQRV'HFUHWRV0XQLFLSDLVQžHD/HLQž
&/È868/$6e7,0$'29$/25
2YDORUGRSUHVHQWH&RQWUDWRpHVWLPDGRHP5DVHUSDJRFRQIRUPH
HQWUHJDGRVSURGXWRV
&/È868/$2,7$9$'25($-867(
2YDORUHVWLSXODGRQDSURSRVWDLQLFLDOSRGHUiVHUUHDMXVWDGRHPFRQIRUPLGDGHFRPR$UW
LQFLVR,,DOtQHD³G´GD/HLQž
&/È868/$121$'23$*$0(172
2SDJDPHQWRVHUiHIHWXDGRHPPRHGDFRUUHQWHQDFLRQDOGHIRUPDSDUFHODGDGHDFRUGR
FRP D TXDQWLGDGH GR SURGXWR HQWUHJXH HRX VHUYLoR H[HFXWDGR PHGLDQWH HPLVVmR GH RUGHP
EDQFiULD HP IDYRU GD &2175$7$'$ HP DWp WULQWD GLDV DSyV D DSUHVHQWDomR GD 1RWD
)LVFDO)DWXUDDFRPSDQKDGDGDVUHTXLVLo}HVHPLWLGDVQDIRUPDGR(GLWDOGH3UHJmR3UHVHQFLDOQž
GHYLGDPHQWHDWHVWDGDSRUVHUYLGRUGD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
±+DYHQGRHUURQD1RWD)LVFDO)DWXUDRXFLUFXQVWkQFLDTXHDOLTXLGDomRGDGHVSHVDDTXHOD
VHUi GHYROYLGD H R SDJDPHQWR ILFDUi SHQGHQWH DWp TXH D &RQWUDWDGD SURYLGHQFLH DV PHGLGDV
VDQHDGRUDV 1HVWD KLSyWHVH R SUD]R SDUD R SDJDPHQWR LQLFLDUVHi DSyV D UHJXODUL]DomR GD
VLWXDomR HRX UHDSUHVHQWDomR GR GRFXPHQWR ILVFDO QmR DFDUUHWDQGR TXDOTXHU {QXV SDUD R
&RQWUDWDQWH
±2SDJDPHQWRGDVIDWXUDVTXDQGRKRXYHUUHDMXVWDPHQWRIDUVHiSRUPHLRGHGXDVIDWXUDV
XPD FRUUHVSRQGHQWH j SUySULD IDWXUD H RXWUD VXSOHPHQWDU UHIHUHQWH DR YDORU GR UHDMXVWDPHQWR
GHYLGRSRGHQGRDPEDVDVIDWXUDVWUDPLWDUFRQMXQWDPHQWHDFULWpULRGD&RQWUDWDQWH
&/È868/$'e&,0$'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±)XQGR0XQLFLSDOGH(GXFDomR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
2EMHWR$WLYLGDGH ± )XQFLRQDPHQWR GD 5HGH GH (GXFDomR %iVLFD ± (QVLQR GH -RYHQV H
$GXOWRV
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD,QIUDHVWUXWXUDH8UEDQLVPR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
90 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR'HVHQYROYLPHQWRH3ODQHMDPHQWR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD,QG~VWULD&RPpUFLRH6HUYLoR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH6D~GH
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR)XQGR
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGD$GPLQLVWUDomR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR0HLR$PELHQWH
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULDGD)D]HQGD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULDGD&XOWXUD(VSRUWHH/D]HU
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRVGR'HSDUWDPHQWRGH
&XOWXUD
)RQWH
8QLGDGH±)XQGR0XQLFLSDOGH$VVLVWrQFLD6RFLDO
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGR)XQGR
2EMHWR$WLYLGDGH±6HUYLoRVGH3URWHomR6RFLDO%iVLFDj)DPtOLD
2EMHWR$WLYLGDGH ± 6HUYLoRV GH 3URWHomR H $WHQGLPHQWR (VSHFLDOL]DGR D )DPtOLDV H
,QGLYtGXRVFRP'LUHLWRV9LRODGRV
2EMHWR$WLYLGDGH±6HUYLoR6RFLRHGXFDWLYRHGH&RQYLYrQFLDSDUD(UUDGLFDomRGR7UDEDOKR
,QIDQWLO
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
91 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR%ROVD)DPtOLD
2EMHWR$WLYLGDGH±*HVWmR'HVFHQWUDOL]DGDGR68$6
)RQWH
8QLGDGH±*DELQHWHGD3UHIHLWD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGR*DELQHWH
)RQWH
8QLGDGH±6HFUHWDULD0XQLFLSDOGR7XULVPR
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGD6HFUHWDULD
)RQWH
8QLGDGH±6HFUHWDULD(VSHFLDOGD3HVFD
&ODVVLILFDomR(FRQ{PLFD±0DWHULDOGH&RQVXPR
&ODVVLILFDomR(FRQ{PLFD±(TXLSDPHQWRVH0DWHULDLV3HUPDQHQWHV
2EMHWR$WLYLGDGH±0DQXWHQomRGH6HUYLoRV7pFQLFRVH$GPLQLVWUDWLYRGD6HFUHWDULD
)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
&/È868/$'e&,0$35,0(,5$'$9,*Ç1&,$('$9$/,'$'(
$YLJrQFLDGHVWHFRQWUDWRVHUiDWpDFRQWDUGDGDWDGHDVVLQDWXUDGR
&RQWUDWRSRGHQGRVHUSURUURJDGRDFULWpULRGD$GPLQLVWUDomR
&/È868/$'e&,0$6(*81'$'$66$1d®(6
3HODLQH[HFXomRWRWDORXSDUFLDOGRREMHWRFRQWUDWDGRD$GPLQLVWUDomRSRGHUiJDUDQWLGDD
SUpYLDGHIHVDDSOLFDUj&2175$7$'$DVVHJXLQWHVVDQo}HV
DDGYHUWrQFLD
E PXOWD GH XP SRU FHQWR DR GLD VREUH R YDORU GR FRQWUDWR SRU GLD GH DWUDVR QD
H[HFXomRHRXIRUQHFLPHQWRDWpRžYLJpVLPRGLD
F PXOWD GH YLQWH SRU FHQWR VREUH R YDORU GR FRQWUDWR D SDUWLU GR ž YLJpVLPR
SULPHLUR GLD SHOR DWUDVR QR IRUQHFLPHQWR HRX H[HFXomR IDFXOWDGD D UHVFLVmR FRQWUDWXDO VHP
SUHMXt]RGDVGHPDLVSHQDOLGDGHVSUHYLVWDVQD/HLQž
GSHORVPRWLYRVTXHVHVHJXHPSULQFLSDOPHQWHD&2175$7$'$HVWDUiVXMHLWDjPXOWD
WUDWDGDQHVWD&OiXVXOD
ƒ SHODUHFXVDLQMXVWLILFDGDGHUHFHEHUD1RWDGH(PSHQKRHDVVLQDUR&RQWUDWR
ƒ SHORDWUDVRQDHQWUHJDGRIRUQHFLPHQWRHPUHODomRDRSUD]RSURSRVWRHDFHLWRH
ƒ SHOD QmR HQWUHJD GR IRUQHFLPHQWR FDUDFWHUL]DQGRVH D IDOWD VH D HQWUHJD QmR VH
HIHWLYDUGHQWURGRVTXLQ]HGLDVTXHVHVHJXLUHPDRWpUPLQRGRSUD]RSURSRVWRHDFHLWR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
92 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
H $ FULWpULR GD $GPLQLVWUDomR SRGHUmR VHU VXVSHQVDV DV SHQDOLGDGHV QR WRGR RX HP
SDUWHTXDQGRRDWUDVRGRIRUQHFLPHQWRGRVSURGXWRVIRUGHYLGDPHQWHMXVWLILFDGR
SHOD &2175$7$'$ H DFHLWR SHOD $GPLQLVWUDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD TXH IL[DUi
QRYRSUD]RHVWHLPSURUURJiYHOSDUDDFRPSOHWDH[HFXomRGDVREULJDo}HVDVVXPLGDV
&/È868/$'e&,0$7(5&(,5$'$5(6&,6­2
$LQH[HFXomRWRWDORXSDUFLDOGHVWH&RQWUDWRHQVHMDDVXDUHVFLVmRFRQIRUPHGLVSRVWRQRV
DUWLJRVDGD/HL
68%&/È868/$ 35,0(,5$ RV FDVRV GH UHVFLVmR FRQWUDWXDO VHUmR IRUPDOPHQWH
PRWLYDGRVQRVDXWRVGRSURFHVVRDVVHJXUDGRRFRQWUDGLWyULRHDDPSODGHIHVD
68%&/È868/$6(*81'$$UHVFLVmRGHVWH&RQWUDWRSRGHUiVHU
D GHWHUPLQDGD SRU DWR XQLODWHUDO H HVFULWR GD $GPLQLVWUDomR QRV FDVRV HQXPHUDGRV QRV
LQFLVRV , D ;,, H ;9,, GR DUWLJR GD /HL PHQFLRQDGD QRWLILFDQGRVH D &2175$7$'$ FRP D
DQWHFHGrQFLDPtQLPDGHWULQWDGLDVRX
E DPLJiYHO SRU DFRUGR HQWUH DV SDUWHV GHVGH TXH KDMD FRQYHQLrQFLD SDUD D
$GPLQLVWUDomRRX
FMXGLFLDOQRVWHUPRVGDOHJLVODomRYLJHQWHVREUHDPDWpULD
68%&/È868/$ 7(5&(,5$ D UHVFLVmR DGPLQLVWUDWLYD RX DPLJiYHO VHUi SUHFHGLGD GH
DXWRUL]DomRHVFULWDHIXQGDPHQWDGDGDDXWRULGDGHFRPSHWHQWH
&/È868/$'e&,0$48$57$±'235$=2(/2&$/'((175(*$'$0(5&$'25,$
)LFDHVWDEHOHFLGRTXHRSUD]RGHHQWUHJDGDPHUFDGRULDQmRVHUiVXSHULRUjGH]GLDV
FRQWDGR GR UHFHELPHQWR GD 2UGHP GH )RUQHFLPHQWR6HUYLoR H TXH R ORFDO GH HQWUHJD GRV
SURGXWRVRXH[HFXomRGRVVHUYLoRVVHUiQDVHGHGRPXQLFtSLR
&/È868/$'e&,0$48,17$'2)252
)LFD HOHLWR R )RUR GD &RPDUFD GH 9DOHQoD QR (VWDGR GD %DKLD SDUD GLULPLU TXDLVTXHU
G~YLGDVVXVFLWDGDVQDH[HFXomRGRSUHVHQWH&RQWUDWR
( SDUD YDOLGDGH GR TXH SHODV SDUWHV ILFRX DFHUWDGR ILUPDVH R SUHVHQWH LQVWUXPHQWR HP
WUrV YLDV GH LJXDO WHRU H IRUPD SDUD XP Vy HIHLWR GHSRLV GH OLGR H DFKDGR FRQIRUPH QD
SUHVHQoDGHGXDVWHVWHPXQKDVTXHRVXEVFUHYHPYDLSHODVSDUWHVDVVLQDGR
9DOHQoDGHGH
&RQWUDWDQWH
&2175$7$'$
BBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBB
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
93 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
(',7$/'(/,&,7$d­2
35(*­235(6(1&,$/1ž
2081,&,3,2'(9$/(1d$(67$'2'$%$+,$SRULQWHUPpGLRGD3UHIHLWXUD0XQLFLSDO
GH 9DOHQoD DWUDYpV GR 35(*2(,52 2),&,$/ H (TXLSH GH $SRLR GHVLJQDGR SHOD 3RUWDULD
GH GH MDQHLUR GH WRUQD S~EOLFR SDUD FRQKHFLPHQWR GRV LQWHUHVVDGRV TXH
IDUi UHDOL]DU SURFHGLPHQWR OLFLWDWyULR QD PRGDOLGDGH ³35(*­2 35(6(1&,$/´ 7LSR 0(125
35(d2325,7(0SHOR6,67(0$'(5(*,6752'(35(d26QRGLDGHMXOKRGH
jV KRUDV FRQIRUPH GHVFULWR QHVWH (GLWDO H VHXV DQH[RV GH FRQIRUPLGDGH FRP DV /HLV
)HGHUDLVQƒ'HFUHWRV0XQLFLSDLVQžHOHJLVODomR
YLJHQWH
2V HQYHORSHV FRQWHQGR D SURSRVWD GH SUHoR H RV GRFXPHQWRV GH KDELOLWDomR GHYHUmR VHU
HQWUHJXHV DR SUHJRHLUR jV KRUDV GR GLD VHWRU GH OLFLWDomR QD VHGH GHVWD
3UHIHLWXUD 6,78$'$ 3529,625,$0(17( $ 58$ &(&,/,$ 0(,5(/(6 1ž &(1752
9$/(1d$%$+,$$QWLJR&ROpJLR3DXOR)UHLUH
2VLQWHUHVVDGRVHPFRQKHFHUDtQWHJUDGRHGLWDOHVWHHVWDUiGLVSRQtYHOQRVLWLRHOHWU{QLFR
GD3UHIHLWXUD0XQLFLSDOZZZYDOHQFDEDLRRUJEUHFDVRRLQWHUHVVDGRTXHLUDRHGLWDOLPSUHVVR
HVWH GHYHUi VH GLULJLU D 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD ORFDOL]DGD D 5XD 0DUHFKDO )ORULDQR
3HL[RWR Qž FHQWUR 9DOHQoD%DKLD PHGLDQWH SDJDPHQWR QR YDORU QmR UHHPEROViYHO 5
FLQTXHQWDUHDLVUHIHUHQWHDRVFXVWRVFRQIRUPHDUWLJR†žGD/HLQž
'22%-(72'$/,&,7$d­2
2SUHVHQWH3UHJmRWHPSRUREMHWRR5(*,6752'(35(d26SDUDHYHQWXDOFRQWUDWDomRGH
HPSUHVD HVSHFLDOL]DGD SDUD IRUQHFLPHQWR GH *Ç1(526 $/,0(17Ë&,26 TXH VH GHVWLQDUmR D
PHUHQGDHVFRODUGDUHGHPXQLFLSDOGHHQVLQRFRQIRUPHHVSHFLILFDo}HVFRQVWDQWHVQRDQH[R,
TXHLQWHJUDHVWH(GLWDO
2VSURGXWRVGHYHUmRVHUHQWUHJXHVSHORIRUQHFHGRUQDVHGHGRPXQLFtSLRQRGHSyVLWRGD
6HFUHWDULDGH(GXFDomRHQRVGHSyVLWRVGDVXQLGDGHVGD6HFUHWDULDGH(GXFDomRQRVGLVWULWRV
GR PXQLFtSLR *XDLELP (QWURQFDPHQWR 6HUUD *UDQGH 2UREy %DL[mR 0DULFRDER -HTXLULoi
*HUHEDH%RPILP
2IRUQHFLPHQWRVHUiHIHWXDGRGDVHJXLQWHIRUPD
D3URGXWRVQmRSHUHFtYHLVSHULRGLFDPHQWHR0XQLFtSLRVROLFLWDUiDVTXDQWLGDGHVQHFHVVLWDGDV
GHYHQGRROLFLWDQWHYHQFHGRUSURYLGHQFLDUDHQWUHJDQRSUD]RPi[LPRGHDWpTXDUHQWDHRLWR
KRUDVLQGHSHQGHQWHPHQWHGDTXDQWLGDGHVROLFLWDGD
E 3URGXWRV KRUWLIUXWL ± SHULRGLFDPHQWH R PXQLFtSLR VROLFLWDUi DV TXDQWLGDGHV QHFHVVLWDGDV
GHYHQGRROLFLWDQWHYHQFHGRUSURYLGHQFLDUDHQWUHJDQRSUD]RPi[LPRGHDWpTXDUHQWDHRLWR
KRUDVLQGHSHQGHQWHPHQWHGDTXDQWLGDGHVROLFLWDGD
352'8726(672&È9(,6
2V SURGXWRV TXH SRVVXHP HVWDELOLGDGH TXDQGR HVWRFDGRV j WHPSHUDWXUD DPELHQWH GHYHP
DSUHVHQWDUVH FRP HPEDODJHQV tQWHJUDV DSURSULDGDV SDUD FDGD WLSR FRP SUD]R GH YDOLGDGH
GLVWDQWHGRYHQFLPHQWRHWRGRVFRQWHQGRUyWXORGHLGHQWLILFDomRHHVSHFLILFDomRFRUUHWDV
2V FHUHDLV IDULQiFHRV H OHJXPLQRVDV QmR GHYHP DSUHVHQWDU YHVWtJLRV GH LQVHWRV XPLGDGH
H[FHVVLYDHREMHWRVHVWUDQKRVDVODWDVQmRSRGHPHVWDUHQIHUUXMDGDVHVWXIDGDVRXDPDVVDGDV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
94 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
HRVYLGURVRXJDUUDIDVQmRGHYHPDSUHVHQWDUYD]DPHQWRVQDVWDPSDVIRUPDomRGHHVSXPDV
RXTXDOTXHURXWURVLQDOGHDOWHUDomRGRVSURGXWRV
2V SURGXWRV DGTXLULGRV TXH DSUHVHQWDUHP PRGLILFDo}HV RUJDQROpSWLFDV FRU FKHLUR WH[WXUD
VDERUHODUYDVRXSUDJDVPHVPRHVWDQGRQRSUD]RGHYDOLGDGHGHYHUmRVHUWURFDGRVGHQWUR
GRSHUtRGRGHKFRQIRUPHVROLFLWDomRGD1XWULFLRQLVWDRXGRDOPR[DULIDGR
1RFDVRGHSURGXWRVSHUHFtYHLVRIRUQHFHGRUGHYHUiWHUHVWUXWXUDSDUDDUPD]HQDURVSURGXWRV
FDVR FRQWUiULR D FDGD GLD GH DWUDVR VHUi DSOLFDGR XPD PXOWD GH VREUH R YDORU WRWDO GD
FRPSUDGRSURGXWRDTXDOVHUiDSOLFDGDQRDWRGRSDJDPHQWR
2V OLFLWDQWHV GHYHUmR DSUHVHQWDU $02675$6 GRV SURGXWRV OLFLWDGRV TXH GHYHUmR VHU
DSUHVHQWDGDV QR GHSyVLWR GD 6HFUHWDULD 0XQLFLSDO GH (GXFDomR VLWR j 5XD &RPHQGDGRU
0DGXUHLUDQžFHQWURQHVWDFLGDGHDWpGRLVGLDVDQWHVGDVHVVmRS~EOLFDGHDEHUWXUDH
DSUHFLDomRGRVHQYHORSHVUHIHUHQWHVDHVWHFHUWDPH$VDPRVWUDVGHYHUmRYLUDFRPSDQKDGDVGH
OLVWDFRPDVPDUFDVGRVSURGXWRV
$V DPRVWUDV HQWUHJXHV VHUmR VXEPHWLGDV j DQiOLVH SRU SDUWH GH HTXLSH FRP TXDOLILFDomR
WpFQLFDDGHTXDGDGHVLJQDGDQRkPELWRGD6HFUHWDULD0XQLFLSDOGH(GXFDomRDTXHPFDEHUiD
HODERUDomR GH ODXGR DFHUFD GD DFHLWDELOLGDGH GDV DPRVWUDV TXDQWR DR REMHWR GD OLFLWDomR GH
DFRUGRFRPDVHVSHFLILFDo}HVFRQVWDQWHVGHVWHHGLWDO
1D KLSyWHVH GH LQDFHLWDomR GH DPRVWUDV DQDOLVDGDV D OLFLWDQWH GHYHUi DSUHVHQWDU QR
SUD]RGHKYLQWHHTXDWURKRUDVQRYDVDPRVWUDVVXEVWLWXWLYD
1mR KDYHQGR DSUHVHQWDomR GDV DPRVWUDV QR SUD]R H QD IRUPD SUHYLVWRV QRV VXELWHQV
DQWHULRUHV RX MXOJDGDV LQDFHLWiYHLV DV DPRVWUDV HQFDPLQKDGDV R OLFLWDQWH QmR UHFHEHUi
GHFODUDomRGHDFHLWDomRGDVDPRVWUDV
2VSURGXWRVDSUHVHQWDGRVFRPR$02675$6$&(,7$6SDUDHVWHFHUWDPHGHYHUmRVHURV
PHVPRVDSUHVHQWDGRVQDSURSRVWDGHSUHoRVPDUFDXQLGDGHTXDQWLGDGHHWF
$ “declaração de aceitação das amostras” GHYHUi VHU HQWUHJXH SRU XP UHSUHVHQWDQWH GD
6HFUHWDULDGH(GXFDomRDRUHSUHVHQWDQWHGDHPSUHVDOLFLWDQWHHHVWD³declaração de aceitação
das amostras´ GHYHUi LQWHJUDU R (QYHORSH ± 3URSRVWD GH 3UHoRV SDUD FRQIURQWDomR GDV
DPRVWUDVDSUHVHQWDGDVHDFHLWDVSHOD6HFUHWDULDGH(GXFDomRFRPDVRIHUWDGDVQDSURSRVWDGH
SUHoRVVRESHQDGHGHVFODVVLILFDomRGDSURSRVWD
$VDPRVWUDVVHUmRH[LJLGDVDSHQDVSDUDRV/RWHVH
REGISTRO DE PREÇOS
Lei Federal n° 8.666/93
"Art.15 inciso V parágrafo 4º - A existência de preços registrados não obriga a
Administração a firmar as contratações que deles poderão advir, ficando-lhe
facultada a utilização de outros meios, respeitada a legislação relativa as
licitações, sendo assegurado ao beneficiário do registro preferência em
igualdade de condições."
