ED-A100/ED-A110/CP

Сomentários

Transcrição

ED-A100/ED-A110/CP
Projetor
ED-A100/ED-A110/CP-A100W
Manual do Usuário (detalhado)
Guia de Utilização
Obrigado pela compra deste projetor.
AVISO Ź$QWHVGHXVDUHVWHSURGXWROHLDRPDQXDO/HLDHVWH³*XLDGD
VHJXUDQoD´SULPHLUR'HSRLVGHOHUDVLQVWUXo}HVJXDUGHRSDUDUHIHUrQFLD
IXWXUD
6REUHHVWHPDQXDO
'LYHUVRVVtPERORVVmRXVDGRVQHVWHPDQXDO2VLJQL¿FDGRGHVWHVVtPERORVVmR
GHVFULWRVDVHJXLU
AVISO
PRECAUÇÃO
(VWHVtPERORLQGLFDDLQIRUPDomRTXHVHLJQRUDGDSRGHUHVXOWDU
SRVVLYHOPHQWHHPOHVmRSHVVRDORXPHVPRPRUWHSDUDPDQXVHLRLQFRUUHFWR
(VWHVtPERORLQGLFDDLQIRUPDomRTXHVHLJQRUDGDSRGH
UHVXOWDUSRVVLYHOPHQWHHPOHVmRSHVVRDORXPHVPRPRUWHSDUD
PDQXVHLRLQFRUUHFWR
&RQVXOWHDVSiJLQDVHVFULWDVFRPHVWHVtPEROR
NOTA ‡$LQIRUPDomRFRQWLGDQHVWHPDQXDOpVXMHLWDDDOWHUDo}HVVHPDYLVR
SUpYLR
‡2IDEULFDQWHQmRDVVXPHUHVSRQVDELOLGDGHSRUTXDOTXHUHUURTXHSRVVDRFRUUHUQHVWHPDQXDO
‡eSURLELGRUHSURGX]LUWUDQVPLWLURXFRSLDUHVWHGRFXPHQWRWRWDORXSDUFLDOPHQWHVHP
DXWRUL]DomRSUpYLDSRUHVFULWR
Reconhecimento de marca
‡0DFpXPDPDUFDUHJLVWDGDGD$SSOH&RPSXWHU,QF
‡9(6$H69*$VmRPDUFDVUHJLVWDGDVGDWUDGHPDUNVRIWKH9LGHR(OHFWURQLFV
6WDQGDUG$VVRFLDWLRQ
‡:LQGRZVpXPDPDUFDUHJLVWDGDGD0LFURVRIW&RUSRUDWLRQ
7RGDVDVRXWUDVPDUFDVVmRGHSURSULHGDGHGHVHXVUHVSHFWLYRVSURSULHWiULRV
1
Lees deze
Veiligheidshandleiding eerst.
Projecto
Gebruiksaanwijzing - Veiligheidshandleiding
Bedankt voor de aankoop van deze projector.
WAARSCHUWING • Lees vóór gebruik de handleiding van deze projector
grondig door, zodat u de werking ervan begrijpt en correct gebruik verzekerd
is. Bewaar deze handleiding, nadat u deze aandachtig heeft doorgelezen, zodat
u deze later opnieuw kunt doorlezen. Niet correcte omgang met dit product kan
mogelijk leiden tot persoonlijk letsel of materiële schade. De producent aanvaardt
geen aansprakelijkheid voor eventuele schades die het gevolg zijn van verkeerde
handelingen die voorbij gaan aan het normale gebruik zoals dat in de handboeken
van deze projecten wordt gedefinieerd.
OPMERKING • De informatie in deze handleiding kan zonder voorafgaande kennisgeving
veranderd worden.
• De fabrikant neemt geen enkele verantwoordelijkheid voor de eventuele fouten in deze
handleiding.
• Reproductie, overdracht of het gebruik van dit document is niet toegestaan, zonder
uitdrukkelijke toestemming van de betreffende partij.
Waarschuwingssymbolen
In deze gebruiksaanwijzing en op het apparaat zelf staan diverse symbolen vermeld,
die u de juiste bediening tonen en u waarschuwen om schade en gevaar voor uzelf en
anderen te voorkomen. De betekenis van deze symbolen wordt hieronder uitgelegd.
Lees de beschrijving aandachtig door, om volledig kennis te nemen van de betekenis.
WAARSCHUWING
Dit symbool vergezelt aanwijzingen die u niet mag
veronachtzamen, omdat onjuiste bediening hier gevaar voor
verwonding of zelfs fatale ongelukkenkan veroorzaken.
LET OP
Dit symbool vergezelt aanwijzingen die u dient te volgen om
gevaar voor schade of lichamelijk letselte voorkomen.
Toegepaste symbolen
Dit symbool vergezelt een aanvullende waarschuwing (of bedieningsaanwijzing).
Hierbij geeft het teken in het midden de inhoud aan.
Dit symbool waarschuwt voor een handeling die verboden is. De inhoud
wordt verduidelijkt door het teken in het midden (het voorbeeld links geeft
aan dat demontage niet is toegestaan).
Dit symbool geeft een noodzakelijke handeling aan. De inhoud wordt
verduidelijkt door het teken in het midden (het voorbeeld links geeft aan dat u
de stekker uit het stopcontact moet trekken).
SG1
Veiligheidsmaatregelen
WAARSCHUWING
Gebruik de projector nooit indien deze niet juist werkt.
Gebruik de projector niet als deze rook uitstoot, vreemd ruikt, als er geen beeld of
geluid is of als het geluid te luid is, als de behuizing, kabels of andere onderdelen
beschadigd zijn, of als er een vloeistof of voorwerp in het apparaat is terechtgekomen,
want dit kan resulteren in brand of een elektrische schok.
In zulke gevallen moet u de projector meteen uitschakelen en de stekker uit het
stopcontact trekken. Controleer of de rook of geur stopt en neem dan contact op
met uw dealer. Probeer het apparaat nooit zelf te repareren want dit kan bijzonder
gevaarlijk zijn.
• Gebruik een stopcontact dat dicht bij de projector is en dat gemakkelijk bereikbaar is.