'$6&21',d®(6'(3$57,&,3$d­2
3RGHUmRSDUWLFLSDUGHVWH3UHJmRRVLQWHUHVVDGRVGRUDPRGHDWLYLGDGHSHUWLQHQWHDRREMHWR
GDFRQWUDWDomRTXHDWHQGHUHPDWRGDVDVH[LJrQFLDVFRQVWDQWHVGHVWH(GLWDOHVHXV$QH[RV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
95 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
1mR SRGHUmR SDUWLFLSDU GD SUHVHQWH OLFLWDomR RV LQWHUHVVDGRV TXH VH HQTXDGUHP QDV
VHJXLQWHVKLSyWHVHVDVHJXLUHOHQFDGDV
7HQKDPVLGRGHFODUDGRVLQLG{QHRVSDUDOLFLWDURXFRQWUDWDUFRPD$GPLQLVWUDomR3~EOLFD
HQTXDQWR SHUGXUDUHP RV PRWLYRV GHWHUPLQDQWHV GD SXQLomR RX DWp TXH VHMD SURPRYLGD D
UHDELOLWDomRSHUDQWHDSUySULDDXWRULGDGHTXHDSOLFRXDSHQDOLGDGHTXHVHUiFRQFHGLGDVHPSUH
TXHRFRQWUDWDGRUHVVDUFLUD$GPLQLVWUDomRSHORVSUHMXt]RVUHVXOWDQWHVHDSyVGHFRUULGRRSUD]R
GD VDQomRDSOLFDGDFRP EDVH QR LQFLVR DQWHULRU LQFLVR ,9 GR DUW GD OHL GH GH
MXQKRGH
4XH VH HQFRQWUHP VRE IDOrQFLD FRQFRUGDWD FRQFXUVR GH FUHGRUHV GLVVROXomR RX
OLTXLGDomR
4XH HP UHJLPH GH FRQVyUFLR TXDOTXHU TXH VHMD VXD IRUPD GH FRQVWLWXLomR VHMDP
FRQWURODGRUDVFROLJDGDVRXVXEVLGLiULDVHQWUHVL
(VWUDQJHLUDVTXHQmRIXQFLRQHPQR3DtV
4XHQmRGHWHQKDPDDWLYLGDGHSHUWLQHQWHHFRPSDWtYHOFRPRREMHWRGHVWH3UHJmR
$SDUWLFLSDomRQDSUHVHQWHOLFLWDomRILFDFRQGLFLRQDGDDRDWHQGLPHQWRDWRGDVDVH[LJrQFLDV
FRQVWDQWHVGHVWH(GLWDOHVHXVDQH[RVFRUUHQGRSRUFRQWDGDVHPSUHVDVLQWHUHVVDGDVWRGRVRV
FXVWRV GHFRUUHQWHV GD HODERUDomR H DSUHVHQWDomR GH VXDV SURSRVWDV QmR VHQGR GHYLGD
QHQKXPDLQGHQL]DomRjVOLFLWDQWHVSHODUHDOL]DomRGHWDLVDWRV
'2&5('(1&,$0(172)25$'26(19(/23(6
$SUHVHQWDU±VHGHYLGDPHQWHFUHGHQFLDGRVFRQIRUPHPRGHOR$QH[R,,,RVUHSUHVHQWDQWHV
OHJDLV GD HPSUHVD OLFLWDQWH RX VHXV SURFXUDGRUHV FRQVWLWXtGRV QD IRUPD GD OHL PXQLGRV GH
FHUWLILFDGRV GH KDELOLWDomR SUpYLD TXDQGR IRU R FDVR 7UDWDQGR±VH GH SURFXUDomR D PHVPD
GHYHUiFRQIHULUDPSORVSRGHUHVSDUDUHSUHVHQWDURXFRPILPHVSHFLILFRSDUDDSUHVHQWHOLFLWDomR
2 UHSUHVHQWDQWH GHYHUi DSUHVHQWDU R GRFXPHQWR GH LGHQWLILFDomR 5* RX RXWUR GRFXPHQWR
RILFLDO
±'HYHUiRUHSUHVHQWDQWHGDHPSUHVDOLFLWDQWHDSUHVHQWDUMXQWDPHQWHFRPDFUHGHQFLDOD
'HFODUDomR GH PLFURHPSUHVD RX GH HPSUHVD GH SHTXHQR SRUWH REMHWLYDQGR H[HUFtFLR GD
SUHIHUrQFLD SUHYLVWD QD /HL &RPSOHPHQWDU Qž GH DFRUGR FRP R PRGHOR FRPSRVWR SHOR
$QH[R 9,, TXH GHYHUi VHU DSUHVHQWDGD IRUD GRV HQYHORSHV ³³ H ³´ MXQWDPHQWH FRP RV
GRFXPHQWRVGHFUHGHQFLDPHQWRVHQRGLDGHVLJQDGRSDUDRUHFHELPHQWRGRVHQYHORSHV
'$)250$'($35(6(17$d­2'26(19(/23(6³´H³´
'HFODUDGD DEHUWD j VHVVmR SHOR 3UHJRHLUR R V UHSUHVHQWDQWH V GD V OLFLWDQWH V
DSUHVHQWDUimRGHFODUDomRGDQGRFLrQFLDGHTXHFXPSUHPSOHQDPHQWHRVUHTXLVLWRVGH
KDELOLWDomR $QH[R 9 HP HQYHORSH SUySULR H HQWUHJDUimR RV (19(/23(6 /$&5$'26
FRQWHQGRDVSURSRVWDVGHSUHoRVHRVGRFXPHQWRVGHKDELOLWDomRQmRVHQGRDFHLWDDSDUWLU
GHVVHPRPHQWRDDGPLVVmRGHQRYRVOLFLWDQWHV
2V HQYHORSHV ³´ H ³´ FRQWHQGR UHVSHFWLYDPHQWH D SURSRVWD GH SUHoR H GRFXPHQWDomR
UHIHUHQWH j KDELOLWDomR GHYHUmR VHU HQWUHJXHV QD GDWD KRUiULR H ORFDOLQGLFDGRV QR SUHkPEXOR
GHVWHHGLWDOGHYLGDPHQWHODFUDGRVFRQVWDQGRGDIDFHGHFDGDTXDORVVHJXLQWHVGL]HUHV
D(19(/23(3523267$'(35(d26
35()(,785$081,&,3$/'(9$/(1d$%$+,$
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
96 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
5$=­262&,$/(1ƒ'2&13-'2/,&,7$17(
E(19(/23('2&80(1726'(+$%,/,7$d­2
35()(,785$081,&,3$/'(9$/(1d$%$+,$
35(*­235(6(1&,$/1ƒ
5$=­262&,$/(1ƒ'2&13-'2/,&,7$17(
'$3523267$'(35(d2
$3URSRVWDGH3UHoRVGHYHUiVHUDSUHVHQWDGDHPXPDYLDLPSUHVVDUHGLJLGDFRPFODUH]D
HP OtQJXD SRUWXJXHVD VHP HPHQGDV VHP UDVXUDV RX HQWUHOLQKDV GHYLGDPHQWH GDWDGD H
DVVLQDGDQD~OWLPDIROKDHUXEULFDGDQDVGHPDLVSHORUHSUHVHQWDQWHOHJDOGDOLFLWDQWHQDIRUPD
GR$QH[R,,
1D3URSRVWDGH3UHoRVGHYHUmRFRQVWDUVRESHQDGHGHVFODVVLILFDomR
±5D]mR6RFLDOGDOLFLWDQWH
1žGR&13-0)
(QGHUHoRFRPSOHWR
7HOHIRQH
)D[SDUDFRQWDWR
1žGD&RQWDFRUUHQWHDJrQFLDHUHVSHFWLYR%DQFR
3UD]R GH HILFiFLD GD SURSRVWD R TXDO QmR SRGHUi VHU LQIHULRU D VHVVHQWD GLDV
FRUULGRVDFRQWDUGDGDWDGHVXDDSUHVHQWDomR
8PD~QLFDFRWDomRFRPSUHoRVXQLWiULRVWRWDLVHJOREDLVHPPRHGDFRUUHQWHQDFLRQDO
H[SUHVVRV HP DOJDULVPRV H SRU H[WHQVR VHP SUHYLVmR LQIODFLRQiULD (P FDVR GH GLYHUJrQFLD
HQWUHRVYDORUHVXQLWiULRVHWRWDLVVHUmRFRQVLGHUDGRVRVSULPHLURVHHQWUHRVYDORUHVH[SUHVVRV
HPDOJDULVPRHSRUH[WHQVRVHUiFRQVLGHUDGRHVWH~OWLPR
&RWDomRSRULWHPFRP YDORUHVXQLWiULRVWRWDLVHJOREDLVFRPD PDUFD GRVSURGXWRV
FRWDGRVQRFDVRGHSURGXWRVLQGXVWULDOL]DGRVVRESHQDGHGHVFODVVLILFDomR
3UD]RGHIRUQHFLPHQWRH[HFXomRQmRVXSHULRUDKTXDUHQWDHRLWRKRUDVFRQWDGRGR
UHFHELPHQWRGD2UGHPGH)RUQHFLPHQWR6HUYLoR
$SURSRVWDGHSUHoRVGHYHUiYLUDFRPSDQKDGDGD³DECLARAÇÃO DE ACEITAÇÃO
DAS AMOSTRAS” GRFXPHQWR HVWH IRUQHFLGR SHOD 6HFUHWDULD GH (GXFDomR DWHVWDQGR D
ERDTXDOLGDGHGRVSURGXWRVRIHUHFLGRVHGHDFRUGRFRPDVHVSHFLILFDo}HVGRHGLWDOVRE
SHQDGHGHVFODVVLILFDomRGDSURSRVWDGHSUHoRV
1RVSUHoRVSURSRVWRVGHYHUmRHVWDULQFOXtGRVDOpPGROXFURWRGDVDVGHVSHVDVHFXVWRV
FRPR SRU H[HPSOR WUDQVSRUWH OLPSH]D VHJXURV WULEXWRV GH TXDOTXHU QDWXUH]D H WRGDV DV
GHPDLV GHVSHVDV GLUHWDV RX LQGLUHWDV UHODFLRQDGDV FRP D SUHVWDomR GH VHUYLoRV REMHWR GD
SUHVHQWHOLFLWDomR
±2VSUHoRVRIHUWDGRVSHUPDQHFHUmRIL[RVSHORSUD]RGHXPDQRDFRQWDUGDGDWDGH
DVVLQDWXUDGD$WDGH5HJLVWURGH3UHoRV
$ DSUHVHQWDomR GDV SURSRVWDV LPSOLFDUi QD SOHQD DFHLWDomR SRU SDUWH GR OLFLWDQWH GDV
FRQGLo}HVHVWDEHOHFLGDVQHVWH(GLWDOHVHXV$QH[RV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
97 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
6HUmRGHVFODVVLILFDGDVDVSURSRVWDVTXHQmRDWHQGHUHPDVHVSHFLILFDo}HVHH[LJrQFLDVGR
SUHVHQWH (GLWDO H GH VHXV $QH[RV H TXH DSUHVHQWHP RPLVV}HV LUUHJXODULGDGHV RX GHIHLWRV
FDSD]HVGHGLILFXOWDURMXOJDPHQWR
(PQHQKXPDKLSyWHVHSRGHUiVHUDOWHUDGRRFRQWH~GRGDSURSRVWDDSUHVHQWDGDVHMDFRP
UHODomRDSUHoRXQLWiULRSDJDPHQWRSUD]RRXTXDOTXHUFRQGLomRTXHLPSRUWHDPRGLILFDomRGRV
WHUPRVRULJLQDLV
'2-8/*$0(172'$63523267$6
$UWLJRR9,,,,;;;,;,,;9;9,;9,,H;;,,,GD/HLQR
$EHUWRVRVHQYHORSHVDVSURSRVWDVVHUmRUXEULFDGDVSHOR3UHJRHLURHHTXLSHGHDSRLR
/LGR RV SUHoRV R 3UHJRHLUR UHODFLRQDUi WRGDV DV SURSRVWDV HP RUGHP FUHVFHQWH (P
VHJXLGDFODVVLILFDUiDVGHPHQRUSUHoRJOREDOSRUORWH
3DUDMXOJDPHQWRHFODVVLILFDomRGDVSURSRVWDVQDVHVVmRS~EOLFDVHUiDGRWDGRRFULWpULR
GH0(12535(d2*/2%$/325/27(REVHUYDGRVRVSUD]RVPi[LPRVSDUDIRUQHFLPHQWR
$SyV D DEHUWXUD GRV HQYHORSHV FRQWHQGR DV SURSRVWDV GH SUHoRV R DXWRU GD RIHUWD GH
YDORU PDLV EDL[R H RV GDV RIHUWDV FRP SUHoRV DWp GH] SRU FHQWR VXSHULRUHV jTXHOD
SRGHUmRID]HUQRYRVODQFHVYHUEDLVHVXFHVVLYRVDWpDSURFODPDomRGRYHQFHGRU
$SyVDSUHVHQWDomRGDSURSRVWDQmRFDEHUiGHVLVWrQFLDVDOYRSRUPRWLYRMXVWRGHFRUUHQWH
GHIDWRVXSHUYHQLHQWHHDFHLWRSHOR3UHJRHLUR
1mRKDYHQGRSHORPHQRVWUrVRIHUWDVQDVFRQGLo}HVGHILQLGDVQRLWHPSRGHUmR
RVDXWRUHVGDVPHOKRUHVSURSRVWDVDWpRPi[LPRGHWUrVRIHUHFHUQRYRVODQFHVYHUEDLVH
VXFHVVLYRVTXDLVTXHUTXHVHMDPRVSUHoRVRIHUHFLGRV
1R FDVR GH HPSDWH QRV SUHoRV VHUmR DGPLWLGDV WRGDV DV SURSRVWDV HPSDWDGDV
LQGHSHQGHQWHPHQWHGRQ~PHURGHOLFLWDQWHV
2SUHJRHLURFRQYLGDUiLQGLYLGXDOPHQWHRVOLFLWDQWHVFODVVLILFDGRVGHIRUPDVHTHQFLDOD
DSUHVHQWDU ODQFHV YHUEDLV D SDUWLU GR DXWRU GD SURSRVWD FODVVLILFDGD GH PDLRU SUHoR JOREDO SRU
ORWHHRVGHPDLVHPRUGHPGHFUHVFHQWHGHYDORUJOREDOKDYHUiVRUWHLRHPFDVRGHHPSDWH
± 2V ODQFHV GHYHUmR VHU IRUPXODGRV SRU YDORU JOREDO SRU ORWH HP YDORUHV GLVWLQWRV H
GHFUHVFHQWHVLQIHULRUHVDSURSRVWDGHPHQRUSUHoRFRQVLGHUDQGRRYDORUWRWDOGRORWH
±2LQWHUYDORPtQLPRGHYDORUHQWUHRVODQFHVDVHUHPDSUHVHQWDGRVSHORVOLFLWDQWHVVHUi
GHILQLGRSHORSUHJRHLUR
±$GHVLVWrQFLDHPDSUHVHQWDUODQFHYHUEDOTXDQGRFRQYRFDGRSHORSUHJRHLURLPSOLFDUi
DH[FOXVmRGROLFLWDQWHGDHWDSDGHODQFHVYHUEDLVHQDPDQXWHQomRGR~OWLPRSUHoRDSUHVHQWDGR
SHOROLFLWDQWHSDUDHIHLWRGHRUGHQDomRGDVSURSRVWDV
1mR SRGHUi KDYHU GHVLVWrQFLD GRV ODQFHV RIHUWDGRV VXMHLWDQGRVH R SURSRQHQWH
GHVLVWHQWHjVSHQDOLGDGHVFRQVWDQWHVQRLWHPGHVWH(GLWDO
&DVRQmRVHUHDOL]DUHPODQFHVYHUEDLVVHUiYHULILFDGDDFRQIRUPLGDGHHQWUHDSURSRVWD
HVFULWDGHPHQRUSUHoRHRYDORUHVWLPDGRSDUDDFRQWUDWDomR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
98 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
'HFODUDGD HQFHUUDGD D HWDSD FRPSHWLWLYD H RUGHQDGDV jV SURSRVWDV R SUHJRHLUR
H[DPLQDUi D DFHLWDELOLGDGH GD SULPHLUD FODVVLILFDGD TXDQWR DR REMHWR H YDORU GHFLGLQGR
PRWLYDGDPHQWHDUHVSHLWR
&RQVLGHUDGDDRIHUWDGHPHQRUSUHoRDFHLWiYHOVHKRXYHUSDUWLFLSDomRGH0LFURHPSUHVD
±0(RX(PSUHVDGH3HTXHQR3RUWH(33QRFHUWDPHVHUmRREVHUYDGDVDVGLVSRVLo}HVGD/HL
&RPSOHPHQWDUQž
6HDSURSRVWDGD0((33PHOKRUFRORFDGDIRUVXSHULRUHPDWpFLQFRSRUFHQWRGR
YDORUGROLFLWDQWHGHPHOKRURIHUWDVHUiFRQFHGLGRRSUD]RGHFLQFRPLQXWRVSDUDDSUHVHQWDU
SUHoRLQIHULRU
1D KLSyWHVH GD 0((33 PHOKRU FODVVLILFDGD QmR DSUHVHQWDU QRYD SURSRVWD VHUi
FRQYRFDGDDVHJXQGD0((33PHOKRUFODVVLILFDGDHDVVLPVXFHVVLYDPHQWHDWpTXHVHFKHJXH
jPDUJHPGHVXSHULRUDRYDORUGROLFLWDQWHFODVVLILFDGRHPžSULPHLUROXJDU
1mRKDYHQGRQHQKXPDSURSRVWDQDIDL[DGHDWpFLQFRSRUFHQWRVXSHULRUjPHOKRU
RIHUWDRXQmRKDYHQGRQRYDSURSRVWDGH0((33DSURSRVWDRULJLQiULDVHUiFRQVLGHUDGDFRPR
DPHOKRUFODVVLILFDGD
6HQGR DFHLWiYHO D SURSRVWD GH PHQRU SUHoR VHUi DEHUWR R HQYHORSH FRQWHQGR D
GRFXPHQWDomR GH KDELOLWDomR GR OLFLWDQWH TXH D WLYHU IRUPXODGR SDUD FRQILUPDomR GDV VXDV
FRQGLo}HVKDELOLWDWyULDV
&RQVWDWDGR R DWHQGLPHQWR GDV H[LJrQFLDV IL[DGDV QR HGLWDO R OLFLWDQWH VHUi GHFODUDGR
YHQFHGRUVHQGROKHDGMXGLFDGRRREMHWRGRFHUWDPH
6HDRIHUWDQmRIRUDFHLWiYHORXVHROLFLWDQWHGHVDWHQGHUjVH[LJrQFLDVKDELOLWDWyULDVR
SUHJRHLUR H[DPLQDUi D RIHUWD VXEVHTHQWH YHULILFDQGR D VXD DFHLWDELOLGDGH H SURFHGHQGR j
KDELOLWDomRGRSURSRQHQWHQDRUGHPGHFODVVLILFDomRHDVVLPVXFHVVLYDPHQWHDWpDDSXUDomR
GHXPDSURSRVWDTXHDWHQGDDRHGLWDOVHQGRRUHVSHFWLYROLFLWDQWHGHFODUDGRYHQFHGRUHDHOH
DGMXGLFDGRRREMHWRGRFHUWDPH
1DV VLWXDo}HV SUHYLVWDV QRV VXELWHQV H R SUHJRHLUR SRGHUi QHJRFLDU
GLUHWDPHQWHFRPRSURSRQHQWHSDUDTXHVHMDREWLGRSUHoRPHOKRU
'D UHXQLmR ODYUDUVHi DWD FLUFXQVWDQFLDGD QD TXDO VHUmR UHJLVWUDGDV DV RFRUUrQFLDV
UHOHYDQWHV GHYHQGR D PHVPD DR ILQDO VHU DVVLQDGD SHOR 3UHJRHLUR H RV OLFLWDQWHV SUHVHQWHV
UHVVDOWDQGRVHTXHSRGHUiFRQVWDUjDVVLQDWXUDGDHTXLSHGHDSRLRVHQGROKHVIDFXOWDGRHVVH
GLUHLWR
'$+$%,/,7$d­2
$UWLJRR;,,,;,9GD/HLQRFFD/HLQž
2 HQYHORSH ³´ FRQWHQGR D GRFXPHQWDomR UHODWLYD j +DELOLWDomR GHYHUi FRQWHU
REULJDWRULDPHQWHVRESHQDGHLQDELOLWDomRGDOLFLWDQWHRVGRFXPHQWRVDVHJXLULQGLFDGRV
+$%,/,7$d­2-85Ë',&$
D&pGXODGH,GHQWLGDGHGRVVyFLRVLQFOXVLYHHPFDVRGHILUPDLQGLYLGXDO
E$WRFRQVWLWXWLYRHVWDWXWRRXFRQWUDWRVRFLDOHPYLJRUGHYLGDPHQWHUHJLVWUDGRHP
VH WUDWDQGR GH VRFLHGDGHV FRPHUFLDLV H DFRPSDQKDGR QR FDVR GH VRFLHGDGHV SRU
Do}HVGRFXPHQWRVGHHOHLomRGHVHXVDWXDLVDGPLQLVWUDGRUHV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
99 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
F ,QVFULomR GR DWR FRQVWLWXWLYR QR FDVR GH VRFLHGDGH FLYLO DFRPSDQKDGD GH SURYD GD
GLUHWRULDHPH[HUFtFLR
G 'HFUHWR GH DXWRUL]DomR HP VH WUDWDQGR GH HPSUHVD RX VRFLHGDGH HVWUDQJHLUD HP
IXQFLRQDPHQWRQR3DtV
H7RGDVDVOLFLWDQWHVGHYHUmRDSUHVHQWDUDGHFODUDomRFRQIRUPHPRGHORGR$QH[R
,9DWHVWDQGRTXH
1mR H[LVWH HP VHX TXDGUR GH HPSUHJDGRV VHUYLGRUHV S~EOLFRV H[HUFHQGR
IXQo}HVGHJHUrQFLDDGPLQLVWUDomRRXWRPDGDGHGHFLVmR
,QH[LVWHIDWRVXSHUYHQLHQWHLPSHGLWLYRGHKDELOLWDomRQDIRUPDGR$UW†ž
GD/HL
1mRSRVVXLHPVHXTXDGURGHSHVVRDOHPSUHJDGRVFRPPHQRVGHDQRV
HP WUDEDOKR QRWXUQR SHULJRVR RX LQVDOXEUH H PHQRU GH DQRV HP TXDOTXHU
WUDEDOKR VDOYR QD FRQGLomR GH DSUHQGL] D SDUWLU GH DQRV QRV WHUPRV GR DUW
ž;;;,,,GD&RQVWLWXLomR)HGHUDOHDUW9GD/HL
5(*8/$5,'$'(),6&$/75$%$/+,67$
D3URYDGH,QVFULomRQR&DGDVWUR1DFLRQDOGH3HVVRD-XUtGLFD&13-
E 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD )HGHUDO H 'tYLGD $WLYD GD 8QLmR
PHGLDQWH D DSUHVHQWDomR GH &HUWLGmR GH 4XLWDomR GH 7ULEXWRV H &RQWULEXLo}HV
)HGHUDLV H[SHGLGR SHOD 6HFUHWDULD GD 5HFHLWD )HGHUDO GR GRPLFLOLR RX VHGH GR
SURSRQHQWH
F 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD (VWDGXDO PHGLDQWH DSUHVHQWDomR GH
&HUWLGmR GH 5HJXODULGDGH )LVFDO H[SHGLGD SHOD 6HFUHWDULD GD )D]HQGD (VWDGXDO GR
GRPLFLOLRRXVHGHGRSURSRQHQWH
G 3URYD GH UHJXODULGDGH SDUD FRP D )D]HQGD 0XQLFLSDO PHGLDQWH DSUHVHQWDomR GH
&HUWLGmRGH5HJXODULGDGH)LVFDOH[SHGLGDSHOD6HFUHWDULDGD)D]HQGD0XQLFLSDOGR
GRPLFLOLRRXVHGHGRSURSRQHQWH
H 3URYD GH UHJXODULGDGH UHODWLYD DR )XQGR GH *DUDQWLD SRU 7HPSR GH 6HUYLoR )*76
GHPRQVWUDQGRDVLWXDomRUHJXODUQRFXPSULPHQWRGRVHQFDUJRVVRFLDLVLQVWLWXtGRVSRU
OHL
I3URYDGHUHJXODULGDGHUHODWLYDD6HJXULGDGH6RFLDOMXQWRD3UHYLGrQFLD6RFLDO,166
GHPRQVWUDQGRDVLWXDomRUHJXODUQRFXPSULPHQWRGRVHQFDUJRVVRFLDLVLQVWLWXtGRVSRU
OHL
J&HUWLGmR1HJDWLYDGH)DOrQFLDH&RQFRUGDWDH[SHGLGDSHORGLVWULEXLGRUGDVHGHGR
SURSRQHQWHH[SHGLGDDPHQRVGHQRYHQWDGLDVGDDEHUWXUDGDVSURSRVWDV
K $OYDUi GH ORFDOL]DomR H IXQFLRQDPHQWR RX GRFXPHQWR HTXLYDOHQWH ± HPLWLGR SHOR
3RGHU([HFXWLYR0XQLFLSDO
L$OYDUiGH9LJLOkQFLD6DQLWiULDGDVHGHGDOLFLWDQWH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
100 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
M 3URYD GH LQH[LVWrQFLD GH GpELWRV LQDGLPSOLGRV SHUDQWH D -XVWLoD GR 7UDEDOKR
PHGLDQWH D DSUHVHQWDomR GH FHUWLGmR QHJDWLYD QRV WHUPRV GR 7tWXOR 9,,$ GD
&RQVROLGDomRGDV/HLVGR7UDEDOKR
48$/,),&$d­27e&1,&$
D $SUHVHQWDomR GH QR PtQLPR GRLV DWHVWDGRV IRUQHFLGRV SRU SHVVRD MXUtGLFD GH
GLUHLWR S~EOLFR RX SULYDGRV FRPSURYDQGR D UHDOL]DomR GH WUDEDOKRV H[HFXomR GH
VHUYLoRV HRX IRUQHFLPHQWRV FRPSDWtYHLV HP FDUDFWHUtVWLFDV TXDQWLGDGHV H SUD]RV
FRPRREMHWRGHVWDOLFLWDomRFRQIRUPHPRGHORDQH[R9,
48$/,),&$d­2(&21Ð0,&2±),1$1&(,5$
D%DODQoR3DWULPRQLDOHGHPRQVWUDo}HVFRQWiEHLVGHH[HUFtFLRILQDQFHLURGRDQR
TXH FRPSURYHP D ERD VLWXDomR ILQDQFHLUD H RSHUDFLRQDO GD HPSUHVD YHGDGD D VXD
VXEVWLWXLomR SRU EDODQFHWHV RX EDODQoR SURYLVyULRV 1mR VHQGR D OLFLWDQWH REULJDGD D
SXEOLFDU R VHX EDODQoR GHYHUi DSUHVHQWDU IRWRFySLD DXWHQWLFDGD GD SiJLQD GR /LYUR
'LiULRRQGHIRLWUDQVFULWRRUHIHULGREDODQoRHDGHPRQVWUDomRGRUHVXOWDGRGRH[HUFtFLR
(VWHVGRFXPHQWRVGHYHUmRFRQWHUDVDVVLQDWXUDVGHSHORPHQRVXPVyFLRJHUHQWHHGR
FRQWDGRUUHVSRQViYHODWUDYpVGRVHORGHKDELOLWDomRSURILVVLRQDOGHYLGDPHQWHUHJLVWUDGR
QR &RQVHOKR 5HJLRQDO GH &RQWDELOLGDGHV GR (VWDGR RQGH RV PHVPRV IRUDP HIHWXDGRV
FRPRVUHVSHFWLYRVWHUPRVGHDEHUWXUDGHHQFHUUDPHQWRUHJLVWURQD-XQWD&RPHUFLDOGR
(VWDGRGD6HGHGD/LFLWDQWHRXQR5HJLVWURGH7tWXORVH'RFXPHQWRV
E ¬V 6RFLHGDGHV HQTXDGUDGDV QR UHJLPH HVWDEHOHFLGR QD /HL Qž GH GH
GH]HPEUR GH ± /HL GDV 0LFURHPSUHVDV H GDV (PSUHVDV GH 3HTXHQR 3RUWH QmR
VHUi H[LJLGR R %DODQoR 3DWULPRQLDO FRQIRUPH UHJH R $UW GD &RQVWLWXLomR )HGHUDO
GHVGHTXHILTXHFRPSURYDGRRVHXHQTXDGUDPHQWR
7RGDV DV OLFLWDQWHV GHYHUmR DSUHVHQWDU GHQWUR GR HQYHORSH Qž RV GRFXPHQWRV
HVSHFLILFDGRV SDUD D SDUWLFLSDomR QHVWH 3UHJmR GHYHUmR VHU HQWUHJXHV SUHIHUHQFLDOPHQWH
QXPHUDGRV VHTHQFLDOPHQWH D ILP GH SHUPLWLU FHOHULGDGH QD FRQIHUrQFLD H H[DPH
FRUUHVSRQGHQWHV
6RE SHQD GH LQDELOLWDomR WRGRV RV GRFXPHQWRV DSUHVHQWDGRV SDUD KDELOLWDomR GHYHUmR
HVWDU
(P QRPH GD OLFLWDQWH H SUHIHUHQFLDOPHQWH FRP QXPHUR GR &13- H FRP HQGHUHoR
UHVSHFWLYR
DVHDOLFLWDQWHIRUDPDWUL]WRGRVRVGRFXPHQWRVGHYHUmRHVWDUHPQRPHGDPDWUL]RX
E VH D OLFLWDQWH IRU ILOLDO WRGRV RV GRFXPHQWRV GHYHUmR HVWDU HP QRPH GD ILOLDO H[FHWR
DTXHOHV GRFXPHQWRV TXH SHOD SUySULD QDWXUH]D FRPSURYDGDPHQWH IRUHP HPLWLGRV
VRPHQWHHPQRPHGDPDWUL]
F RV DWHVWDGRV GH FDSDFLGDGH WpFQLFD UHVSRQVDELOLGDGH WpFQLFD SRGHUmR VHU
DSUHVHQWDGRVHPQRPHHFRP&13-GDPDWUL]HRXGDVILOLDOLVGDOLFLWDQWH
'DWDGRVGRV~OWLPRVFHQWRHRLWHQWDGLDVDWpDGDWDGHDEHUWXUDGDVHVVmRS~EOLFD
TXDQGRQmRWLYHUSUD]RHVWDEHOHFLGRSHORyUJmRFRPSHWHQWHH[SHGLGRU
D QmR VH HQTXDGUDP QR SUD]R GH TXH WUDWD R LWHP DQWHULRU RV GRFXPHQWRV FXMD YDOLGDGH p
LQGHWHUPLQDGDFRPRpRFDVRGRVDWHVWDGRVGHFDSDFLGDGHUHVSRQVDELOLGDGHWpFQLFD
2V GRFXPHQWRV SUHYLVWRV QHVWH (GLWDO SRGHUmR VHU DXWHQWLFDGRV SHOR SUHJRHLUR H SHOD
HTXLSHGHDSRLRDSDUWLUGRRULJLQDOSUHIHUHQFLDOPHQWHHPPRPHQWRDQWHULRUDR3UHJmR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
101 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
6HUmRDFHLWDVVRPHQWHFySLDVOHJtYHLV
1mRVHUmRDFHLWRVGRFXPHQWRVFXMDVGDWDVHVWHMDPUDVXUDGDV
23UHJRHLURUHVHUYDVHRGLUHLWRGHVROLFLWDURRULJLQDOGHTXDOTXHUGRFXPHQWRVHPSUHTXH
WLYHUG~YLGDHMXOJDUQHFHVViULR
2V GRFXPHQWRV QHFHVViULRV j KDELOLWDomR SRGHUmR VHU DSUHVHQWDGRV HP RULJLQDO RX HP
FySLD DXWHQWLFDGD SRU FDUWyULR FRPSHWHQWH RX SRU TXDOTXHU VHUYLGRU RX HP SXEOLFDomR GD
LPSUHQVDRILFLDORXHPFySLDVVLPSOHVGHVGHTXHDFRPSDQKDGDVGRVRULJLQDLVSDUDFRQIHUrQFLD
SHOR3UHJRHLUR
1mRVHUmRDFHLWRVSURWRFRORVGHHQWUHJDRXVROLFLWDo}HVGHGRFXPHQWRHPVXEVWLWXLomRDRV
GRFXPHQWRVUHTXHULGRVQRSUHVHQWH(GLWDOHVHXVDQH[RV
6H D GRFXPHQWDomR GH KDELOLWDomR QmR HVWLYHU FRPSOHWD H FRUUHWD RX FRQWUDULDU TXDOTXHU
GLVSRVLWLYRGHVWH(GLWDOHVHXV$QH[RVR3UHJRHLURFRQVLGHUDUiRSURSRQHQWHLQDELOLWDGR
3RGHUiR3UHJRHLURGHFODUDUTXDOTXHUIDWRIRUPDOGHVGHTXHQmRLPSOLTXHGHVREHGLrQFLDj
OHJLVODomR H IRU HYLGHQWH D YDQWDJHP SDUD D $GPLQLVWUDomR GHYHQGR WDPEpP VH QHFHVViULR
SURPRYHUGLOLJrQFLDSDUDGLULPLUDG~YLGD
&RQVWDWDQGR DWUDYpV GD GLOLJrQFLD R QmR DWHQGLPHQWR DR HVWDEHOHFLGR R 3UHJRHLUR
FRQVLGHUDUiRSURSRQHQWHLQDELOLWDGR
7RGDV DV HPSUHVDV TXH HQVHMDU GHFODUDomR IDOVD RX TXH GHOD WHQKD FRQKHFLPHQWR QRV
WHUPRVGRDUWLJRGR&yGLJR3HQDOILFDUiVXMHLWRjVSHQDVGHUHFOXVmRGHXPDFLQFRDQRV
VHRGRFXPHQWRpS~EOLFRHUHFOXVmRGHXPDWUrVDQRVHPXOWDVHRGRFXPHQWRpSDUWLFXODU
LQGHSHQGHQWHGDSHQDOLGDGHHVWDEHOHFLGDQRDUWLJRžGD/HL)HGHUDOQž
±'26,67(0$'(5(*,6752'(35(d26
2 6LVWHPD GH 5HJLVWUR GH 3UHoRV UHJXODVH SHODV QRUPDV H SURFHGLPHQWRV SUHYLVWRV QR
'HFUHWR0XQLFLSDOQž
1RkPELWRGR6LVWHPDGH5HJLVWURGH3UHoRVDDGMXGLFDomRVLJQLILFDWmRVRPHQWHRUHJLVWUR
GRVSUHoRVRIHUWDGRVVHQGRTXHSDUDDSUHVHQWHFRQWUDWDomRVHUiUHGLJLGDDPLQXWDGRFRQWUDWR
HSRVWRRYDORUUHJLVWUDGRHPDWD
$ H[LVWrQFLD GR 5HJLVWUR QmR REULJD D $GPLQLVWUDomR D HIHWLYDU DV FRQWUDWDo}HV SRU HVVH
PHLRILFDQGROKHIDFXOWDGDDDTXLVLomRSRURXWUDVPRGDOLGDGHVUHVSHLWDGDDOHJLVODomRUHODWLYD
jV OLFLWDo}HV VHQGR DVVHJXUDGR j GHWHQWRUD GD $WD R GLUHLWR GH SUHIHUrQFLD HP LJXDOGDGH GH
FRQGLo}HV
8PD YH] UHJLVWUDGRV RV SUHoRV D $GPLQLVWUDomR SRGHUi FRQYRFDU D GHWHQWRUD GR
5HJLVWUR D IRUQHFHU RV UHVSHFWLYRV PDWHULDLV H H[HFXWDU RV VHUYLoRV QD IRUPD H FRQGLo}HV
IL[DGDVQRSUHVHQWH(GLWDOHQD$WDGH5HJLVWURGH3UHoRV
'$,038*1$d­2'2$72&2192&$7Ï5,2
$WpGRLVGLDV~WHLVDQWHVGDGDWDIL[DGDSDUDUHFHELPHQWRGDVSURSRVWDVTXDOTXHUSHVVRD
SRGHUiVROLFLWDUHVFODUHFLPHQWRVSURYLGrQFLDVRXLPSXJQDURSUHVHQWHHGLWDO
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