Trek de
stekker uit het
stopcontact.
Wees vooral voorzichtig voor kinderen en huisdieren.
Bij een verkeerde behandeling kan resulteren in brand, elektrische schok, letsel,
verbranden of gezichtsprobleem.
Wees vooral voorzichtig wanneer er kinderen en huisdieren in de buurt zijn.
Let op dat geen vloeistof of voorwerp in het inwendige
terechtkomt.
Als vloeistoffen of voorwerpen in het inwendige terechtkomen, kan dit resulteren in brand of een
elektrische schok. Wees vooral voorzichtig wanneer er kinderen in de buurt zijn.
Indien toch vloeistof of een voorwerp in de projector terechtkomt, moet u het apparaat
meteen uitschakelen, de stekker uit het stopcontact trekken en contact opnemen met
uw dealer.
• Plaats de projector niet in de buurt van water (bijv. in de badkamer, op het strand, etc.).
• Stel de projector niet aan regen of vocht bloot. Gebruik de projector niet buitenshuis.
• Zet geen bloemenvazen, planten, kopjes, make-up of vloeistoffen zoals water enz.
op of dicht in de buurt van de projector.
• Leg geen metalen of brandbare voorwerpen of andere gevaarlijke stoffen op of dicht
in de buurt van de projector.
• Verpak geen andere objecten dan signaalkabels of connectors samen met de projector in dezelfde
tas of andere verpakking, om te voorkomen dat deze in de projector terecht kunnen komen.
Haal het apparaat nooit uit elkaar en breng er ook nooit
eigenhandig wijzigingen op aan.
In de projector zijn hoge spanningen aanwezig. Wanneer u het apparaat uit elkaar haalt of
er wijzigingen op aanbrengt, kan gevaar voor brand of elektrische schokken ontstaan.
• Maak nooit de behuizing open.
• Neem voor reparatie of reiniging van het inwendige van de projector contact op met
uw dealer.
Stel de projector niet aan stoten of schokken bloot.
Als de projector aan stoten of schokken wordt blootgesteld, kan deze beschadigd worden en
eventueel letsel veroorzaken. Bovendien bestaat de kans op brand of een elektrische schok.
Als de projector gevallen is of iets dergelijks, moet u deze meteen uitschakelen, de
stekker uit het stopcontact trekken en contact opnemen met uw dealer.
Zet de projector niet op een onstabiele ondergrond.
Als de projector valt, kan deze beschadigd worden en eventueel letsel veroorzaken.
Bovendien bestaat de kans op brand of een elektrische schok.
• Zet de projector niet op een onstabiel, schuin of trillend oppervlak zoals een wankel
of schuin aflopend tafeltje.
• Vergrendel de zwenkwieltjes wanneer u de projector op een tafeltje met
zwenkwieltjes plaatst.
• Plaats de projector niet met de zijkant naar boven, de lens naar boven of de lens naar beneden.
• Voor plafondinstallatie of iets dergelijks, raadpleeg uw dealer voor installatie.
SG2
Niet
demonteren.
Veiligheidsmaatregelen (vervolg)
WAARSCHUWING
Wees voorzichtig, de projector geeft veel hitte af.
Wanneer de lamp brandt, geeft de projector veel hitte af. Er bestaat kans op brand en
u kunt zich verbranden. Wees vooral voorzichtig wanneer er kinderen in de buurt zijn.
Raak de lens, de ventilators en de ventilatieopeningen niet aan tijdens gebruik of
meteen na gebruik, om verbranding te voorkomen. Zorg ervoor dat de ventilatie niet
belemmerd wordt.
• Houd ten minste 30 cm ruimte vrij tussen de zijkant van de projector en de muur e.d.
• Plaats de projector niet op een metalen tafel of op een oppervlak dat zacht wordt bij
hitte.
• Plaats geen voorwerpen dicht bij de lens, de ventilators of de ventilatieopeningen
van de projector.
• Let op dat de ventilators en de ventilatieopeningen niet geblokkeerd worden.
• Leg geen tafelkleed e.d. over de projector.
• Zet de projector niet op een vloerkleed of bed.
Kijk nooit in de lens of de openingen wanneer de lamp brandt.
Het sterke licht kan uw gezichtsvermogen beschadigen. Wees vooral voorzichtig
wanneer er kinderen in de buurt zijn.
Gebruik alleen het juiste netsnoer en sluit dit aan op een
stopcontact met de juiste specificaties.
Gebruik op de verkeerde stroomvoorziening kan resulteren in brand of een elektrische
schok.
• De projector mag alleen worden aangesloten op een stopcontact dat voldoet aan de
stroomspecificaties die op het apparaat staan.
• Gebruik het juiste netsnoer voor het stopcontact waarop u de projector aansluit.
Sluit het netsnoer zorgvuldig aan.
Een verkeerde aansluiting van het netsnoer kan resulteren in brand of een elektrische
schok.
• Raak het netsnoer niet met natte handen aan.
• Controleer of de stekker van het netsnoer schoon is (geen stof) voordat u deze
aansluit. Gebruik een zacht, droog doekje om de stekker schoon te maken.
• Steek de stekker stevig in het stopcontact. Gebruik een juist werkend, degelijk
stopcontact.
U moet de aarddraad aansluiten.
Sluit het apparaat via het netsnoer aan op de aardingsdraad van het gebouw;
wanneer het apparaat niet geaard wordt kan gevaar voor brand of elektrische
schokken ontstaan.
Controleer of
• Gebruik geen twee-aderig verlengsnoer.
de aardingkabel
goed contact
maakt.
SG3
Veiligheidsmaatregelen (vervolg)
WAARSCHUWING
Behandel de lichtbronlamp voorzichtig.
De projector maakt gebruik van een kwikhoudende glazen hogedruklamp.
De lamp kan met een luide knal springen of doorbranden. Wanneer de lamp
kapot springt, is het mogelijk dat glasscherven in de lampbehuizing terecht
komen en dat kwikhoudend gas uit de ventilatieopeningen van de projector
vrijkomt.
Lees zorgvuldig de paragraaf “Lamp”.
Behandel het netsnoer en de aansluitkabels voorzichtig.