102 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&DEHUiDRSUHJRHLURGHFLGLUVREUHDSHWLomRQRSUD]RGHYLQWHHTXDWURKRUDV
$FROKLGDjSHWLomRFRQWUDRDWRFRQYRFDWyULRVHUiGHVLJQDGDQRYDGDWDSDUDDUHDOL]DomR
GRFHUWDPH
$ RFRUUrQFLD GH LPSXJQDomR GH FDUiWHU PHUDPHQWH SURWHODWyULR HQVHMDQGR DVVLP R
UHWDUGDPHQWR GD H[HFXomR GR FHUWDPH D DXWRULGDGH FRPSHWHQWH SRGHUi DVVHJXUDGR R
FRQWUDGLWyULR H DPSOD GHIHVD DSOLFDU D SHQD HVWDEHOHFLGD QR DUWLJR ž GD /HL Qž H
OHJLVODomRYLJHQWH
4XHP LPSHGLU SHUWXUEDU RX IUDXGDU DVVHJXUDGR R FRQWUDGLWyULR H D DPSOD GHIHVD D
UHDOL]DomR GH TXDOTXHU DWR GR SURFHGLPHQWR OLFLWDWyULR LQFRUUHUi HP SHQD GH GHWHQomR GH GRLVDWUrVDQRVHPXOWDQRVWHUPRVGRDUWLJRGD/HL
'265(&85626
$UWLJRR;9,,,;,;;;H;;,GD/HLQR
'HFODUDGRRYHQFHGRUTXDOTXHUOLFLWDQWHSRGHUiPDQLIHVWDUPRWLYDGDPHQWHDLQWHQomRGH
UHFRUUHU TXDQGR OKH VHUi FRQFHGLGR R SUD]R GH WUrV GLDV SDUD DSUHVHQWDomR GDV UD]}HV GR
UHFXUVR ILFDQGR RV GHPDLV OLFLWDQWHV GHVGH ORJR LQWLPDGRV SDUD DSUHVHQWDU FRQWUDUD]}HV HP
LJXDO Q~PHUR GH GLDV TXH FRPHoDUmR D FRUUHU GR WpUPLQR GR SUD]R GR UHFRUUHQWH VHQGROKHV
DVVHJXUDGDYLVWDLPHGLDWDGRVDXWRV
$IDOWDGHPDQLIHVWDomRLPHGLDWDHPRWLYDGDGROLFLWDQWHLPSRUWDUiDGHFDGrQFLDGRGLUHLWR
GHUHFXUVRHDDGMXGLFDomRGRREMHWRGDOLFLWDomRSHORSUHJRHLURDRYHQFHGRU
2UHFXUVRFRQWUDGHFLVmRGR3UHJRHLURQmRWHUiHIHLWRVXVSHQVLYR
2 DFROKLPHQWR GH UHFXUVR LPSRUWDUi D LQYDOLGDomR DSHQDV GRV DWRV LQVXVFHWtYHLV GH
DSURYHLWDPHQWR
'HFLGLGRRVUHFXUVRVDDXWRULGDGHFRPSHWHQWHIDUiDDGMXGLFDomRGRREMHWRGDOLFLWDomRDR
OLFLWDQWHYHQFHGRU
2VDXWRVGRSURFHGLPHQWRSHUPDQHFHUmRFRPYLVWDIUDQTXHDGDDRVLQWHUHVVDGRVQR6HWRU
GH /LFLWDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD VLWXDGD D 7UDYHVVD *HQHUDO /DEDWXW 61 ±
&HQWUR9DOHQoD%DKLD
1D RFRUUrQFLD GH PDQLIHVWDomR RX LQWHUSRVLomR GH UHFXUVR GH FDUiWHU PHUDPHQWH
SURWHODWyULRHQVHMDQGRDVVLPRUHWDUGDPHQWRGDH[HFXomRGRFHUWDPHDDXWRULGDGHFRPSHWHQWH
SRGHUiDVVHJXUDGRRFRQWUDGLWyULRHDDPSODGHIHVDDSOLFDUDSHQDHVWDEHOHFLGDQRDUWLJRžGD
/HLQžHOHJLVODomRYLJHQWH
±'$$7$'(5(*,6752'(35(d26
± (QFHUUDGR R SURFHVVR OLFLWDWyULR SDUD 5HJLVWUR GH 3UHoRV D $GPLQLVWUDomR UHVSHLWDGD D
RUGHPFRQYRFDUiDDGMXGLFDWiULDHDVLQWHUHVVDGDVUHPDQHVFHQWHVGHVGHTXHHVWDVWHQKDPR
LQWHUHVVHHPDVVLQiODSHORSUHoRREWLGRSUD]RGHHQWUHJDHGHPDLVFRQGLo}HVGHIRUQHFLPHQWR
GD SULPHLUD FRORFDGD SDUD GHQWUR GR SUD]R GH FLQFR GLDV ~WHLV D FRQWDU GD GDWD GH
UHFHELPHQWR GD QRWLILFDomR DVVLQDUHP D $WD GH 5HJLVWUR GH 3UHoRV FXMD PLQXWD LQWHJUD HVWH
HGLWDO $QH[R 9,,, H TXH DSyV SXEOLFDGD WHUi HIHLWR GH FRPSURPLVVR GH IRUQHFLPHQWR QDV
FRQGLo}HVHVWDEHOHFLGDVQRSUHVHQWHGRFXPHQWRHGLWDOtFLR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
103 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
±4XDQGRDDGMXGLFDWiULDHDVGHPDLVLQWHUHVVDGDVDRVHUHPFRQYRFDGDVQmRDVVLQDUHPD
$WDGH5HJLVWURGH3UHoRVQRSUD]RHFRQGLo}HVHVWDEHOHFLGRVVHUiIDFXOWDGRj$GPLQLVWUDomR
VHP SUHMXt]R GH VH DSOLFDU D VDQomR SUHYLVWD QHVWH HGLWDO FRQYRFDU DV OLFLWDQWHV VHJXLQWHV QD
RUGHPGHFODVVLILFDomRSDUDID]HOR
± )RUPDOL]DGD D $WD GH 5HJLVWUR GH 3UHoRV GXUDQWH VXD YLJrQFLD D HPSUHVD GHWHQWRUD
HVWDUiREULJDGDDRVHXFXPSULPHQWREHPFRPRDRGHWRGDVDVGHPDLVFRQGLo}HVHVWDEHOHFLGDV
QHVWHHGLWDOVHPSUHMXt]RGHVHUHPDSOLFDGDVDVVDQo}HVFDEtYHLVFRQVWDQWHVGHVWHHGLWDO
±'235$=2'(9$/,'$'('$$7$
$$WDGH5HJLVWURGH3UHoRVWHUiYDOLGDGHGHXPDQRFRQWDGRDSDUWLUGDGDWDGHVXD
DVVLQDWXUDSRGHQGRVHUSURUURJDGRDFULWpULRGD$GPLQLVWUDomR
±'2)251(&,0(172((;(&8d­2
±2IRUQHFLPHQWRGRPDWHULDOHRXDH[HFXomRGRVHUYLoRVHUiHIHWXDGRDSyVDDVVLQDWXUD
GRFRQWUDWRPHGLDQWHHQFDPLQKDPHQWRSHOD6HFUHWDULDFRPSHWHQWHGH1RWDGH(PSHQKRTXH
FRUUHVSRQGHjDXWRUL]DomRGHHQWUHJDHRXH[HFXomRGHYHQGRQHODFRQVWDUHVSHFLILFDo}HVGR
PDWHULDOHRXVHUYLoRTXDQWLWDWLYRSUD]RORFDOGHHQWUHJDHSUHoRVXQLWiULRHWRWDO
±'XUDQWHDYLJrQFLDGD$WDGH5HJLVWURGH3UHoRVVXDGHWHQWRUDILFDREULJDGDDIRUQHFHUR
PDWHULDO HRX H[HFXWDU R VHUYLoR GH DFRUGR FRP R SUHoR UHJLVWUDGR QDV TXDQWLGDGHV LQGLFDGDV
HPFDGD1RWDGH(PSHQKR
± 2 0XQLFtSLR GH 9DOHQoD%$ QmR HVWi REULJDGR D DGTXLULU TXDOTXHU TXDQWLGDGH GR REMHWR
OLFLWDGRHLJXDOPHQWHDVROLFLWDUTXDOTXHUGRVVHUYLoRVILFDQGRDVHXH[FOXVLYRFULWpULRGHILQLUD
TXDQWLGDGHHRPRPHQWRGDDTXLVLomRHH[HFXomRGDTXHOHVGHDFRUGRFRPDVQHFHVVLGDGHVGD
$GPLQLVWUDomR
± $ GHWHQWRUD QmR SRGHUi VHP PRWLYR MXVWR GHYLGDPHQWH FRPSURYDGR H LQIRUPDGR
UHFXVDUVH D IRUQHFHU RV PDWHULDLV HRX H[HFXWDU RV VHUYLoRV VROLFLWDGRV SHOR 0XQLFtSLR GH
9DOHQoD%$
±2VPDWHULDOLVSURGXWRVVHUimRGHYROYLGRVRXVHUYLoRVVHUmRUHFXVDGRVQDKLSyWHVH
GHDSUHVHQWDULUUHJXODULGDGHVQmRFRUUHVSRQGHUjVHVSHFLILFDo}HVGD$WDGH5HJLVWURGH3UHoRV
RXHVWDUIRUDGRVSDGU}HVGHWHUPLQDGRVGHYHQGRVHUVXEVWLWXtGRVSHODHPSUHVDGHWHQWRUDGD
$WD QR SUD]R Pi[LPR GH TXDUHQWD H RLWR KRUDV D FRQWDU GD QRWLILFDomR VRE SHQD GH
DSOLFDomRGDVSHQDOLGDGHVSUHYLVWDVQHVWHHGLWDO
±'235$=2(/2&$/3$5$(175(*$((;(&8d­2'266(59,d26
2V SURGXWRVVHUYLoRV VHUmR HQWUHJXHVH[HFXWDGRV GH XPD Vy YH] RX SDUFHODGDPHQWH
FRQIRUPH2UGHPGH)RUQHFLPHQWR6HUYLoRQRSUD]RQmRVXSHULRUDKTXDUHQWDHRLWRKRUDV
FRQWDGRVGDGDWDGHUHFHELPHQWRGD6ROLFLWDomRGH)RUQHFLPHQWRHRX([HFXomR
2IDWXUDPHQWRGHYHUiVHUHPLWLGRSDUD
35()(,785$081,&,3$/'(9$/(1d$LQVFULWDQR&13-VRERQžFRP
VHGHD7UDYHVVD*HQHUDO/DEDWXWVQžFHQWUR9DOHQoD%DKLDH
±'25(&(%,0(172'22%-(72
±&DVRSRUTXDOTXHUUD]mRQmRSRVVDVHUSURFHVVDGRRUHFHELPHQWRGHILQLWLYRQRPRPHQWR
GD HQWUHJD R REMHWR OLFLWDGR VHUi UHFHELGR SURYLVRULDPHQWH FRP HIHLWR LPHGLDWR SDUD SRVWHULRU
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
104 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
YHULILFDomR GH VXD FRQIRUPLGDGH FRP DV HVSHFLILFDo}HV FRQVWDQWHV QD 1RWD GH (PSHQKR H
UHVSHFWLYRGRFXPHQWRILVFDO
± 2 DFHLWHDSURYDomR GRV PDWHULDOLV H VHUYLoRV SHOR yUJmR OLFLWDQWH QmR H[FOXL D
UHVSRQVDELOLGDGH FLYLO GRV IRUQHFHGRUHV SRU YtFLRV GH TXDQWLGDGH RX TXDOLGDGH GRV
PDWHULDOLV H VHUYLoRV YHULILFDGDV SRVWHULRUPHQWH JDUDQWLQGRVH DR yUJmR OLFLWDQWH DV
IDFXOGDGHVSUHYLVWDVQRDUWGD/HLQž
&RPR FRQGLomR SDUD HPLVVmR GD ³1RWD GH (PSHQKR´ R OLFLWDQWH YHQFHGRU GHYHUi HVWDU
FRPDGRFXPHQWDomRREULJDWyULDYiOLGDSHUDQWHD)D]HQGD(VWDGXDOHDLQGDSHUDQWHD)D]HQGD
)HGHUDOD6HJXULGDGH6RFLDO,166HDR)XQGRGH*DUDQWLDSRU7HPSRGH6HUYLoR)*76
6H DV FHUWLG}HV UHIHULGDV QD IDVH GH KDELOLWDomR QmR FRPSURYDUHP D VLWXDomR UHJXODU GD
HPSUHVDDGMXGLFDWiULDDVHVVmRVHUiUHWRPDGDHRVGHPDLVOLFLWDQWHVFKDPDGRVQDRUGHPGH
FODVVLILFDomR SDUD ID]rOR QDV PHVPDV FRQGLo}HV GD SULPHLUD FRORFDGD REVHUYDGR TXH R
SUHJRHLURH[DPLQDUiDDFHLWDELOLGDGHTXDQWRDRREMHWRVHPSUHMXt]RGDDSOLFDomRGDVVDQo}HV
FDEtYHLV
$FRQWUDWDQWHILFDUiREULJDGDDDFHLWDUQDVPHVPDVFRQGLo}HVGHVWHHGLWDORVDFUpVFLPRV
RX VXSUHVV}HV TXH VH IL]HUHP QHFHVViULRV DWp YLQWH H FLQFR SRU FHQWR GR YDORU LQLFLDO
DWXDOL]DGR GR REMHWR DGMXGLFDGR GHYHQGR VXSUHVV}HV DFLPD GHVVH OLPLWH VHU UHVXOWDQWH GH
DFRUGRHQWUHDVSDUWHV
6HDOLFLWDQWHYHQFHGRUDQmRFXPSULURSUD]RHVWLSXODGRQHVWHHGLWDORXUHFXVDUVHDUHWLUDU
D ³1RWD GH (PSHQKR´ VHP MXVWLILFDWLYD IRUPDOPHQWH DFHLWD SHOR 3UHIHLWR 0XQLFLSDO GH 9DOHQoD
GHFDLUi GR GLUHLWR GH IRUQHFHU RV REMHWRV DGMXGLFDGRV VXMHLWDQGRVH jV SHQDOLGDGHV GLVSRVWDV
QHVWH(GLWDOGH3UHJmR
$3UHIHLWXUD0XQLFLSDOGH9DOHQoDQRVWHUPRVSUHYLVWRVQHVWHHGLWDOGHYHUi
5HFHEHURVSURGXWRVHDFHLWDUDH[HFXomRGRVVHUYLoRVDGMXGLFDGRVQRVWHUPRVSUD]RV
TXDQWLGDGHTXDOLGDGHHFRQGLo}HVHVWDEHOHFLGDVQHVWHHGLWDO
2VSURGXWRVVHUYLoRVVHUmRUHFXVDGRVHGHYROYLGRVQDVVHJXLQWHVKLSyWHVHV
D 1RWD ILVFDO FRP HVSHFLILFDomR H TXDQWLGDGHV HP GHVDFRUGR FRP R GLVFULPLQDGR QD QRWD GH
HPSUHQKR
E(QWUHJXHVHPGHVDFRUGRFRPDVHVSHFLILFDo}HVGRVUHTXLVLWRVREULJDWyULRVGHVWHHGLWDO
F$SUHVHQWHPYtFLRVGHTXDOLGDGHRXLPSURSULHGDGHSDUDRXVR
2UHFHELPHQWRSURYLVyULRGRSURGXWRVHUYLoRDGMXGLFDGRQmRLPSOLFDVXDDFHLWDomR
2 UHFHELPHQWR GHILQLWLYR GDUVHi SHOR 6HUYLGRU QRPHDGR SHOD 3UHIHLWXUD SDUD
UHFHELPHQWRGRVSURGXWRVDSyVDYHULILFDomRGRFXPSULPHQWRGDVHVSHFLILFDo}HVGRVSURGXWRV
QRVWHUPRVGHVWH(GLWDOHVHXVDQH[RVHGDSURSRVWDDGMXGLFDWiULDQRSUD]RGHGRLVGLDV
~WHLVFRQWDGRVGRUHFHELPHQWRSURYLVyULR
(IHWXDU R SDJDPHQWR DSyV R UHFHELPHQWR GHILQLWLYR GRV SURGXWRV HRX H[HFXomR GRV
VHUYLoRVPHGLDQWHGHSyVLWREDQFiULRFKHTXHUHFLERRXHPPRHGDFRUUHQWHDWpRƒWULJpVLPR
GLDFRQWDGRDSDUWLUGRUHFHELPHQWRGD)DWXUD1RWD)LVFDOFRPXPHHOHWU{QLFDHGHYLGDPHQWH
DWHVWDGRSHOR6HWRUFRPSHWHQWHGD6HFUHWDULD0XQLFLSDO
'$66$1d®(6$'0,1,675$7,9$6
$UWLJRžGD/HLQR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
105 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
H$UWLJRVHGD/HLQž
2GHVFXPSULPHQWRLQMXVWLILFDGRGDVREULJDo}HVDVVXPLGDVQRVWHUPRVGHVWHHGLWDOVXMHLWD
D OLFLWDQWH RX D FRQWUDWDGD D PXOWDV FRQVRDQWH R caput H †† GR DUW GD /HL Qƒ LQFLGHQWHVVREUHRYDORUGD1RWDGH(PSHQKRQDIRUPDVHJXLQWH
6HP SUHMXt]R GDV VDQo}HV FRPLQDGDV QR DUW , ,,, H ,9 GD /HL SHOD
LQH[HFXomR WRWDO RX SDUFLDO GR REMHWR DGMXGLFDGR D 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD SRGHUi
JDUDQWLGDSUpYLDHDPSODGHIHVDDSOLFDUjFRQWUDWDGDPXOWDGHDWpGH]SRUFHQWRVREUHR
YDORUDGMXGLFDGR
6H D DGMXGLFDWiULD UHFXVDUVH D UHWLUDU D QRWD GH HPSHQKR LQMXVWLILFDGDPHQWH RX VH QmR
DSUHVHQWDU VLWXDomR UHJXODU QR DWR GD IHLWXUD GD PHVPD JDUDQWLGD D SUpYLD H DPSOD GHIHVD
VXMHLWDVHjVVHJXLQWHVSHQDOLGDGHV
PXOWDGHDWpVREUHRYDORUFRQWUDWDGR
VXVSHQVmR WHPSRUiULD GH SDUWLFLSDU GH OLFLWDo}HV H LPSHGLPHQWR GH FRQWUDWDU FRP D
35()(,785$081,&,3$/'(9$/(1d$SRUSUD]RGHDWpGRLVDQRVH
GHFODUDomRGHLQLGRQHLGDGHSDUDOLFLWDURXFRQWUDWDUFRPDDGPLQLVWUDomRS~EOLFD
$OLFLWDQWHDGMXGLFDWiULDRXFRQWUDWDGDTXHGHL[DUGHHQWUHJDURXDSUHVHQWDUGRFXPHQWDomR
IDOVDH[LJLGDSDUDRFHUWDPHHQVHMDURUHWDUGDPHQWRGDH[HFXomRGHVHXREMHWRQmRPDQWLYHUD
SURSRVWDIDOKDURXIUDXGDUQDH[HFXomRGRFRQWUDWRFRPSRUWDUVHGHPRGRLQLG{QHRRXFRPHWHU
IUDXGH ILVFDO JDUDQWLGD D SUpYLD H DPSOD GHIHVD ILFDUi LPSHGLGD GH OLFLWDU H FRQWUDWDU FRP R
0XQLFtSLRSHORSUD]RGHDWpFLQFRDQRVHVHPSUHMXt]RGDDomRSHQDOFRUUHVSRQGHQWHQDIRUPD
GDOHL
$PXOWDHYHQWXDOPHQWHLPSRVWDjFRQWUDWDGDVHUiDXWRPDWLFDPHQWHGHVFRQWDGDGDIDWXUD
DTXHIL]HUMXVDFUHVFLGDGHMXURVPRUDWyULRVGHXPSRUFHQWRDRPrV&DVRDFRQWUDWDGD
QmR WHQKD QHQKXP YDORU D UHFHEHU GHVWD 3UHIHLWXUD VHUOKHi FRQFHGLGR R SUD]R GH FLQFR
GLDV ~WHLV FRQWDGRV GH VXD XOWLPD LQWLPDomR SDUD HIHWXDU R SDJDPHQWR GD PXOWD $SyV HVVH
SUD]RQmRVHQGRHIHWXDGRRSDJDPHQWRVHXVGDGRVVHUmRHQFDPLQKDGRVDRyUJmRFRPSHWHQWH
SDUD TXH VHMD LQVFULWD QD 'LYLGD $WLYD GR 0XQLFtSLR SRGHQGR DLQGD D 3UHIHLWXUD SURFHGHU D
FREUDQoDMXGLFLDOGDPXOWD
$V PXOWDV SUHYLVWDV QHVWD VHomR QmR H[LPHP D OLFLWDQWH HRX DGMXGLFDWiULD GD UHSDUDomR
GRVHYHQWXDLVGDQRVSHUGDVRXSUHMXt]RVTXHVHXDWRSXQtYHOYHQKDFDXVDUDRyUJmR
6RPHQWHVHUiFRQFHGLGDSURUURJDomRGRSUD]RSDUDRIRUQHFLPHQWRGRREMHWRQRWRGRRX
HPSDUWHFDVRDHPSUHVDHIHWLYDPHQWHGHPRQVWUHHFRPSURYHHPSHGLGRIXQGDPHQWDGRIDWR
VXSHUYHQLHQWH LPSUHYLVtYHO RX GH GLItFLO SUHYLVmR LPSHGLWLYR GD HQWUHJD QR SUD]R HVWLSXODGR QD
SURSRVWD
'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±)XQGR0XQLFLSDOGH(GXFDomR&ODVVLILFDomR(FRQ{PLFD±0DWHULDO
GH &RQVXPR 2EMHWR$WLYLGDGH ± 'LVWULEXLomR GH $OLPHQWDomR (VFRODU SDUD RV $OXQRV GD
5HGH3~EOLFDGH(QVLQR)RQWH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
106 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
'$6',6326,d®(6*(5$,6
$UW†žH$UWLJR†RGD/HL
e IDFXOWDGD DR 3UHJRHLUR RX $XWRULGDGH 6XSHULRU HP TXDOTXHU IDVH GD OLFLWDomR D
SURPRomR GH GLOLJrQFLD GHVWLQDGD D HVFODUHFHU RX FRPSOHPHQWDU D LQVWUXomR GR SURFHVVR
YHGDGDDLQFOXVmRSRVWHULRUGHGRFXPHQWRRXLQIRUPDomRTXHGHYHULDFRQVWDUQRDWRGDVHVVmR
S~EOLFD
$ DXWRULGDGH FRPSHWHQWH SDUD GHWHUPLQDU D FRQWUDWDomR SRGHUi UHYRJDU D OLFLWDomR SRU
UD]}HVGHLQWHUHVVHS~EOLFRGHULYDGRGHIDWRVXSHUYHQLHQWHGHYLGDPHQWHFRPSURYDGRSHUWLQHQWH
H VXILFLHQWH SDUD MXVWLILFDU WDO FRQGXWD GHYHQGR DQXOiOD SRU LOHJDOLGDGH GH RItFLR RX SRU
SURYRFDomRGHTXDOTXHUSHVVRDPHGLDQWHDWRHVFULWRHIXQGDPHQWDGR
$DQXODomRGRSURFHGLPHQWRLQGX]jGRFRQWUDWRRXQRWDGHHPSHQKR
2V OLFLWDQWHV QmR WHUmR GLUHLWR j LQGHQL]DomR HP GHFRUUrQFLD GD DQXODomR GR
SURFHGLPHQWR OLFLWDWyULR UHVVDOYDGR R GLUHLWR GR FRQWUDWDGR GH ERDIp GH VHU UHVVDUFLGR SHORV
HQFDUJRVTXHWLYHUVXSRUWDGRQRFXPSULPHQWRGRFRQWUDWR
2VSURSRQHQWHVDVVXPHPWRGRVRVFXVWRVGHSUHSDUDomRHDSUHVHQWDomRGHVXDSURSRVWD
HD3UHIHLWXUD0XQLFLSDOGH9DOHQoDQmRVHUiHPQHQKXPFDVRUHVSRQViYHOSRUHVVHVFXVWRV
LQGHSHQGHQWHPHQWHGDFRQGXomRRXGRUHVXOWDGRGRSURFHVVROLFLWDWyULR
2V SURSRQHQWHV VmR UHVSRQViYHLV SHOD ILGHOLGDGH H OHJLWLPLGDGH GDV LQIRUPDo}HV H GRV
GRFXPHQWRVDSUHVHQWDGRVHPTXDOTXHUIDVHGDOLFLWDomR
1mR KDYHQGR H[SHGLHQWH RX RFRUUHQGR TXDOTXHU IDWR VXSHUYHQLHQWH TXH LPSHoD D
UHDOL]DomR GR FHUWDPH QD GDWD PDUFDGD D VHVVmR VHUi UHGHVLJQDGD SDUD R GLD KRUD H ORFDO
GHILQLGRHQRYDPHQWHSXEOLFDGDQD,PSUHQVD2ILFLDO
1DFRQWDJHPGRVSUD]RVHVWDEHOHFLGRVQHVWH(GLWDOHVHXV$QH[RVH[FOXLUVHiRGLDGR
LQtFLRHLQFOXLUVHiRGRYHQFLPHQWR6yVHLQLFLDPHYHQFHPRVSUD]RVHPGLDVGHH[SHGLHQWH
QRUPDOQD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
2GHVDWHQGLPHQWRGHH[LJrQFLDVIRUPDLVQmRHVVHQFLDLVQmRLPSRUWDUiQRDIDVWDPHQWRGR
OLFLWDQWH GHVGH TXH VHMDP SRVVtYHLV DV DIHULo}HV GDV VXDV TXDOLILFDo}HV H DV H[DWDV
FRPSUHHQV}HVGDVXDSURSRVWDGXUDQWHDUHDOL]DomRGDVHVVmRS~EOLFDGR35(*­2
$VQRUPDVTXHGLVFLSOLQDPHVWHSUHJmRVHUmRVHPSUHLQWHUSUHWDGDVHPIDYRUGDDPSOLDomR
GDGLVSXWDHQWUHRVLQWHUHVVDGRVVHPFRPSURPHWLPHQWRGDVHJXUDQoDGRIXWXURFRQWUDWR
4XDOTXHU SHGLGR GH HVFODUHFLPHQWR HP UHODomR D HYHQWXDLV G~YLGDV QD LQWHUSUHWDomR GR
SUHVHQWH(GLWDOHVHXV$QH[RVGHYHUiVHUHQFDPLQKDGRSRUHVFULWRDR3UHJRHLURD3UHIHLWXUD
0XQLFLSDO GH 9DOHQoD VLWXDGD D 7UDYHVVD *HQHUDO /DEDWXW VQ &HQWUR ± 9DOHQoD%DKLD GDV
jV K H GDV jV KV DWp GRLV GLDV ~WHLV DQWHV GD GDWD GH DEHUWXUD GR
35(*­2
$KRPRORJDomRGRUHVXOWDGRGHVWDOLFLWDomRQmRLPSOLFDUiGLUHLWRjFRQWUDWDomR
$RVFDVRVRPLVVRVDSOLFDPVHDVGLVSRVLo}HVFRQVWDQWHVGD/HLH
'HFUHWRV0XQLFLSDLVQžH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
107 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
6mR SDUWHV LQWHJUDQWHV LQGLVVRFLiYHLV H DWUHODGDV DR FRQWH~GR GHVWH (GLWDO RV DQH[RV
DWDGHUHJLVWURGHSUHoRVFXMRWHRUYLQFXODWRWDOPHQWHRVOLFLWDQWHV
$1(;2,±(VSHFLILFDo}HVGRVSURGXWRVHRXPDWHULDLV
$1(;2,,±0RGHORGH3URSRVWDGH3UHoRV
$1(;2,,,±0RGHORGH&DUWDGH&UHGHQFLDPHQWR
$1(;2 ,9 ± 0RGHOR GH GHFODUDomR GH IDWRV VXSHUYHQLHQWH TXH QmR HPSUHJD PHQRUHV GH DQRV HP WUDEDOKR QRWXUQRV H QmR SRVVXL HP TXDGUR GH SHVVRDO VHUYLGRU S~EOLFR H[HUFHQGR
IXQomRWpFQLFDFRPHUFLDLVGHJHUrQFLDDGPLQLVWUDomRRXWRPDGDGHGHFLVmRLQFLVR,,,GRDUWž
GD/HL
$1(;2 9 ± 0RGHOR GH GHFODUDomR GDQGR FLrQFLD GH TXH FXPSUHP RV UHTXLVLWRV SDUD D
KDELOLWDomR
$1(;29,±0RGHORGHDWHVWDGRGHFDSDFLGDGHWpFQLFD
$1(;29,,±0RGHORGH'HFODUDomRGH0LFUR(PSUHVDH(PSUHVDGH3HTXHQR3RUWH
$1(;29,,,±0LQXWDGD$WDGH5HJLVWURGH3UHoRV
$1(;2,;0RGHORGH0LQXWDGH&RQWUDWRSDUD)RUQHFLPHQWR([HFXomR
9DOHQoD%$GHMXOKRGH
0,&+(/$3$5(&,'23,172
$SURYDGR
$66(6625,$-85Ë',&$
3UHJRHLUR
3RUWDULDQžGH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
108 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,
7(502'(5()(5Ç1&,$
2%-(72
&2175$7$d­2 '( (035(6$ '2 5$02 '( $48,6,d­2 3$5&(/$'$ '(
*Ç1(526 $/,0(17Ë&,26 3(5(&Ë9(,6 ( 1­2 3(5(&Ë9(,6 48( 6(
'(67,1$5­2$$/,0(17$d­2(6&2/$5'$6(6&2/$6081,&,3$,6(&5(&+(6
081,&,3$,6 &21)250( '(6&5,d­2 ( 48$17,'$'(6 &2167$17(6 12
$1(;2
027,9$d­2-867,),&$7,9$
2 081,&Ë3,2 '( 9$/(1d$ 6(*81'2 2 6(162 (6&2/$5 '( &2035((1'(8 $/8126 0$75,&8/$'26 1$ 5('( 081,&,3$/ '(
(16,12 2 081,&Ë3,2 7(0 68$6 (6&2/$6 ',675,%8Ë'$6 (0 '(=
68%6,67(0$6 /2&$/,=$'26 1$ =21$ 585$/ &21+(&,'26 &202 %$,;­2
'(55$'(,5$ (1752&$0(172 *(5(%$ -(48,5,dÈ 0$5,&2$%2 252%Ï ,
252%Ï ,, 3,$8 ( 6(55$ *5$1'( &2035((1'(1'2 (6&2/$6 &5(&+( ( *,1È6,26 1$ 6('( (1&2175$06( &5(&+(6 0$17,'$6
3(/$35()(,785$(6&2/$6'2)81'$0(17$/*,1È6,26&5(&+(6
,167,78,d­2),/$175Ï3,&$3(67$/2==,(
2 352*5$0$ $(( 727$/,=$1'2 $/8126 '2 )81'$0(17$/ 35e
(6&2/$5 $/8126 (-$ $/8126 0$,6 ('8&$d­2 $/8126
&5(&+(6$/8126(48,/20%2/$$/8126
',$17( '(67( (;32672 6( )$= 1(&(66È5,2 $ &2035$ '( *Ç1(526
$/,0(17Ë&,26 3$5$ 6835,5 $6 1(&(66,'$'(6 1875,&,21$,6 '(67$
&/,(17(/$ '$6 48$,6 08,7$6 1(&(66,7$0 '(67$ $/,0(17$d­2 3$5$ 2
'(6(03(1+2(6&2/$5
2 352*5$0 1$&,21$/ '( $/,0(17$d­2 (6&2/$5 e 80 '26 0$,6 $17,*26
12 48( 6( 5()(5( $ 683/(0(17$d­2 (6&2/$5 '2 3$Ë6 ( 2 0$,6 $17,*2
352*5$0$62&,$/'2*29(512)('(5$/1$È5($'(('8&$d­2325e0$
3$57,5 '( $ $/,0(17$d­2 (6&2/$5 3$6628 $ 6(5 ',5(,72
&2167,78&,21$/'(6'(231$(9(06(1'2*(5(1&,$'23(/2)1'(
$87$548,$9,1&8/$'$$20,1,67e5,2'$('8&$d­2
2 2%-(7,92 '2 31$( e 6835,5 12 0Ë1,02 '$6 1(&(66,'$'(6
1875,&,21$,6 ',$5,$6 '26 $/8126 &2175,%8,5 3$5$ $ 5('8d­2 '$
(9$6$® (6&2/$5 )$925(&(5 $ )250$d­2 '( %216 +È%,726
$/,0(17$5(6(0&5,$1d$6$'2/(6&(17(6($'8/726'23$Ë6
&203(7( $2 081,&Ë3,2 $75$9e6 '$ 6(&5(7$5,$ '( (8'8&$d­2 $
5(63216$%,/,'$'( '2 5(&(%,0(172 ( *(5(1&,$0(172 '$ 9(5%$
75$16)(5,'$3(/2)1'(3$5$$(;(&8d­2'231$(
3257$172(;,67($1(&(66,'$'('(&2175$7$d­2'((035(6$'25$02
'( $48,6,d­2 3$5&(/$'$ '( *Ç1(526 $/,0(17Ë&,26 3(5(&Ë9(,6 ( 1­2
3(5(&Ë9(,6 48( 6( '(67,1$5­2 $ $/,0(17$d­2 (6&2/$5 '$6 (6&2/$6
081,&,3$,6(&5(&+(6081,&,3$,6&21)250('(6&5,d­2(48$17,'$'(6
&2167$17(612$1(;2
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
109 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
%$6(/(*$/
$ &2035$ '26 $/,0(1726 '(9(5È 2%6(59$5 26 &5,7e5,26 (
02'$/,'$'(6 35(9,67$6 1$ /(, 48( ,167,78, 1250$6 3$5$
/,&,7$d®(6(&2175$726'$$'0,1,675$d­238%/,&$
1$ $%(5785$ '2 352&(662 '( /,&,7$d­2 26 5(63216$9(,6 3(/$
&2035$ '$ 0(5(1'$ '(9(5­2 )$=(5 80$ '(6&5,d­2 '(7$/+$'$ '26
$/,0(172648(48(5(0&2035$5'(),1,1'2$(63(&,),&$&$2&203/(7$
'2 %(0 $ 6(5 $'48,5,'2 $ 48$17,'$'( 1(&(66$5,$ (0 )81d­2 '2
35(3$52 ( '2 &216802 3(/26 $/8126 ( $6 &21',d®(6 '(
$50$=(1$0(17248(1­23(50,7$0$'(7(5,25,=$d­2'26352'8726
(63(&,),&$d®(67e&1,&$6
Lote:
Item
1
2
3
Lote:
Item
1 GÊNEROSALIMENTÍCIOS
DescriçãoDetalhada
ALMONDEGAS AO MOLHO IGREDIENTES
BÁSICOS: CARNE BOVINA, ACRESCIDA DE
SAL, FARINHA DE ROSCA, ALHO, CEBOLA, E
CONDIMENTOS PERMITIDOS, PODENDO
CONTER AÇUCAR. APRESENTASE SOB A
FORMA ARREDONDADA, INTEGRA DE
CONSISTÊNCIA PRÓPRIA E MOLHO DE
TOMATE(ÁGUAPOLPADETOMATE,AMIDO,
CEBOLA, AÇUCAR, ALHO E SAL). NÃO PODE
CONTER SOJA. O PRODUTO DEVERÁ TER
REGISTRONOMINISTERIODAAGRICULTURA
E/OU MINISTERIO DA SAÚDE LATA DE 0,83
136477 KGOU1KG.
EXTRATO DE TOMATE INGREDIENTES:
TOMATE, AÇÚCAR ( MÁXIMO DE 1%), SAL (
MÁXIMO DE 5% DE CLORETO DE SÓDIO).