Wanneer u een beschadigd netsnoer of een beschadigde aansluitkabel
gebruikt, kan dit brand of een elektrische schok veroorzaken. Let erop
dat het netsnoer en de aansluitkabels niet aan te grote hitte worden
blootgesteld. Druk het snoer en de kabels niet klem en trek ze ook niet te
strak.
Neem contact op met uw dealer als het netsnoer of de aansluitkabels
beschadigd zijn (blootliggende of gebroken kerndraadjes e.d.).
• Zet niet de projector of een ander zwaar voorwerp op het netsnoer of de
aansluitkabels. Leg ook geen sprei, deken e.d. over het netsnoer of de
kabels, want dan is het mogelijk dat u per ongeluk een zwaar voorwerp op
het snoer of de kabels plaatst.
• Trek niet aan het netsnoer of de aansluitkabels. Pak bij het aansluiten of
losmaken van het netsnoer of de aansluitkabels altijd de stekker of plug met
uw hand vast.
• Leg het netsnoer niet in de buurt van een verwarming.
• Zorg dat het netsnoer niet te sterk gebogen wordt.
• Probeer nooit zelf reparaties aan het netsnoer uit te voeren.
Behandel de batterij van de afstandsbediening voorzichtig.
Een verkeerde behandeling van de batterij kan resulteren in brand of letsel.
De batterij kan zelfs ontploffen indien deze niet juist wordt behandeld.
• Houd de batterij uit de buurt van kinderen en huisdieren. Als de batterij
wordt afgeslikt, moet u meteen de hulp van een arts inroepen voor
spoedbehandeling.
• Zorg dat de batterij niet in water of vuur terechtkomt.
• Vermijd omgevingen met een hoge temperatuur of open vuur.
• Pak de batterij niet met een metalen pincet vast.
• Bewaar de batterij op een donkere, koele en droge plaats.
• Zorg dat u de batterij niet kortsluit.
• Probeer de batterij niet op te laden, te demonteren of te solderen.
• Stel de batterij niet aan harde schokken of stoten bloot.
• Gebruik alleen lampen met specificaties die overeenkomen met die
vermeld zijn in de andere handleiding bij de projector.
• Zorg er bij het aanbrengen van de batterij voor dat de plus en min in de
juiste richting zijn gekeerd.
• Als de batterij heeft gelekt, moet u de batterijhouder goed schoonmaken
en de batterij vervangen. Als het poeder aan uw huid of kleding blijft hangen,
moet u dit grondig met water afspoelen.
• Volg de plaatselijke wetgeving voor het weggooien van gebruikte batterijen.
SG4
Veiligheidsmaatregelen (vervolg)
LET OP
Wees voorzichtig wanneer u de projector vervoert.
Wanneer u niet voorzichtig te werk gaat, kan letsel of beschadiging worden
veroorzaakt.
• Verplaats de projector niet tijdens gebruik. Alvorens u de projector verplaatst, maakt u
het netsnoer en alle aansluitkabels los en schuift u het lenskapje of de lensdop dicht.
• Let op dat u de projector niet aan een harde stoot of schok blootstelt.
• Verplaats de projector niet door hem te slepen.
• Vervoer het apparaat altijd in de meegeleverde tas of een andere solide verpakking.
Zet niets bovenop de projector.
Wanneer u iets bovenop de projector zet, kan de projector verschuiven of vallen met letsel
of beschadiging tot gevolg. Wees vooral voorzichtig wanneer er kinderen in de buurt zijn.
Bevestig niets anders dan de gespecificeerde zaken op de projector.
Nalatigheid kan tot verwondingen of schades leiden.
• Sommige projectoren hebben een schroefdraad in het lensgedeelte. Bevestig niets
anders dan de gespecificeerde opties (zoals een optionele conversielens) op de
schroefdraad.
Gebruik het apparaat niet in een rokerige, vochtige of stoffige omgeving.
Wanneer u de projector in een rokerige, vochtige, stoffige, met oliedamp of bijtend gas
vervuilde ruimte gebruikt, kan gevaar voor brand of elektrische schokken ontstaan.
• Plaats de projector niet in de buurt van een rokerige, vochtige of stoffige ruimte (bijv.
een rokersplek, een keuken, het strand, etc.). Gebruik de projector niet buitenshuis.
• Gebruik geen luchtbevochtiger in de buurt van de projector.
Zorg ervoor dat het luchtfilter in goede conditie is.
Het luchtfilter moet regelmatig worden schoongemaakt. Als de luchtstroom wordt
gehinderd door stofophoping op het filter, kan de projector oververhit raken. Dit kan
storingen tot gevolg hebben. Op de projector kan een melding zoals 'CONTROLEER
LUCHTSTROOM' of schakel de projector uit worden weergegeven, om te voorkomen
dat de temperatuur in het apparaat te hoog oploopt.
• Reinig, als de verklikkerlampen of een melding u erop attent maken dat u het
luchtfilter moet reinigen, het luchtfilter zo snel mogelijk.
• Vervang het luchtfilter als het niet meer gereinigd kan worden of wanneer het
beschadigd is.
• Gebruik alleen een luchtfilter van het voorgeschreven type. Gebruik alleen een luchtfilter
met de specificaties zoals die zijn vermeld in de andere handleiding bij deze projector.
• Vervang, wanneer u de lamp vervangt, ook altijd het luchtfilter. Het luchtfilter wordt bij
sommige vervangingslampen voor deze projector meegeleverd.
• Schakel de voedingsspanning van de projector nooit als er geen luchtfilter in het
apparaat geplaatst is.
Vermijd opstelling in een omgeving met hoge temperaturen.
De hitte kan een nadelige invloed hebben op de behuizing en de interne onderdelen
van de projector. Stel de projector, de afstandsbediening en de andere onderdelen
niet aan direct zonlicht bloot en houd ze uit de buurt van hittebronnen zoals een
verwarmingsradiator e.d.
Vermijd Magnetische velden.
Het wordt sterk aanbevolen om elk onbeschermd of onafgeschermd magnetisch veld
op of bij de projector te vermijden. (d.i. Magnetische Veiligheidsapparaten, of andere
hulpstukken van de projector die magnetische materialen bevatten dat niet is voorzien
bij de productie etc.)