PRODUTOINSETODEFERMENTAÇÃOENÃO
DEVE
INDICAR
PROCESSAMENTO
DEFEITUOSO. EMBALAGEM COM DADOS DE
17491 IDENTIFICAÇÃODOPRODUTO.LATADE350G
VINAGRE DE ÁLCOOL COMPOSIÇÃO:
FERMENTADOACETICODEÁLCOOLE ÁGUA.
CONSERVANTE: METABISSULFITO DE SÓDIO.
ACIDEZ VOLÁTIL 4,0%, NÃO CONTÉM
12569 GLÚTEN–GARRAFACOM500ML
Código
Código
2 HORTIFRUTI
DescriçãoDetalhada
Unidade
Qtde
KG
7200
LT
4000
GF
2300
Unidade
Qtde
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
110 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
1
CENOURARAIZTUBEROSA,SUCULENTA,DE
TAMANHOMÉDIONOESTADOINNATURA,
GENUÍNAS,SÃS,DEPRIMEIRAQUALIDADE,
ESCOVADA,COLORAÇÃOUNIFORME;
ISENTASDESUJIDADES,INSETOS,PARASITAS,
LARVASECORPOSESTRANHOSADERIDOSÀ
SUPERFÍCIEEXTERNA.NÃODEVE
APRESENTARQUAISQUERLESÕESDE
ORIGEMFÍSICA,MECÂNICAOU
141260 BIOLÓGICA.SACODENYLON20kG
KG
4500
35$=2/2&$/&21',d®(6'((175(*$((;(&8d­2
235$=2'((175(*$e'(&,1&20(6(63$5&(/$'2&21)250(
62/,&,7$d­20(16$/'26(725'$$/,0(17$d®(6&2/$5$3Ï6$
62/,&,7$d­2'26*Ç1(526$/,0(17Ë&,262)251(&('257(5È8035$=2
'(',$6&255,'263$5$$(175(*$'23(','2
2/2&$/'((175(*$1$,17(*5$'$0(5&$'25,$6(5È12$/02;$5,)$'2
&(175$/ '$ $/,0(17$d­2 (6&2/$5 6,78$'2 12 &(1752 '( 9$/(1d$%$
&$62 2&255$ 3(1'Ç1&,$6 '85$17( $ (175(*$ $ (035(6$ 6(
5(63216$%,/,=$5È3(/$68$',675,%8,d­21$6(6&2/$61235$=2'(
+25$6
2 +25È5,2 '( (175(*$ '$6 0(5&$'25,$6 12 &$62 *Ç1(526
$/,0(17Ë&,26 6(5È '$6 ¬6 ( '$6 ¬6 +25$6 '( 6(*81'$ ¬
48,17$)(,5$9e63(5$'()(5,È'26'$6¬6+25$6
352'87263(5(&Ë9(,6±+257,)587
'HYLGR D JUDQGH GHPDQGD HVFRODU ID]VH QHFHVViULR TXH R IRUQHFHGRU GLVSRQKD
GH XP ORFDO SDUD GLVWULEXLomR GLiULD H DUPD]HQDPHQWR DGHTXDGR GD GLVWLQWD
PHUFDGRULD
$PHUFDGRULDGHYHUiVHUHQWUHJXHYH]HVSRUVHPDQDFRQIRUPHDVROLFLWDomRGR
VHWRUHHQWUHJXHQDVHVFRODVGD]RQDUXUDODVTXDLVVHUmRSDVVDGRVRVHQGHUHoRV
HTXDQWLGDGHVSHORVHWRUGDPHUHQGDQRDWRGDSULPHLUDHQWUHJD
(VWHVJrQHURVGHYHUmRVHUHQWUHJXHVDFRQGLFLRQDGRVHPPRQREORFRVGHSROLHWLOHQRRV
TXDLVVHUmRGHL[DGRVFRPDHVFRODDWpRSRVVtYHOHVYD]LDPHQWRGDPHUFDGRULD
2V JrQHURV GHYHUmR REHGHFHU DR JUDX GH PDWXUDomR GR YHJHWDO SDUD QmR VHUHP
HQWUHJXHVPHUFDGRULDVPXLWRPDGXUDVHHYLWDURVGHVSHUGtFLRV
352'8726(672&È9(,6
2V SURGXWRV TXH SRVVXHP HVWDELOLGDGH TXDQGR HVWRFDGRV j WHPSHUDWXUD DPELHQWH
GHYHPDSUHVHQWDVH FRPHPEDODJHQVtQWHJUDVDSURSULDGDV SDUDFDGDWLSRFRPSUD]R
GHYDOLGDGHUHFRPHQGDGDVFRQIRUPHQDWXUH]DGRSURGXWR/RWHFRPSRVLomRGRSURGXWR
Qž GH UHJLVWUR GR yUJmR RILFLDO &*& HQGHUHoR GR IDEULFDQWH FRQGLo}HV GH
DUPD]HQDPHQWRHTXDQWLGDGHVSHVRGDGRVMiGHVFULWRVHPILFKDVWpFQLFDVPDVTXH
GHYHP VHU FRQIHULGRV 3RUpP WRGDV DV LQIRUPDo}HV FRQWLGDV QDV HPEDODJHQV QmR
GHYHUmRHVWDUVREDIRUPDGHHWLTXHWDV
2V YLGURV RX JDUUDIDV QmR GHYHP DSUHVHQWDU YD]DPHQWR QDV WDPSDV IRUPDomR GH
HVSXPDVRXTXDOTXHURXWURVLQDOGHDOWHUDomRGRVSURGXWRV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
111 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
)LFD UHVHUYDGR DR 6HWRU GH $OLPHQWDomR (VFRODU R GLUHLWR GH YLVLWDU R DOPR[DULIDGR
FHQWUDO GRV IRUQHFHGRUHV RX D iUHD GH SURGXomR GRV JrQHURV DOLPHQWtFLRV DGTXLULGRV
SDUDVXSULUDQHFHVVLGDGHGDDOLPHQWDomRHVFRODUVHPSUHTXHDFKDUQHFHVViULR
2V SURGXWRV GHYHUmR VHU HQWUHJXHV FRQIRUPH DV HVSHFLILFDo}HV GR HGLWDO RX VHMD DV
DPRVWUDV DSUHVHQWDGDV QD OLFLWDomR GHYHUmR VHU HQWUHJXHV SRU WRGR R SHUtRGR GH
GLVWULEXLomR
$ PHUFDGRULD HQWUHJXH QR DOPR[DULIDGR FHQWUDO GHYHUi VHU DFRPSDQKDGD GDV GHYLGDV
QRWDV ILVFDLV H GRFXPHQWDo}HV QHFHVViULDV VROLFLWDGD SHOR 6HWRU GH /LFLWDomR
FDVR FRQWUiULR QmR VHUmR DFHLWDV ILFDQGR R IRUQHFHGRU UHVSRQViYHO SHORV SRVVtYHLV
GDQRVRFDVLRQDGRVQDGLVWULEXLomRGDPHUHQGD
5(63216È9(/3(/25(&(%,0(1727(/()21((0$,/
26(725'($/,0(17$d­2(6&2/$5e&20326723(/26(*8,17(48$'52
5(63216È9(/7e&1,&2085,21(,&Ï'$6,/9$1875,&,21,67$&51
7(/28HPDLO(GXFDFDR#YDOHQFDEDJRYEU
48$/,),&$d­27e&1,&$32/,$11$/$:,16&.<'(025$(61875,&,21,67$
&51
7(/28HPDLOHGXFDFDR#YDOHQFDEDJRYEU
&225'(1$'25$'26(7250$5,$$8;,/,$'25$'26$1-266,/9$
7(/7(/28HPDLOHGXFDFDR#YDOHQFDEDJRYEU
(67248,67$6$'5,$12$/(;$181&,$d­25$1*(/
7(/28HPDLO(GXFDFDR#YDOHQFDEDJRYEU
',*,7$'25$,5$&(0$6286$$66,6
7(/28HPDLO(GXFDFDR#YDOHQFDEDJRYEU
48$/,),&$d­27e&1,&$
'( $&25'2 &20 $6 '(7(50,1$d®(6 '2 352*5$0$ '( $/,0(17$d­2
(6&2/$5&217,'$61$5(62/8d­2&')1'(1ž'('(-8/+2'(
48((67$%(/(&($61250$63$5$(;(&8d­2'2352*5$0$7Ï3,&29,,±
'2&21752/('(48$/,'$'('$$/,0(17$d­2(6&2/$5
$48$/,'$'('26$/,0(17261­26((1&(55$1$$9$/,$d­2'2352'872
'85$17( $ $48,6,d­2 0$6 35(9Ç 7$0%(0 $ *$5$17,$ '( &21',d®(6
+,*,(1,&2 6$1,7È5,$6 $'(48$'$6 '85$17( 75$163257( (672&$*(0
35(3$52 ( 0$186(,2 $7e 2 6(8 &216802 3(/$6 &5,$1d$6 (
$'2/(6&(17(6 3257$172 $ (17,'$'( (;(&8725$ '(9( 35(9(5 126
(',7$,6 ( &2175$726 $ 5(63216$%,/,'$'( '26 )251(&('25(6 3(/$
48$/,'$'( ( +,*,(1( '2 352'872 %(0 &202 (;,*,5 126 (',7$,6
$02675$6 '26 *Ç1(526 $/,0(17Ë&,26 3$5$ $1È/,6(6 ( $75$9e6 '(
$7(67$'26 $1$/,6( '2 /$8'2 %520$72/Ï*,&2 ),&+$ 7e&1,&$ $/9$5È
6$1,7È5,2($&203529$d­2-8172¬6$8725,'$'(66$1,7È5,$6/2&$,6
'(,167$/$d®(6&203$7Ë9(,6&202352'872
6(5­2(;,*,'26),&+$7e&1,&$(/$8'2%520$72/Ï*,&2'266(*8,17(6
352'8726
),&+$7e&1,&$
/$8'2%520$72/Ï*,&228
),&+$'(,163(d­26$1,7È5,$
$/021'(*$6
$/021'(*$6
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
112 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
(;75$72'(720$7(
9,1$*5('(È/&22/
(;75$72'(720$7(
9,1$*5('(È/&22/
085,21(,&Ï'$6,/9$
1875,&,21,67$
&51
32/,$11$/$:,16&.<'(025$(6
1875,&,21,67$
&51
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
113 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,,
SDSHOWLPEUDGRGDHPSUHVD
02'(/23523267$'(35(d26
/LFLWDomR1ž309%$0RGDOLGDGH35(*­235(6(1&,$/7,320(12535(d2
*/2%$/325/27(
6HVVmR3~EOLFDjVKRUDV
/RFDO6HWRUGH/LFLWDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDVLWXDGDD7UDYHVVD*HQHUDO/DEDWXW61
&HQWUR9DOHQoD±%DKLD
,'(17,),&$d­2'$352321(17(
5D]mR6RFLDOBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&13-BBBBBBBBBBBBBBBBBBBBBBBBBB
2SWDQWHSHOR6,03/(6"6LP1mR
(QGHUHoRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
%DLUUR&LGDGHBBBBBBBBBBBBBBBBBBBBBBBBBBBBB&(3BBBBBBBBBBBBBBBBBBB
7HOHIRQH)D[BBBBBBBBBBBBBBBBBBBBBBBBB
%DQFR&RQWD%DQFiULDBBBBBBBBBBBBBBBBBBBBBBB
1RPHHQžGD$JrQFLDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
,WHP 4WGH 8QLG
'HVFULomR
0DUFD
9DORU
9DORU7RWDO
0RGHOR
8QLWiULR
$HPSUHVDGHFODUDTXHHVWmRLQFOXVDVQRYDORUFRWDGRWRGDVDVGHVSHVDV
FRPPmRGHREUDHEHPFRPRWRGRVRVWULEXWRVHHQFDUJRVILVFDLVVRFLDLVWUDEDOKLVWDVSUHYLGHQFLiULRV
HFRPHUFLDLV
(VWDQGR GH DFRUGR FRP RV WHUPRV GR DWR FRQYRFDWyULR H FRP D OHJLVODomR QHOH LQGLFDGD SURSRPRV RV
YDORUHVDFLPDFRPDYDOLGDGHGDSURSRVWDGHBBBBBBBBBGLDVH3UD]RGH([HFXomRLPHGLDWRDFRQWDU
GD2UGHPGH6HUYLoRFRQIRUPHHGLWDO
/RFDOHGDWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&DULPERGDHPSUHVD$VVLQDWXUDGRUHVSRQViYHO
2EV 6HUmR GHVFODVVLILFDGDV DV SURSRVWDV TXH DSUHVHQWDUHP FRWDo}HV FRQWHQGR SUHoRV H[FHVVLYRV
VLPEyOLFRVGHYDORU]HURRXLQH[HTtYHLVQDIRUPDGDOHJLVODomRHPYLJRURXDLQGDTXHRIHUHoDPSUHoRV
RXYDQWDJHQVEDVHDGDVQDVRIHUWDVGRVGHPDLVOLFLWDQWHV
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
114 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,,,
0RGHORGH&DUWDGHFUHGHQFLDPHQWR
3DSHO7LPEUDGRGDHPSUHVD
¬
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
7,320(12535(d2*/2%$/325/27(
,QGLFDPRV R D 6U D BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU D GD FpGXOD GH
LGHQWLGDGH QžBBBBBBBBBBBBBBBBBBBBBBBB yUJmR H[SHGLGRU BBBBBBBBBBBBBBBBBBBBBB FRPR
QRVVR UHSUHVHQWDQWH OHJDO QD /LFLWDomR HP UHIHUrQFLD SRGHQGR UXEULFDU D GRFXPHQWDomR GH
+$%,/,7$d­2 H GDV 3523267$6 PDQLIHVWDU SUHVWDU WRGRV RV HVFODUHFLPHQWRV j QRVVD
3URSRVWD LQWHUSRU UHFXUVRV GHVLVWLU GH SUD]RV H UHFXUVRV HQILP SUDWLFDU WRGRV RV DWRV
QHFHVViULRVDRILHOFXPSULPHQWRGRSUHVHQWH&UHGHQFLDPHQWR
$WHQFLRVDPHQWH
QRPHHIXQomRQDHPSUHVD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
115 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,9
02'(/2'('(&/$5$d­2
3DSHOWLPEUDGRGDHPSUHVD
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
'(&/$5$d­2
$BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQVFULWDDR&13-Qž
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBSRULQWHUPpGLRGHVHXUHSUHVHQWDQWHOHJDORD6UD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU D GD &DUWHLUD GH
,GHQWLGDGH QžBBBBBBBBBBBBBBBBBB H GR &3) Qž BBBBBBBBBBBBBBBBBBBBBBBBB '(&/$5$
VREDVSHQDVGDOHLTXHDWpDSUHVHQWHGDWDLQH[LVWHPIDWRVLPSHGLWLYRVSDUDVXDKDELOLWDomRQR
SUHVHQWH SURFHVVR OLFLWDWyULR FLHQWH GD REULJDWRULHGDGH GH GHFODUDU RFRUUrQFLDV SRVWHULRUHV H
SDUDILQVGRGLVSRVWRQRLQFLVR9GRDUWGD/HLQžGHGHMXQKRGHDFUHVFLGR
SHOD /HL Qž GH GH RXWXEUR GH TXH QmR HPSUHJD PHQRU GH GH]RLWR DQRV HP
WUDEDOKR QRWXUQR SHULJRVR RX LQVDOXEUH H QmR HPSUHJD PHQRU GH GH]HVVHLV DQRV UHVVDOYD
HPSUHJDPHQRUDSDUWLUGHTXDWRU]HDQRVQDFRQGLomRGHDSUHQGL]HTXHQmRSRVVXLHPVHX
TXDGUR GH SHVVRDO VHUYLGRUHV S~EOLFRV H[HUFHQGR IXQo}HV WpFQLFDV FRPHUFLDLV GH JHUrQFLD
DGPLQLVWUDomRRXWRPDGDGHGHFLVmRLQFLVR,,,GRDUWžGD/HL
/RFDOHGDWD
$VVLQDWXUDHLGHQWLILFDomRGRUHVSRQViYHOSHODHPSUHVD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
116 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29
3DSHOWLPEUDGRGDHPSUHVD
0RGHOR GH 'HFODUDomR GDQGR FLrQFLD GH TXH FXPSUH SOHQDPHQWH RV UHTXLVLWRV GH
KDELOLWDomR)25$'26(19(/23(6³´H³´
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
'HFODUDPRVHPDWHQGLPHQWRDRSUHYLVWRQRLWHPGRHGLWDOGH3UHJmRQƒ309%$
TXHFXPSULPRVSOHQDPHQWHRVUHTXLVLWRVGHKDELOLWDomRH[LJLGRVSDUDSDUWLFLSDomRQRSUHVHQWH
FHUWDPH
/RFDOHGDWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$VVLQDWXUDHFDULPER
UHSUHVHQWDQWHOHJDO
2EV$VHUHQWUHJXHMXQWRFRPRVHQYHORSHVHTXDQGRGHFODUDGDDEHUWDDVHVVmRSHOR
SUHJRHLUR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
117 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,
02'(/2'($7(67$'2'(&$3$&,'$'(7e&1,&$
7LPEUHORJRPDUFDGDHPSUHVDHPLWHQWH±&13-
$
35()(,785$081,&,3$/'(9$/(1d$
5()35(*­235(6(1&,$/1ž309%$
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDWHVWDSDUDRVGHYLGRVILQVTXHD
(PSUHVDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
FRP
VHGH
QD
BBBBBBBBBBBBBBBBBBBBBBB IRUQHFHXIRUQHFH RV SURGXWRV $%$,;2 5(/$&,21$'26 VHQGR
FXPSULGRUDGRVSUD]RVHWHUPRVILUPDGRVQDFRQWUDWDomRQmRKDYHQGRFRQWUDDPHVPDQHQKXP
UHJLVWURTXHDGHVDERQH
5HODomRGRVSURGXWRVIRUQHFLGRV
D
E
F
/RFDOH'DWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1RPHFRPSOHWRSRUH[WHQVRGRUHVSRQViYHOSHOD3HVVRD-XUtGLFDHPLWHQWHGHVWH
DWHVWDGRHVXDDVVLQDWXUD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
118 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,,
02'(/2'('(&/$5$d­2'(
0,&52(035(6$((035(6$'(3(48(123257(
7LPEUHORJRPDUFDGDHPSUHVDHPLWHQWH±&13-
$
35()(,785$081,&,3$/'(9$/(1d$
5()5(*­235(6(1&,$/1ž309%$
$HPSUHVDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQVFULWDQR&13-0)VRER
Qž
BBBBBBBBBBBBBBBBBBBBBBB
SRU
VHX
UHSUHVHQWDQWH
OHJDO
RD
6UD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SRUWDGRU GD &pGXOD GH ,GHQWLGDGH Qž
BBBBBBBBBBBBBBBBBBBHGR&3)0)QžBBBBBBBBBBBBBBBBBBBBGHFODUDVREDVSHQDVGDOH
H VHP SUHMXt]R GDV SHQDOLGDGHV SUHYLVWDV QHVWH HGLWDO TXH p ³PLFURHPSUHVD RX HPSUHVD GH
SHTXHQR SRUWH´ QRV WHUPRV GR HQTXDGUDPHQWR SUHYLVWR D /HL &RPSOHPHQWDU Qž GH GH
GH]HPEUR GH TXH FRQKHFH QD tQWHJUD H HVWi SRUWDQWR DSWD D H[HUFHU R GLUHLWR GH
SUHIHUrQFLDFRPRFULWpULRGHGHVHPSDWHQRSUHJmRSUHVHQFLDOQž309%$
/RFDOH'DWD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1RPHFRPSOHWRSRUH[WHQVRGRUHVSRQViYHOSHOD3HVVRD-XUtGLFDHPLWHQWHGHVWHDWHVWDGRHVXD
DVVLQDWXUD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
119 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;29,,,
0,187$'$$7$'(5(*,6752'(35(d26'235(*­235(6(1&,$/1ž
$RV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBD
35()(,785$
081,&,3$/ '( 9$/(1d$ FRP VHGH D 7UDYHVVD *HQHUDO /DEDWXW VQž H IRUR HP 9DOHQoD
%DKLD LQVFULWD QR &13- VRE R Qž R 3UHJRHLUR QRV WHUPRV GR 'HFUHWR
0XQLFLSDOQžGHGHIHYHUHLURGH'HFUHWRQžGHGHMXOKRGHHGRV
'HFUHWRVGHGHDJRVWRGHLQWHJUDQWHVGRSUHVHQWHDMXVWHGLDQWHGRGLVSRVWRQR
DUWLJRGD/HLQžGHGHMXQKRGHHGHPDLVQRUPDVOHJDLVDSOLFiYHLVHPIDFH
GD FODVVLILFDomR GDV 3URSRVWDV DSUHVHQWDGDV UHVROYH 5(*,675$5 35(d26 SDUD HYHQWXDO
FRQWUDWDomRGHHPSUHVDHVSHFLDOL]DGDSDUDIRUQHFLPHQWRGH*Ç1(526$/,0(17Ë&,26TXHVH
GHVWLQDUmR D PHUHQGD HVFRODU GD UHGH PXQLFLSDO GH HQVLQR SDUD DWHQGHU DV QHFHVVLGDGHV GD
6HFUHWDULD GH (GXFDomR GHVWH 0XQLFtSLR GH 9DOHQoD%$ GH DFRUGR DV FRQGLo}HV H
HVSHFLILFDo}HVFRQVWDQWHVQR7HUPRGH5HIHUrQFLDHGHPDLVGLVSRVLo}HVIL[DGDVQHVWH(GLWDOH
VHXV $QH[RV GXUDQWH R SHUtRGR GH YDOLGDGH GD SUHVHQWH $7$ '( 5(*,6752 '( 35(d26
RIHUHFLGRV SHODV HPSUHVDV FODVVLILFDGDV HP
SULPHLUR OXJDU SDUD RV LWHQV DEDL[R GLVFULPLQDGRV H SHODV HPSUHVDV UHPDQHVFHQWHV
H QD RUGHP VXFHVVLYD GH FODVVLILFDomR
REVHUYDGDVDVFRQGLo}HVGR(GLWDOTXHUHJHR3UHJmR3UHVHQFLDOQž
,7(0 '(6&5,d­2
81,'$'( 48$17
35(d2
'(7(1725$
81,7È5,2
&/È868/$,±'2635$=26(35(d26
3UD]RGHHQWUHJDGRVPDWHULDLVHRXH[HFXomRGRVVHUYLoRVQmRVXSHULRUDKTXDUHQWDHRLWR
KRUDVFRQWDGRGRUHFHELPHQWRGD2UGHPGH)RUQHFLPHQWR6HUYLoR
$ SUHVHQWH $WD WHP YDOLGDGH GH XP DQR D SDUWLU GD GDWD GH VXD DVVLQDWXUD SRGHQGR VHU
SURUURJDGDjFULWpULRGD$GPLQLVWUDomR
2VSUHoRVUHJLVWUDGRVVHUmRIL[RVHLUUHDMXVWiYHLVGXUDQWHDYLJrQFLDGDSUHVHQWH$WDGH5HJLVWUR
GH3UHoRV
$VHPSUHVDVGHWHQWRUDVGRUHJLVWURDVVXPHPRFRPSURPLVVRGHIRUQHFHURVSURGXWRV
VROLFLWDGRVHH[HFXWDURVVHUYLoRVQDVTXDQWLGDGHVGHILQLGDVQRVSHGLGRVDVHUHP
HPLWLGRV SHOR 0XQLFtSLR GH 9DOHQoD%$ SHORV SUHoRV UHJLVWUDGRV H QDV FRQGLo}HV
FRQVWDQWHVGRHGLWDOGXUDQWHRSUD]RGHYDOLGDGHGHVWD$WDGH5HJLVWURGH3UHoRV
'XUDQWH D YLJrQFLD GD $WD GH 5HJLVWUR GH 3UHoRV DV HPSUHVDV GHWHQWRUDV GHYHUimR D
FDGD IDWXUDHPLWLGD FRPSURYDU VXDV UHJXODULGDGHV SHUDQWH R 6LVWHPD GH 6HJXULGDGH 6RFLDO
,166HR)XQGRGH*DUDQWLDSRU7HPSRGH6HUYLoR)*76
&/È868/$,,±'$&2175$7$d­2
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
120 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
$FRQWUDWDomRFRPRVIRUQHFHGRUHVUHJLVWUDGRVVHUiIRUPDOL]DGDSHOR0XQLFtSLRGH9DOHQoDSRU
LQWHUPpGLRGHLQVWUXPHQWRFRQWUDWXDOHPLVVmRGHQRWDGHHPSHQKRGHGHVSHVDDXWRUL]DomRGH
FRPSUDRXRXWURLQVWUXPHQWRKiELOFRQIRUPHRDUWGD/HLQžGH
$ H[LVWrQFLD GH 3UHoRV 5HJLVWUDGRV QmR REULJD R 0XQLFtSLR D ILUPDU DV FRQWUDWDo}HV TXH HOHV
SRGHUmRDGYLU
1D KLSyWHVH GR )251(&('25 SULPHLUR FODVVLILFDGR WHU VHX UHJLVWUR FDQFHODGR QmR DVVLQDU
QmR DFHLWDU RX QmR UHWLUDU R FRQWUDWR QR SUD]R H FRQGLo}HV HVWDEHOHFLGDV SRGHUmR VHU
FRQYRFDGRV RV IRUQHFHGRUHV UHPDQHVFHQWHV QD RUGHP GH FODVVLILFDomR SDUD ID]rOR HP LJXDO
SUD]R H QDV FRQGLo}HV SURSRVWDV SHOR SULPHLUR FODVVLILFDGR LQFOXVLYH TXDQWR DR SUHoR
LQGHSHQGHQWHPHQWHGDFRPLQDomRSUHYLVWDQR$UWLJRGD/HL
2EVHUYDGRV RV FULWpULRV H FRQGLo}HV HVWDEHOHFLGRV QR HGLWDO R 0XQLFtSLR SRGHUi FRPSUDU GH
PDLVGHXPIRUQHFHGRUUHJLVWUDGRVHJXQGRDRUGHPGHFODVVLILFDomRGHVGHTXHDVUD]}HVGH
LQWHUHVVHS~EOLFRMXVWLILTXHPHTXHRSULPHLURFODVVLILFDGRQmRSRVVXDIRUQHFLPHQWRFRPSDWtYHO
FRPRVROLFLWDGRSHOR0XQLFtSLRREVHUYDGRjVFRQGLo}HVGRHGLWDOHR3UHoR5HJLVWUDGR
$ILVFDOL]DomRVHUiH[HUFLGDSHOD6HFUHWDULDVROLFLWDQWH
&/È868/$,,,±'$(175(*$
$V HQWUHJDV HRX H[HFXomR GRV VHUYLoRV VHUmR HIHWXDGRV FRQIRUPH VROLFLWDomR GR 0XQLFtSLR
VHQGRTXHRSUD]RGHHQWUHJDH[HFXomRQmRVHUiVXSHULRUjKTXDUHQWDHRLWRKRUDVDSyVR
UHFHELPHQWRGD1RWDGH(PSHQKR
&DVRRVSURGXWRVQmRFRUUHVSRQGDPDRH[LJLGRSHORHGLWDORIRUQHFHGRUGHYHUiSURYLGHQFLDUQR
SUD]RPi[LPRGHDWpTXDUHQWDHRLWRKRUDVDVXDVXEVWLWXLomRYLVDQGRDRDWHQGLPHQWRGDV
HVSHFLILFDo}HVVHPSUHMXt]RGDLQFLGrQFLDGDVVDQo}HVSUHYLVWDVQRHGLWDOHQD/HL
&/È868/$,9±'$66$1d®(6
3HODLQH[HFXomRWRWDORXSDUFLDOGRREMHWRFRQWUDWDGRD$GPLQLVWUDomRSRGHUiJDUDQWLGD
DSUpYLDGHIHVDDSOLFDUj&2175$7$'$DVVHJXLQWHVVDQo}HV
DDGYHUWrQFLD
E PXOWD GH XP SRU FHQWR DR GLD VREUH R YDORU GR FRQWUDWR SRU GLD GH DWUDVR QD
H[HFXomRHRXIRUQHFLPHQWRDWpRžYLJpVLPRGLD
F PXOWD GH YLQWH SRU FHQWR VREUH R YDORU GR FRQWUDWR D SDUWLU GR ž YLJpVLPR
SULPHLUR GLD SHOR DWUDVR QR IRUQHFLPHQWR HRX H[HFXomR IDFXOWDGD D UHVFLVmR FRQWUDWXDO VHP
SUHMXt]RGDVGHPDLVSHQDOLGDGHVSUHYLVWDVQD/HLQž
GSHORVPRWLYRVTXHVHVHJXHPSULQFLSDOPHQWHD&2175$7$'$HVWDUiVXMHLWDjPXOWD
WUDWDGDQHVWD&OiXVXOD
ƒ SHODUHFXVDLQMXVWLILFDGDGHUHFHEHUD1RWDGH(PSHQKRHDVVLQDUR&RQWUDWR
ƒ SHORDWUDVRQDHQWUHJDGRIRUQHFLPHQWRHPUHODomRDRSUD]RSURSRVWRHDFHLWRH
ƒ SHOD QmR HQWUHJD GR IRUQHFLPHQWR FDUDFWHUL]DQGRVH D IDOWD VH D HQWUHJD QmR VH
HIHWLYDUGHQWURGRVTXLQ]HGLDVTXHVHVHJXLUHPDRWpUPLQRGRSUD]RSURSRVWRHDFHLWR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
121 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
H $ FULWpULR GD $GPLQLVWUDomR SRGHUmR VHU VXVSHQVDV DV SHQDOLGDGHV QR WRGR RX HP
SDUWH TXDQGR R DWUDVR GR IRUQHFLPHQWR GRV SURGXWRV IRU GHYLGDPHQWH MXVWLILFDGR SHOD
&2175$7$'$HDFHLWRSHOD$GPLQLVWUDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDTXHIL[DUiQRYR
SUD]RHVWHLPSURUURJiYHOSDUDDFRPSOHWDH[HFXomRGDVREULJDo}HVDVVXPLGDV
&/È868/$9±'$5(6&,6­2&2175$78$/
$ LQH[HFXomR WRWDO RX SDUFLDO GHVWH &RQWUDWR HQVHMD D VXD UHVFLVmR FRQIRUPH GLVSRVWR QRV
DUWLJRVDGD/HL
&DVRD&RQWUDWDQWHQmRVHXWLOL]HGDSUHUURJDWLYDGHUHVFLQGLUD$WDGH5HJLVWURGH3UHoRVDVHX
H[FOXVLYRFULWpULRSRGHUiVXVSHQGHUDVXDH[HFXomRHRXVXVWDURSDJDPHQWRGDV)DWXUDVDWp
TXH D &RQWUDWDGD FXPSUD LQWHJUDOPHQWH D FRQGLomR FRQWUDWXDO LQIULQJLGD VHP SUHMXt]R GD
LQFLGrQFLDGDVVDQo}HVSUHYLVWDVQRHGLWDOHQD/HL
$ UHVFLVmR SRGHUi VHU 8QLODWHUDO $PLJiYHO RX -XGLFLDO QRV WHUPRV H FRQGLo}HV SUHYLVWDV QR
$UWLJRGD/HL
&/È868/$9,±'2&$1&(/$0(172'25(*,6752'(35(d26
25HJLVWURGH3UHoRVGRIRUQHFHGRUSRGHUiVHUFDQFHODGRJDUDQWLGDSUpYLDGHIHVDQRSUD]RGH
FLQFRGLDV~WHLVDFRQWDUGRUHFHELPHQWRGDQRWLILFDomRQDVVHJXLQWHVKLSyWHVHV
,±3HOR0XQLFtSLR
D2IRUQHFHGRUQmRFXPSULUDVH[LJrQFLDVFRQWLGDVQR(GLWDORX$WDGH5HJLVWURGH3UHoRV
E 2 IRUQHFHGRU GHU FDXVD j UHVFLVmR DGPLQLVWUDWLYD GH FRQWUDWR GHFRUUHQWH GR 5HJLVWUR GH
3UHoRVSRUXPGRVPRWLYRVHOHQFDGRVQR$UWLJRGD/HLQž
F2V3UHoRV5HJLVWUDGRVVHDSUHVHQWDUHPVXSHULRUHVDRVSUDWLFDGRVQRPHUFDGR
G3RUUD]}HVGHLQWHUHVVHS~EOLFRGHYLGDPHQWHIXQGDPHQWDGRQDIRUPDGR,QFLVR;,,GR$UWLJR
GD/HLQžHDOWHUDo}HVSRVWHULRUHV
,,±3HOR)RUQHFHGRUTXDQGRPHGLDQWHVROLFLWDomRSRUHVFULWRFRPSURYDUHVWDULPSRVVLELOLWDGR
GHFXPSULUDVH[LJrQFLDVGRLQVWUXPHQWRFRQYRFDWyULRTXHGHXRULJHPDR5HJLVWURGH3UHoRV
2 FDQFHODPHQWR VHUi SUHFHGLGR GH 3URFHVVR $GPLQLVWUDWLYR D VHU H[DPLQDGR SHOR 0XQLFtSLR
VHQGRTXHDGHFLVmRILQDOGHYHUiVHUIXQGDPHQWDGD
$ VROLFLWDomR GR )251(&('25 SDUD FDQFHODPHQWR GR 5HJLVWUR GH 3UHoRV QmR GHVREULJD GR
IRUQHFLPHQWR GRV SURGXWRV DWp D GHFLVmR GR 0XQLFtSLR D TXDO GHYHUi VHU SURODWDGD QR SUD]R
Pi[LPRGHWULQWDGLDV
&/È868/$9,,±'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±)XQGR0XQLFLSDOGH(GXFDomR&ODVVLILFDomR(FRQ{PLFD±0DWHULDO
GH &RQVXPR 2EMHWR$WLYLGDGH ± 'LVWULEXLomR GH $OLPHQWDomR (VFRODU SDUD RV $OXQRV GD
5HGH3~EOLFDGH(QVLQR)RQWH
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
122 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
&/È868/$9,,,±'2)252
)LFD HOHLWR R IRUR GD &RPDUFD GH 9DOHQoD%$ SDUD GLULPLU G~YLGDV H TXHVW}HV RULXQGDV GD
SUHVHQWH$WDGH5HJLVWURGH3UHoRVFRPH[FOXVmRGHTXDOTXHURXWURSRUPDLVSULYLOHJLDGRTXH
VHMD
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
&13-1ž[[[[[[[[[[[[[[
(QGHUHoR[[[[[[[[[[[[[[
5HSUHVHQWDQWH[[[[[[[[[[[[[[[[
5*[[[[[[[
&3)[[[[[[[[[[[
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
&13-1ž[[[[[[[[[[[[[[
(QGHUHoR[[[[[[[[[[[[[[
5HSUHVHQWDQWH[[[[[[[[[[[[[[[[
5*[[[[[[[
&3)[[[[[[[[[[[
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
123 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
35(*­235(6(1&,$/1ž
$1(;2,;
0,187$&2175$721ž;;;;;;;;;;;;
&2175$72 3$5$ )251(&,0(172 3$5&(/$'2 '( 352'8726 28
(;(&8d­2'(6(59,d2648((175(6,&(/(%5$0$35()(,785$
081,&,3$/
'(
9$/(1d$
(
$
$35()(,785$081,&,3$/'(9$/(1d$FRPVHGHHIRURHP9DOHQoD%DKLDLQVFULWD
QR &13- VRE R Qž QHVWH DWR UHSUHVHQWDGD SRU VXD 3UHIHLWD -8&e/,$