Magnetische objecten zouden onderbreking kunnen veroorzaken in de interne
mechanische resultaten van de projector dat de snelheid van de koelingsventilator
zou kunnen belemmeren of stoppen, en zou kunnen veroorzaken dat de projector
helemaal afsluit.
SG5
Veiligheidsmaatregelen (vervolg)
LET OP
Trek de stekker uit het stopcontact wanneer de projector
langere tijd niet wordt gebruikt.
• Om veiligheidsredenen moet u de stekker uit het stopcontact trekken wanneer u de
projector langere tijd niet denkt te gebruiken.
• Voordat u de projector gaat schoonmaken, moet u deze uitschakelen en de stekker
uit het stopcontact trekken. Dit om brand of een elektrische schok te voorkomen.
Trek de
stekker uit het
stopcontact.
Laat uw dealer ongeveer ieder jaar het inwendige van de
projector schoonmaken.
Opeenhoping van stof in de projector kan resulteren in brand of een defect. U kunt
het inwendige van de projector het beste laten schoonmaken iedere keer voordat een
vochtig seizoen begint (bijv. de regentijd in tropische landen).
• Maak het inwendige van de projector niet zelf schoon, want dit is gevaarlijk.
OPMERKINGEN
Stel de afstandsbediening niet aan schokken bloot.
Harde stoten of schokken kunnen resulteren in een defect of beschadiging van de afstandsbediening.
• Laat de afstandsbediening niet vallen.
• Zet niet de projector of een ander zwaar voorwerp op de afstandsbediening.
Verzorging van de lens.
• Wanneer de projector niet gebruikt wordt, moet u het lenskapje of de lensdop dicht dichtschuiven om
krassen op de lens te voorkomen.
• Raak de lens niet aan om vlekken of vuil op de lens te voorkomen, hetgeen resulteert in een minder
goede beeldkwaliteit.
• Gebruik een in de handel verkrijgbaar lensreinigingsdoekje om de lens schoon te maken (zoals een
reinigingsdoekje voor cameralenzen, brillenglazen e.d.). Wees voorzichtig dat u geen krassen op de
lens maakt.
Verzorging van de projector-behuizing en de afstandsbediening.
Bij een verkeerde behandeling kan verkleuren, afschilferen e.d. optreden.
• Gebruik een zachte doek om de behuizing en het bedieningspaneel van de projector en de
afstandsbediening schoon te maken. Voor het verwijderen van hardnekkig vuil kan een zachte
doek bevochtigd met een mild reinigingsmiddel, verdund met water, worden gebruikt. Wring de
doek goed uit voordat u begint en wrijf met een droge, zachte doek na. Gebruik geen onverdund
reinigingsmidddel.
• Gebruik geen aërosolsprays, oplosmiddelen, schuurmiddelen of andere bijtende reinigingsmiddelen.
• Lees zorgvuldig de instructies op het reinigingsmiddel voordat u dit gebruikt.
• Vermijd langdurig contact met rubber of vinyl.
Zowat kichte of donkere vlekken.
Ofschoon er lichte of donkere vlekken op het scherm kunnen verschijnen, wat een uniek karakteristiek
kenmerk is van liquid crystal displays, betekent dit niet dat het apparaat stuk is.
Wees bedacht op de eventuele weergave van het LCD paneel.
Projecteert de projector voor langere tijd een stilstaand beeld, inactieve beelden, beelden met
een beeldverhouding van 16:9 van 4:3 paneel of iets dergelijks of geeft de projector de beelden
herhaaldelijk weer, dan is het mogelijk dat het LCD paneel wordt weergegeven.
SG6
Veiligheidsmaatregelen (vervolg)
OPMERKINGEN
Over hulponderdelen.
De lamp, LCD panelen, polarisatoren en andere optische componenten, en het luchtfilter
en de koelventilatoren hebben elk een andere levensduur. Deze onderdelen zouden
kunnen moeten worden vervangen na een lange gebruiksduur.
• Dit product is niet ontworpen voor langdurig continu gebruik. In geval van een continu
gebruik van 6 uur of meer, of dagelijks gebruik van 6 uur of meer (zelfs als het niet continu
is), of herhaaldelijk gebruik, zou de levensduur kunnen worden verkort, en moeten deze
onderdelen wellicht binnen een jaar na ingebruiksname worden vervangen.
• Elk hellend gebruik meer dan de aanpassingshoek aangegeven in deze
gebruiksaanwijzingen zou de levensduur van de hulponderdelen kunnen verkorten.
Voordat u de stroom aanzet, laat de projector voldoende afkoelen.
Na het uitzetten van de projector, het indrukken van de restart schakelaar of het
onderbreken van de stroomtoevoer, laat dan de projector voldoende afkoelen.
Bediening bij een hoge temperatuur van de projector kan schade veroorzaken van een
electrode of niet-verlichten van de lamp.
Vermijd sterke lichtstralen.
Zorg dat geen sterke lichtstralen (zoals direct zonlicht of het licht van een sterke lamp) op
de afstandsbedieningssensors vallen want dan zal de afstandsbediening niet werken.
Vermijd hoogfrequentstoringen.
Bij hoogfrequentstoringen kan het beeld of geluid worden aangetast.
• Vermijd het gebruik van een hoogfrequentgenerator zoals een mobiele telefoon,
zendontvanger e.d. in de buurt van de projector.
Betreffende de weergavekwaliteit.
De weergavekwaliteit van de projector (zoals de kleur, het contrast enz.) wordt eveneens
bepaald door de eigenschappen van het scherm, want de projector maakt gebruik van een
LCD-paneel. Het weergavebeeld kan verschillen van het beeld voortgebracht door een
beeldbuis.
•Gebruik geen gepolariseerd scherm, want dit kan een rood beeld geven.
Schakel de apparatuur in de juiste volgorde in en uit.
Om storingen te voorkomen, moet u de projector en de andere apparatuur in de
onderstaande volgorde in- en uitschakelen, tenzij anders aangegeven.
• Schakel eerst de projector in en dan de computer of videorecorder.
• Schakel de projector pas uit nadat u de computer of videorecorder hebt uitgeschakeld.
Zorg dat u uw ogen niet te zeer belast.
Het verdient aanbeveling regelmatig een rustpauze in te lassen.
Stel de geluidssterkte niet te hoog in om overlast voor anderen te
voorkomen.
•Stel de geluidssterkte zodanig in dat er geen overlast voor anderen wordt veroorzaakt.
Aansluiten op een notebook-computer
Bij het aansluiten op een notebook-computer moet de externe RGB beelduitgang worden
ingeschakeld (instelling voor CRT display of gelijktijdig LCD en CRT display).
Zie de gebruiksaanwijzing van de notebook-computer voor verdere informatie.
SG7
Lamp
WAARSCHUWING
HOOGSPANNING
HOGE TEMPERATUUR
HOGE DRUK
De projector maakt gebruik van een kwikhoudende glazen hogedruklamp. De lamp kan springen
met een luide knal of doorbranden, indien hij wordt gestoten of bekrast, wordt vastgepakt als hij
heet is of over zijn levensduur heen is. Houd er rekening mee dat elke lamp een andere levensduur
heeft en sommige kunnen al kort, nadat u ze in gebruik heeft genomen, springen of doorbranden.
Wanneer de lamp kapotspringt, is het bovendien mogelijk dat glasscherven in de lampbehuizing
terechtkomen en dat kwikhoudend gas uit de ventilatieopeningen van de projector uittreedt.
Over het weggooien van een lamp • Dit produkt bevat een mercury lamp; hanteer deze niet
als gewoon afval. Verwerk in overeenstemming met milieuwetten.
Voor informatie over reclycing van de lamp, ga naar www.lamprecycle.org (in de Verenigde Staten)
Voor verwerking van dit product, neem contact op met uw locale overheidsinstantie of ga naar www.
eiae.org (in de Verenigde Staten) of www.epsc.ca (in Canada)
Voor meer informatie, kunt u contact opnemen uw Verkoopkantoor.
Haal de
stekker uit het
stopcontact.
• Mocht de lamp kapot springen (u hoort dan een luide knal), haal dan de stekker uit het
stopcontact en zorg ervoor dat bij uw plaatselijke dealer een nieuwe lamp wordt besteld.
Houd er rekening mee dat stukjes glas het binnenste van de projector kunnen
beschadigen of verwondingen kunnen veroorzaken bij het vastpakken ervan.
Probeer dus niet de projector te reinigen of de lamp zelf te vervangen.
• Mocht de lamp kapotgaan (u hoort dan een luide knal), ventileer
dan grondig de ruimte en zorg ervoor dat u het gas, dat uit de
ventilatieopeningen komt, niet inademt of in uw ogen of mond krijgt.
• Verzekert u zich er vóór vervanging van de lamp van dat de stroom uitgeschakeld
is en dat de stroomkabel niet ingeplugd is. Wacht vervolgens 45 minuten om de
lamp te laten afkoelen. Het vastpakken van een hete lamp kan verbrandingen
veroorzaken en de lamp beschadigen.
• Open niet het klepje van de lamp, wanneer de projector is opgehangen aan
het plafond. Dat is gevaarlijk. Wanneer de lamp gesprongen is, kunnen er
glasscherven omlaag vallen, wanneer de klep wordt geopend. Bovendien is het
werken op hoogte gevaarlijk. Vraag dus uw plaatselijke dealer om de lamp te
vervangen, zelfs wanneer de lamp niet is gesprongen.
• Gebruik de projector niet, wanneer de afdekklep van de lamp niet geplaatst is. Let
er bij het vervangen van de lamp op dat de schroeven stevig ingedraaid zijn. Losse
schroeven kunnen leiden tot beschadigingen of persoonlijk letsel.
• Gebruik alleen lampen van het gespecificeerde type.
• Wanneer de lamp al kort na het eerste gebruik springt, is het mogelijk dat er
elektrische problemen zijn, die niet met de lamp zelf te maken hebben. Mocht dit
gebeuren, neem dan contact op met uw plaatselijke dealer of servicemedewerker.
• Wees voorzichtig: stoten of krassen zouden kunnen resulteren in het
springen van de lamp tijdens gebruik.
• Gebruik van de lamp gedurende lange tijdsperioden, zou verdonkering
kunnen veroorzaken, het niet oplichten of springen van de lamp. Als de
beelden donker zijn, of als de kleurtoon slecht is, gelieve dan de lamp zo
spoedig mogelijk te vervangen. Gebruik geen oude (gebruikte) lampen; dit
kan kapotspringen veroorzaken.
SG8
Mededelingen over regelgevingen
Waarschuwing volgens de FCC-verklaring
Dit apparaat voldoet aan deel 15 van de FCC-voorschriften. Het gebruik van het apparaat
moet voldoen aan de volgende twee voorwaarden: (1) dit apparaat mag geen schadelijke
storingen veroorzaken, en (2) dit apparaat moet alle ontvangen storingen opnemen,
inclusief storingen die leiden tot ongewenste werking.
WAARSCHUWING : Deze apparatuur genereert en gebruikt energie op radiofrequenties
en straalt deze uit. Indien zij niet wordt geïnstalleerd en gebruikt in overeenstemming
met de instructies, kan zij schadelijke interferenties in radiocommunicaties veroorzaken.
Er is echter geen garantie dat interferentie zich bij een bepaalde installatie niet zal
voordoen. Indien deze apparatuur de radio- of televisieontvangst stoort – hetgeen kan
worden bepaald door de apparatuur aan en uit te schakelen – dan wordt de gebruiker
aangemoedigd om de interferentie met behulp van één of meerdere van de volgende
maatregelen op te heffen:
- Heroriënteer of herplaats de ontvangstantenne.
- Vergroot de afstand tussen de apparatuur en de ontvanger.
- Sluit de apparatuur aan op een stopcontact van een ander circuit dan waarop de
ontvanger is aangesloten.
- Raadpleeg de dealer of vraag een ervaren radio/TV technicus om hulp.