6286$ '2 1$6&,0(172 EUDVLOHLUD FDVDGD SRUWDGRU GD FDUWHLUD GH LGHQWLGDGH Qž
663%$H&3)QžUHVLGHQWHHGRPLFLOLDGRQD5XD&LGDGHGR5LR
GH-DQHLURQž/RWHDPHQWR1RYR+RUL]RQWH9DOHQoD%DKLDQRXVRGHVXDVDWULEXLo}HVFRPR
3UHIHLWD H D HPSUHVD HVWDEHOHFLGD D
&13- QžUHVROYHP FHOHEUDU R
SUHVHQWH &RQWUDWR VXMHLWDQGRVH DV SDUWHV jV QRUPDV SUHYLVWDV QD /HL H DOWHUDo}HV
SRVWHULRUHV GH DFRUGR FRP R TXH FRQVWD QD 3UHJmR 3UHVHQFLDO Qž PHGLDQWH DV
&OiXVXODVHRX&RQGLo}HVVHJXLQWHV
&/È868/$35,0(,5$'22%-(72
2 SUHVHQWH FRQWUDWR WHP SRU REMHWR D FRQWUDWDomR GH HPSUHVD GR UDPR SDUD
IRUQHFLPHQWR GH *Ç1(526 $/,0(17Ë&,26 TXH VH GHVWLQDUmR D PHUHQGD HVFRODU GD UHGH
PXQLFLSDOGHHQVLQRSDUDDWHQGHUDVQHFHVVLGDGHVGD6HFUHWDULDGH(GXFDomRGHVWH0XQLFtSLR
GH9DOHQoD%$GHDFRUGRDVFRQGLo}HVHHVSHFLILFDo}HVFRQVWDQWHVQR7HUPRGH5HIHUrQFLDH
GHPDLVGLVSRVLo}HVIL[DGDVQHVWH(GLWDOHVHXV$QH[RV
68%&/È868/$Ò1,&$±9LQFXODPVHDRSUHVHQWHFRQWUDWRR3UHJmR3UHVHQFLDOQž
$WD GH 5HJLVWUR GH 3UHoRV EHP FRPR D SURSRVWD GD FRQWUDWDGD DPERV FRP VHXV $QH[RV H
GHPDLV GRFXPHQWRV RV TXDLV VH FRQVWLWXHP HP SDUWHV LQWHJUDQWHV GHVWH LQVWUXPHQWR
LQGHSHQGHQWHPHQWHGHWUDQVFULomR
&/È868/$6(*81'$'25(*,0('((;(&8d­2
2 REMHWR GHVWH FRQWUDWR VHUi UHDOL]DGR SRU H[HFXomR LQGLUHWD VRE R UHJLPH GH PHQRU
SUHoRJOREDOSRUORWH
&/È868/$7(5&(,5$'2$80(172286835(66­2
1R LQWHUHVVH GD $GPLQLVWUDomR GD 3UHIHLWXUD 0XQLFLSDO GH 9DOHQoD R REMHWR GHVWH
&RQWUDWR SRGHUi VHU DXPHQWDGR RX VXSULPLGR DWp R OLPLWH GH YLQWH H FLQFR SRU FHQWR
FRQIRUPHGLVSRVWRQRDUWLJRSDUiJUDIRVžHžGD/HLQž
68%&/È868/$ 35,0(,5$ $ &2175$7$'$ REULJDVH D DFHLWDU QDV PHVPDV
FRQGLo}HVOLFLWDGDVRVDFUpVFLPRVRXVXSUHVV}HVTXHVHIL]HUHPGHDWpYLQWHHFLQFRSRU
FHQWRGRYDORUFRQVWDQWHGDSURSRVWDGHYLGDPHQWHDWXDOL]DGDGHFRQIRUPLGDGHFRPRGLVSRVWR
QD&OiXVXOD'pFLPD
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
124 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
68%&/È868/$ 6(*81'$ QHQKXP DFUpVFLPR RX VXSUHVVmR SRGHUi H[FHGHU RV
OLPLWHV HVWDEHOHFLGRV QR SDUiJUDIR DQWHULRU VDOYR VH DV VXSUHVV}HV UHVXOWDUHP GH DFRUGR
FHOHEUDGRHQWUHRVFRQWUDWDQWHVFRQIRUPH$UWSDUiJUDIRžLQFLVR,,GD/HL
68%&/È868/$ 7(5&(,5$ DV HYHQWXDLV PRGLILFDo}HV GRV WHUPRV GHVWH &RQWUDWR
SRGHUmRVHUDOWHUDGRVFRPDVGHYLGDVMXVWLILFDWLYDVQRVFDVRVUHIHULGRVQR$UWLJRGD/HLQž
PHGLDQWH7HUPR$GLWLYR
&/È868/$48$57$'$62%5,*$d®(6'2&2175$7$17(
'XUDQWHDYLJrQFLDGHVWH&RQWUDWRR&2175$7$17(GHYHUi
DDFRPSDQKDUILVFDOL]DUHFRQIHULURVSURGXWRVVHUYLoRVRUDFRQWUDWDGRV
E HIHWXDU R SDJDPHQWR SHORV SURGXWRVVHUYLoRV GH DFRUGR FRP R HVWDEHOHFLGR QD
&OiXVXOD1RQDH
FUHMHLWDUQRWRGRRXHPSDUWHVRIRUQHFLPHQWRH[HFXomRHPGHVDFRUGRFRPRFRQWUDWR
&/È868/$48,17$'$62%5,*$d®(6'$&2175$7$'$
&DEHUij&RQWUDWDGDHQTXDQWRYLJRUDUHVWH&RQWUDWRDOpPGDVREULJDo}HVGR7HUPRGH
5HIHUrQFLDDVGHPDLVTXHVHVHJXHP
D UHDOL]DU R IRUQHFLPHQWR RX H[HFXomR GR VHUYLoR DR UHVSRQViYHO GR 6HWRU GD
3UHIHLWXUD0XQLFLSDOGHVWH0XQLFtSLRVHJXLQGRFURQRJUDPDGHHQWUHJD
E DSUHVHQWDU DQWHV GR IDWXUDPHQWR TXDGUR GHPRQVWUDWLYR GRV IRUQHFLPHQWRV SDUD
FRQIURQWRGHLQIRUPDo}HV
F FRPXQLFDU GH LPHGLDWR H SRU HVFULWR j &RQWUDWDQWH TXDOTXHU WLSR GH LUUHJXODULGDGH
TXHRFRUUDGXUDQWHDYLJrQFLDGHVWH&RQWUDWR
G IRUQHFHU DR &RQWUDWDQWH GH IRUPD UHJXODU H QDV TXDQWLGDGHV UHTXLVLWDGDV RV
SURGXWRVVHUYLoRVOLFLWDGRV
HDUFDUFRPRV{QXVUHIHUHQWHVDRIRUQHFLPHQWRRUDFRQWUDWDGRGHVGHRSDJDPHQWRGH
HQFDUJRVWUDEDOKLVWDVFRPHUFLDLVILVFDLVHSUHYLGHQFLiULRVQmRWUDQVIHULQGRSDUDD&RQWUDWDQWH
DUHVSRQVDELOLGDGHSRUVHXSDJDPHQWRQHPRQHUDURREMHWRGRFRQWUDWR
I UHVSRQGHU SHORV GDQRV FDXVDGRV GLUHWDPHQWH j $GPLQLVWUDomR RX D WHUFHLURV
GHFRUUHQWHV GH VXD FXOSD RX GROR QmR LQFOXLQGR RX UHGX]LQGR HVVD UHVSRQVDELOLGDGH j
ILVFDOL]DomRRXDRDFRPSDQKDPHQWRSHOR&2175$7$17(
J SURYLGHQFLDU D LPHGLDWD FRUUHomR GDV GHILFLrQFLDV DSRQWDGDV SHOR &2175$7$17(
TXDQWRDRIRUQHFLPHQWRGRREMHWRFRQWUDWDGR
K SUHVWDU WRGRV RV HVFODUHFLPHQWRV TXH IRUHP VROLFLWDGRV SHOD ILVFDOL]DomR GR
&2175$7$17(FXMDVUHFODPDo}HVVHREULJDDDWHQGHUSURQWDPHQWH
LPDQWHUGXUDQWHDH[HFXomRGRFRQWUDWRHPFRPSDWLELOLGDGHFRPDVREULJDo}HVSRUHOH
DVVXPLGDVWRGDVDVFRQGLo}HVGHKDELOLWDomRHTXDOLILFDomRH[LJLGDVQDOLFLWDomR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
125 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
M UHSDUDU FRUULJLU UHPRYHU RX VXEVWLWXLU jV VXDV H[SHQVDV QR WRWDO RX HP SDUWH R
REMHWRGRFRQWUDWRHPTXHVHYHULILFDUHPYtFLRVGHIHLWRVRXLQFRUUHo}HVUHVXOWDQWHVGRVSURGXWRV
HPSUHJDGRV
&/È868/$6(;7$'2$03$52/(*$/
$ ODYUDWXUD GR SUHVHQWH &RQWUDWR GHFRUUH GR 3UHJmR 3UHVHQFLDO Qž UHDOL]DGD
FRPIXQGDPHQWRQRV'HFUHWRV0XQLFLSDLVQžHD/HLQž
&/È868/$6e7,0$'29$/25
2YDORUGRSUHVHQWH&RQWUDWRpHVWLPDGRHP5DVHUSDJRFRQIRUPH
HQWUHJDGRVSURGXWRV
&/È868/$2,7$9$'25($-867(
2YDORUHVWLSXODGRQDSURSRVWDLQLFLDOSRGHUiVHUUHDMXVWDGRHPFRQIRUPLGDGHFRPR$UW
LQFLVR,,DOtQHD³G´GD/HLQž
&/È868/$121$'23$*$0(172
2SDJDPHQWRVHUiHIHWXDGRHPPRHGDFRUUHQWHQDFLRQDOGHIRUPDSDUFHODGDGHDFRUGR
FRP D TXDQWLGDGH GR SURGXWR HQWUHJXH HRX VHUYLoR H[HFXWDGR PHGLDQWH HPLVVmR GH RUGHP
EDQFiULD HP IDYRU GD &2175$7$'$ HP DWp WULQWD GLDV DSyV D DSUHVHQWDomR GD 1RWD
)LVFDO)DWXUDDFRPSDQKDGDGDVUHTXLVLo}HVHPLWLGDVQDIRUPDGR(GLWDOGH3UHJmR3UHVHQFLDO
QžGHYLGDPHQWHDWHVWDGDSRUVHUYLGRUGD3UHIHLWXUD0XQLFLSDOGH9DOHQoD
±+DYHQGRHUURQD1RWD)LVFDO)DWXUDRXFLUFXQVWkQFLDTXHDOLTXLGDomRGDGHVSHVDDTXHOD
VHUi GHYROYLGD H R SDJDPHQWR ILFDUi SHQGHQWH DWp TXH D &RQWUDWDGD SURYLGHQFLH DV PHGLGDV
VDQHDGRUDV 1HVWD KLSyWHVH R SUD]R SDUD R SDJDPHQWR LQLFLDUVHi DSyV D UHJXODUL]DomR GD
VLWXDomR HRX UHDSUHVHQWDomR GR GRFXPHQWR ILVFDO QmR DFDUUHWDQGR TXDOTXHU {QXV SDUD R
&RQWUDWDQWH
± 2 SDJDPHQWR GDV IDWXUDV TXDQGR KRXYHU UHDMXVWDPHQWR IDUVHi SRU PHLR GH GXDV
IDWXUDV XPD FRUUHVSRQGHQWH j SUySULD IDWXUD H RXWUD VXSOHPHQWDU UHIHUHQWH DR YDORU GR
UHDMXVWDPHQWR GHYLGR SRGHQGR DPEDV DV IDWXUDV WUDPLWDU FRQMXQWDPHQWH D FULWpULR GD
&RQWUDWDQWH
&/È868/$'e&,0$'$'27$d­225d$0(17È5,$
$VGHVSHVDVGHFRUUHQWHGHVWH&RQWUDWRFRUUHUmRjFRQWDGRVUHFXUVRVFRQVLJQDGRVSDUDR
H[HUFtFLRGHVREDVHJXLQWHFODVVLILFDomR
8QLGDGH±)XQGR0XQLFLSDOGH(GXFDomR&ODVVLILFDomR(FRQ{PLFD±0DWHULDO
GH &RQVXPR 2EMHWR$WLYLGDGH ± 'LVWULEXLomR GH $OLPHQWDomR (VFRODU SDUD RV $OXQRV GD
5HGH3~EOLFDGH(QVLQR)RQWH
+DYHQGR QHFHVVLGDGH H FRP D GHYLGD DXWRUL]DomR SRGHUmR VHU XWLOL]DGRV 5HFXUVRV
2UoDPHQWiULRVGHTXDLVTXHU6HFUHWDULDV0XQLFLSDLV
&/È868/$'e&,0$35,0(,5$'$9,*Ç1&,$('$9$/,'$'(
$YLJrQFLDGHVWHFRQWUDWRVHUiDWpDFRQWDUGDGDWDGHDVVLQDWXUDGR
&RQWUDWRSRGHQGRVHUSURUURJDGRDFULWpULRGD$GPLQLVWUDomR
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
126 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
&/È868/$'e&,0$6(*81'$'$66$1d®(6
3HODLQH[HFXomRWRWDORXSDUFLDOGRREMHWRFRQWUDWDGRD$GPLQLVWUDomRSRGHUiJDUDQWLGD
DSUpYLDGHIHVDDSOLFDUj&2175$7$'$DVVHJXLQWHVVDQo}HV
DDGYHUWrQFLD
E PXOWD GH XP SRU FHQWR DR GLD VREUH R YDORU GR FRQWUDWR SRU GLD GH DWUDVR QD
H[HFXomRHRXIRUQHFLPHQWRDWpRžYLJpVLPRGLD
F PXOWD GH YLQWH SRU FHQWR VREUH R YDORU GR FRQWUDWR D SDUWLU GR ž YLJpVLPR
SULPHLUR GLD SHOR DWUDVR QR IRUQHFLPHQWR HRX H[HFXomR IDFXOWDGD D UHVFLVmR FRQWUDWXDO VHP
SUHMXt]RGDVGHPDLVSHQDOLGDGHVSUHYLVWDVQD/HLQž
GSHORVPRWLYRVTXHVHVHJXHPSULQFLSDOPHQWHD&2175$7$'$HVWDUiVXMHLWDjPXOWD
WUDWDGDQHVWD&OiXVXOD
ƒ SHODUHFXVDLQMXVWLILFDGDGHUHFHEHUD1RWDGH(PSHQKRHDVVLQDUR&RQWUDWR
ƒ SHORDWUDVRQDHQWUHJDGRIRUQHFLPHQWRHPUHODomRDRSUD]RSURSRVWRHDFHLWRH
ƒ SHOD QmR HQWUHJD GR IRUQHFLPHQWR FDUDFWHUL]DQGRVH D IDOWD VH D HQWUHJD QmR VH
HIHWLYDUGHQWURGRVTXLQ]HGLDVTXHVHVHJXLUHPDRWpUPLQRGRSUD]RSURSRVWRHDFHLWR
H $ FULWpULR GD $GPLQLVWUDomR SRGHUmR VHU VXVSHQVDV DV SHQDOLGDGHV QR WRGR RX HP
SDUWHTXDQGRRDWUDVRGRIRUQHFLPHQWRGRVSURGXWRVIRUGHYLGDPHQWHMXVWLILFDGR
SHOD&2175$7$'$HDFHLWRSHOD$GPLQLVWUDomRGD3UHIHLWXUD0XQLFLSDOGH9DOHQoDTXHIL[DUi
QRYRSUD]RHVWHLPSURUURJiYHOSDUDDFRPSOHWDH[HFXomRGDVREULJDo}HVDVVXPLGDV
&/È868/$'e&,0$7(5&(,5$'$5(6&,6­2
$ LQH[HFXomR WRWDO RX SDUFLDO GHVWH &RQWUDWR HQVHMD D VXD UHVFLVmR FRQIRUPH GLVSRVWR
QRVDUWLJRVDGD/HL
68%&/È868/$ 35,0(,5$ RV FDVRV GH UHVFLVmR FRQWUDWXDO VHUmR IRUPDOPHQWH
PRWLYDGRVQRVDXWRVGRSURFHVVRDVVHJXUDGRRFRQWUDGLWyULRHDDPSODGHIHVD
68%&/È868/$6(*81'$$UHVFLVmRGHVWH&RQWUDWRSRGHUiVHU
DGHWHUPLQDGDSRUDWRXQLODWHUDOHHVFULWRGD$GPLQLVWUDomRQRVFDVRVHQXPHUDGRVQRV
LQFLVRV , D ;,, H ;9,, GR DUWLJR GD /HL PHQFLRQDGD QRWLILFDQGRVH D &2175$7$'$ FRP D
DQWHFHGrQFLDPtQLPDGHWULQWDGLDVRX
E DPLJiYHO SRU DFRUGR HQWUH DV SDUWHV GHVGH TXH KDMD FRQYHQLrQFLD SDUD D
$GPLQLVWUDomRRX
FMXGLFLDOQRVWHUPRVGDOHJLVODomRYLJHQWHVREUHDPDWpULD
68%&/È868/$ 7(5&(,5$ D UHVFLVmR DGPLQLVWUDWLYD RX DPLJiYHO VHUi SUHFHGLGD GH
DXWRUL]DomRHVFULWDHIXQGDPHQWDGDGDDXWRULGDGHFRPSHWHQWH
&/È868/$'e&,0$48$57$±'235$=2(/2&$/'((175(*$'$0(5&$'25,$
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL
Sexta-feira
11 de Julho de 2014
127 - Ano VI - Nº 1008
Valença
35()(,785$081,&,3$/'(9$/(1d$
(67$'2'$%$+,$
)LFD HVWDEHOHFLGR TXH R SUD]R GH HQWUHJD GD PHUFDGRULD QmR VHUi VXSHULRU j K
TXDUHQWD H RLWR KRUDV FRQWDGR GR UHFHELPHQWR GD 2UGHP GH )RUQHFLPHQWR6HUYLoR H TXH R
ORFDOGHHQWUHJDGRVSURGXWRVRXH[HFXomRGRVVHUYLoRVVHUiQDVHGHGRPXQLFtSLRQRGHSyVLWR
GD 6HFUHWDULD GH (GXFDomR H QRV GHSyVLWRV GDV XQLGDGHV GD 6HFUHWDULD GH (GXFDomR QRV
GLVWULWRV GR PXQLFtSLR *XDLELP (QWURQFDPHQWR 6HUUD *UDQGH 2UREy %DL[mR 0DULFRDER
-HTXLULoi*HUHEDH%RPILP
&/È868/$'e&,0$48,17$'2)252
)LFD HOHLWR R )RUR GD &RPDUFD GH 9DOHQoD QR (VWDGR GD %DKLD SDUD GLULPLU TXDLVTXHU
G~YLGDVVXVFLWDGDVQDH[HFXomRGRSUHVHQWH&RQWUDWR
(SDUDYDOLGDGHGRTXHSHODVSDUWHVILFRXDFHUWDGRILUPDVHRSUHVHQWHLQVWUXPHQWRHP
WUrV YLDV GH LJXDO WHRU H IRUPD SDUD XP Vy HIHLWR GHSRLV GH OLGR H DFKDGR FRQIRUPH QD
SUHVHQoDGHGXDVWHVWHPXQKDVTXHRVXEVFUHYHPYDLSHODVSDUWHVDVVLQDGR
9DOHQoDGHGH
&RQWUDWDQWH
&2175$7$'$
BBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBB
7UDYHVVD*HQHUDO/DEDWXW61&HQWUR
&(3±9$/(1&$%$+,$
7HOHID[
CERTIFICAÇÃO DIGITAL: M3VZDYN3XNWAMJ9TPDKRNG
Esta edição encontra-se no site: www.valenca.ba.io.org.br em servidor certificado ICP-BRASIL