INSTRUCTIES VOOR GEBRUIKERS: In sommige gevallen moeten kabels met
een kerndraad worden gebruikt. Gebruik de meegeleverde kabel of een kabel van een
voorgeschreven type voor de aansluiting. Bij kabels met een kern aan slechts één van de
uiteinden, moet de kernzijde aan de projector worden aangesloten.
Garantie en service
Raadpleeg, wanneer er een storing is opgetreden (anders dan door abnormaal gebruik,
zoals is beschreven in de eerste paragraaf van het hoofdstuk WAARSCHUWING in deze
handleiding) eerst de paragraaf 'Storingen Verhelpen' in de 'Gebruikershandleiding' en
voer de daar voorgestelde handelingen uit.
Neem, als u hiermee het probleem niet kunt oplossen, contact op met uw leverancier of
onderhoudsdienst. Deze zal u meer informatie verstrekken.
SG9
Conteúdo
&RQWH~GR
Sobre este manual . . . . . . . . . . 1
Conteúdo . . . . . . . . . . . . . . . . . . 2
Características do projetor . . . 3
Preparação para o uso . . . . . . . 3
&RQWH~GRGDHPEDODJHP 3
Nomes das peças . . . . . . . . . . . 4
3URMHWRU 4
%RW}HVGH&RQWUROR 5
3RUWDV 5
&RQWUROHUHPRWR 6
&RQÀJXUDomR. . . . . . . . . . . . . . . 7
$MXVWH 7
/LJDomRFRPRVVHXVDSDUHOKRV 10
/LJDomRHOpFWULFD 12
8WLOL]DomRGDEDUUDHHQFDL[HGHVHJXUDQoD 13
8WLOL]DomRGDSURWHFomRGRFDER 13
Controle remoto . . . . . . . . . . . 14
3UHSDUDomRSDUDRWHOHFRPDQGR 14
0XGDQGRDIUHTXrQFLDGRVLQDOGH&RQWUROHUHPRWR 15
8WLOL]DomRFRPRPRXVHHWHFODGRVLPSOHVSDUD3& 15
/LJDUGHVOLJDU . . . . . . . . . . . . . . 16
/LJDUjFRUUHQWH 16
'HVOLJDUGDFRUUHQWH 17
Funcionamento . . . . . . . . . . . . 18
$MXVWHGRYROXPH 18
'HVOLJDQGRWHPSRUDULDPHQWHRVRP 18
6HOHFLRQDQGRXPVLQDOGHHQWUDGD 18
%XVFDQGRXPVLQDOGHHQWUDGD 19
6HOHFLRQDQGRXPDUD]mRGHDVSHFWR 19
$MXVWDQGRDSRVLomRGRSURMHWRU 20
$MXVWDQGRR]RRP 20
$MXVWDQGRDSRVLomRGDLPDJHP 20
$MXVWDQGRDIRFDJHP 21
8VDQGRRUHFXUVRGHDMXVWHDXWRPiWLFR 21
&RUULJLQGRGLVWRUo}HVNH\VWRQH 22
8VDQGRRUHFXUVRGHDXPHQWR 22
&RQJHODQGRDWHOD 23
$SDJDQGRWHPSRUDULDPHQWHDWHOD 23
8VDQGRDIXQomRPHQX 24
MENU FAC. . . . . . . . . . . . . . . . 26
Menu CENA . . . . . . . . . . . . . . . 28
ASPECTO, D-ZOOM, KEYSTONE ,
MODO FOTO., BRILHO, CONTRASTE, COR,
MATIZ, NITIDEZ, SILENCIAME, IMAG.ESPELH,
REAJUSTE, TEMPO FILTRO, IDIOMA,
9i3DUD0HQX$YDQoDGR
2
BRILHO, CONTRASTE, GAMA, TEMP COR,
COR, MATIZ, NITIDEZ, MINHA MEM
Menu IMAGEM . . . . . . . . . . . . . 31
ASPECTO, SOBREEXPL., POSICAO V,
POSICAO H, FASE H, TAMANHO H,
EXECUTA AJUS AUTOM
Menu ENTRD . . . . . . . . . . . . . . 33
PROGRESS., RED.INT.VÍ, ESP COR,
COMPONENT, FORMATO VIDEO,
BLOQ EST, ENTRADA COMPUTER, RESOLUÇÃO
Menu AJUSTE . . . . . . . . . . . . . 36
D-ZOOM, DESLOCAR-D V, DESLOCAR-D H,
KEYSTONE , SILENCIAME, IMAG.ESPELH,
VOLUME, ALTO-FALANTE, AUDIO
Menu TELA . . . . . . . . . . . . . . . 38
IDIOMA, MENU POS, SUPRESS.IMA, INICIAR,
0LQKD7HOD%O0LQKD7HOD, MENSAG,
NOME DA FONTE
Menu OPCAO . . . . . . . . . . . . . . 42
BUSCA AUTOM., LIGAR AUTOM., DESLIG.AUTO,
TEMPO LÂMP., TEMPO FILTRO, MEU BOTÃO,
SERVIÇO, SEGURANÇA
Menu REDE . . . . . . . . . . . . . . . 55
CONFIG, NOME DO PROJETOR, HSHOT,
INFO, SERVIÇO
Menu C.C. . . . . . . . . . . . . . . . . 60
EXIBIR, MODO, CANAL
Manutenção . . . . . . . . . . . . . . 61
6XEVWLWXLomRGDOkPSDGD 61
0DQXWHQomRGR¿OWURGHDU 63
6XEVWLWXLomRGDSLOKDGRUHOyJLR 65
&XLGDGRVFRPRHVSHOKRHFRPDVOHQWHV 66
2XWURVFXLGDGRV 67
Solução de problemas . . . . . . 68
0HQVDJHQVUHODFLRQDGDV 68
(PUHODomRjVOkPSDGDVLQGLFDGRUDV 69
)HFKDURSURMHWRU 70
5HDMXVWDUWRGDVDVFRQ¿JXUDo}HV 70
(YHQWRVTXHSRGHPVHUIDFLOPHQWH
FRQIXQGLGRVFRPGHIHLWRVGRHTXLSDPHQWR 71
(VSHFLÀFDo}HV . . . . . . . . . . . . 74
Características do projetor/Preparação para o uso
&DUDFWHUtVWLFDVGRSURMHWRU
(VWHSURGXWRFULDXPDLPDJHPGHSURMHFomRJUDQGHGHGLYHUVRVVLQDLVGH
LPDJHPPHVPRVHQXPHVSDoRSHTXHQR(VWHSURGXWRSRGHSURSRUFLRQDUOKH
FRPRGLGDGHHYiULRVWLSRVGHXWLOL]DomRDWUDYpVGDVVHJXLQWHVIXQFLRQDOLGDGHV
92VLVWHPDGHOHQWHHHVSHOKR~QLFRUHDOL]DGLVWkQFLDVGHSURMHFomRXOWUD
FXUWDVSURSRUFLRQDQGROKHIRUPDVGHXWLOL]DomRPDLVYDULDGDV
9$SRUWDPRWRUL]DGDGDOHQWHSHUPLWHTXHRSURMHWRUVHMDXWLOL]DGRGHXP
PRGRPXLWRVLPSOHV
9(VWHSURMHWRUSRGHVHUFRQWURODGRHPRQLWRUDGRDWUDYpVGDFRQH[mR/$1
3UHSDUDomRSDUDRXVR
&RQWH~GRGDHPEDODJHP
&RQVXOWHDVHFomR³9HUL¿FDomRGRFRQWH~GR´QR0DQXDOGR8VXiULRUHVXPLGR
6HXSURMHWRUGHYHDFRPSDQKDRVLWHQVPRVWUDGRVDTXL&RQWDFWHLPHGLDWDPHQWH
VHXIRUQHFHGRUVHDOJXPLWHPHVWLYHUIDOWDQGR
NOTA ‡0DQWHQKDRVPDWHULDLVGHHPEDODJHQVRULJLQDLVSDUDWUDQVSRUWH
IXWXUR9HUL¿TXHVHXVDRVPDWHULDLVRULJLQDLVGHHPEDODJHPDRPRYHUR
SURMHWRU7HQKDFXLGDGRHVSHFLDOFRPDOHQWH
3
Nomes das peças
1RPHVGDVSHoDV
Projetor
%RW}HVGH&RQWUROR
&RQVXOWHDVHJXLQWHSiJLQD
7DPSDGDOkPSDGD61
6HQVRUHVUHPRWRV14
$OWLIDODQWH37
6DtGDVGHH[DXVWmR
3RUWDGDOHQWH16, 66
3RUWDV5, 10
(QWUDGD&$12
,QWHUUXSWRUGHDOLPHQWDomR16
%DUUDGHVHJXUDQoD13
(QWUDGDGHYHQWLODo}HV
8QLGDGHGH¿OWUR63
3HGDOGRHOHYDGRU20
7DPSDGDEDWHULD65
$EHUWXUDVLQWHULRUHV
(VWDVVmRDEHUWXUDVSDUD
DFHVVyULRVGHPRQWDJHP
RSFLRQDLV
/HQWH16, 66
(VSHOKR16, 66
AVISO Ź&XLGDGRSDUDQmRSUHQGHURVVHXVGHGRVTXDQGRDSRUWDGDOHQWH
HVWLYHUHPPRYLPHQWRLVVRSRGHUiFDXVDUIHULPHQWRV
Ź1XQFDROKHGHQWURGDOHQWHGRSURMHWRURXHVSHOKRTXDQGRDOkPSDGDHVWLYHU
DFHVDLVVRSRGHUiFDXVDUGDQRVjVXDYLVmR
PRECAUÇÃO Ź1mRWRTXHDWDPSDGDOkPSDGDRXDVVDtGDVGHH[DXVWmR
HQTXDQWRHVWLYHUDXWLOL]DURSURMHWRUHGXUDQWHXPFXUWRSHUtRGRDSyVRXVR
SDUDSUHYHQLUTXHLPDGXUDV
Ź1mRFXEUDREVWUXDRXWDSHDVVDtGDVGHH[DXVWmRSDUDPDQWHUDYHQWLODomR
QRUPDO1mRFRORTXHTXDOTXHUREMHWRTXHSRVVD¿FDUSUHVRRXVXJDGRQDV
YHQWLODo}HVDRUHGRUGDVYHQWLODo}HVGHHQWUDGD
4
Nomes das peças
%RW}HVGH&RQWUROR
,QGLFDGRU/$0369
,QGLFDGRU7(0369
,QGLFDGRU32:(516, 17, 69
%RWmR(067$1'%<2116, 17
%RWmR,138718
%RW}HV)2&86
TXDQGRQmRIRUH[LELGRPHQX21RX
%RW}HVFXUVRUŻŹ
TXDQGRIRUH[LELGRPHQX24
%RW}HV0(18
TXDQGRQmRIRUH[LELGRPHQX24RX
%RW}HVFXUVRUŸź
TXDQGRIRUH[LELGRPHQX24
Portas
LAMP
TEMP
POWER
STANDBY/ON
INPUT
MENU
FOCUS -
+ FOCUS
10, Technical de 3 a 6
3RUWD86%15
3RUWD9,'(2
3RUWD$8',2,1('37
3RUWD$8',2287
3RUWD$8',2,137
3RUWD$8',2,137
3RUWD69,'(2
)HQGDGHVHJXUDQoD13
,QWHUUXSWRUGHIHFKDPHQWR
3RUWD021,725287
<&B3B&R3R
3RUWDV&RPSRQHQWHYtGHR
3RUWD&20387(5,1
3RUWD&20387(5,1
3RUWD/$1
3RUWD&21752/
COMPUTER IN2
MONITOR OUT
COMPUTER IN1
LAN
1
CONTROL
USB
S-VIDEO
Y
VIDEO
CB/PB CR/PR
L
2
AUDIO IN
R
AUDIO IN3
AUDIO
OUT
5
Nomes das peças
Controle remoto
%RWmR(067$1'%<2116, 17
%RWmR9,'(219
%RWmR&20387(518
%RWmR6($5&+19
%RWmR$63(&719
%RWmR$87221
%RWmR%/$1.23
%RWmR0$*1,)<2122
%RWmR0$*1,)<2))15, 22
%RWmR+20(15
%RWmR(1'15
%RWmR3$*(8315
%RWmR3$*('2:115
%RWmR92/80(18
%RWmR087(15, 18
%RWmR)5((=(23
%RWmR0<%8772144
%RWmR0<%8772144
%RWmR.(<6721(22
%RWmR)2&86±21
%RWmR)2&8621
%RWmR'=220±20
%RWmR'=22020
%RWmR326,7,2120, 22, 24
%RWmR0(1824
%RW}HVFXUVRUŸźŻŹ24, 25
%RWmR(17(524, 25
%RWmR(6&24, 25
%RWmR5(6(724, 25
7DPSDGDEDWHULD14
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
-
FOCUS
MY BUTTON
1
+
-
POSITION
KEYSTONE
2
D-ZOOM
+
MENU
ENTER
ESC
RESET
3DUWHGHWUiVGR
FRQWURORUHPRWR
6
&RQÀJXUDomR
&RQ¿JXUDomR
Ajuste
,QVWDOHRSURMHWRUHPORFDOHVWiYHOIUHVFRVHFRHYHQWLODGRPDQWHQGRXPHVSDoRGH
FPRXPDLVHQWUHDVODWHUDLVGRSURMHWRUHRXWURVREMHFWRVFRPRSRUH[HPSORSDUHGHV
&RQVXOWHDVLQIRUPDo}HVDVHJXLUSDUDGHFLGLURHVWLORGHSURMHomR3DUDXVRGRSURMHWRU
HPVXSRUWHGHSDUHGHRXGHPHVDVHUiQHFHVViULRLQVWDODURVDFHVVyULRVRSFLRQDLV
&RQVXOWHRVHXIRUQHFHGRUSDUDREWHUPDLVLQIRUPDo}HV
6XSRUWHGHSDUHGH
6XSRUWHGHPHVD
3URWHFWRUGR
HVSHOKR
3pVSDUDXWLOL]DomR
VREUHRWDPSRGD
PHVD
8WLOL]DomRPDLVIUHTHQWH
NOTA ‡'XUDQWHDLQVWDODomRGRSURMHWRUDVVHJXUHVHGHTXHQmRKiQDGDD
EORTXHDUDOX]HQWUHRSURMHWRUHDWHOD
‡$RLQVWDODURSURMHWRUYHULILTXHVHRVVHQVRUHVUHPRWRVQmRHVWmRH[SRVWRVD
QHQKXPWLSRGHUDGLDomRIRUWH14
PRECAUÇÃO Ź2DFHVVyULRRSFLRQDOLQGLFDGRSDUDXVRVREUHRWDPSRGD
PHVDFRQWpPRVSpVSDUDXWLOL]DomRVREUHRWDPSRGDPHVDHSURWHFWRUGR
HVSHOKR3RUIDYRUFRQVXOWHRPDQXDOLQFOXtGRFRPRDFHVVyULR
‡2VSpVSDUDXVRVREUHRWDPSRGDPHVDGHYHPVHUXWLOL]DGRVSDUDHVVH¿P
FDVRFRQWUiULRRSURMHWRUSRGHUiQmRVHVXVWHQWDURXFDLUHTXHEUDUVH
‡2SURWHFWRUGRHVSHOKRGHYHVHUXWLOL]DGRSDUDSURWHJHUDSRUWDGDOHQWH
TXDQGRRSURMHWRUFDLVREUHDPHVD
7
&RQÀJXUDomR
Ajuste (continuação)
9HULILTXHDVVHJXLQWHVLQIRUPDo}HVSDUDUHJXODUDGLVWkQFLDGRSURMHWRU
2VYDORUHVPRVWUDGRVQDWDEHODVmRFDOFXODGRVSDUDSURMHomRQXPDWHODLQWHLUD
[
Tabela para tela 4:3
A
A
C2
C1
B1
B2
B2
C2
B1
C1
*
B2
SROHJDGD FP SROHJDGD FP SROHJDGD
48 15
50
1 16
60
4 19
70 7 22
80 10 25
90 13 28
100 16 31
120 22 37
150 31 45
200 45 60
C1
A
B2
B1
C1
C2
SROHJDGD
B1
B2
C2
FP SROHJDGD FP SROHJDGD
10 39
10 40
11 47
13 55
14 62
16 70
17 77
20 92
24 115
32 152
“
Tabela para tela 16:9
A
A
B1
“
C1
C2
FP SROHJDGD FP SROHJDGD FP SROHJDGD FP SROHJDGD
NOTA ‡5HFRPHQGDVHRDMXVWHGRWDPDQKRGDWHODGHSROHJDGDVSDUD
SROHJDGDVGLDJRQDO$LPDJHPDMXVWDGDSDUDTXDOTXHUWDPDQKRIRUDGHVWH
LQWHUYDORPDLRURXPHQRUSRGHUiILFDUGLVWRUFLGD
‡$SRVLomRGDWHODSRGHVHUPXGDGDDSyVDLQVWDODomRVHRSURMHWRUIRUVXVSHQVRQRWHFWR
RXHPTXDOTXHURXWUDSDUWHXPDYH]TXHRFRUSRGHVWHSURMHWRUpIDEULFDGRFRPPDWpULDV
SOiVWLFDV6HIRUQHFHVViULRDOJXPUHDMXVWHFRQVXOWHRVHXIRUQHFHGRURXLQVWDODGRU
8
&RQÀJXUDomR
Ajuste (continuação)
AVISO Ź&RORTXHRSURMHWRUQDSRVLomRKRUL]RQWDOHVWiYHO6HRSURMHWRU
FDLURXYLUDUSRGHFDXVDUOHVmRHRXVHUGDQL¿FDGR8VDUXPSURMHWRUGDQL¿FDGR
SRGHUHVXOWDUHPLQFrQGLRHRXFKRTXHHOpFWULFR
‡1mRFRORTXHRSURMHWRUQXPDVXSHUItFLHLQVWDYpOHLQFOLQDDGDWDOFRPRXP
VWDQGLQFOLQDGRRXGHHVWDELOLGDGHGXYLGRVD
‡1mRFRORTXHRSURMHWRUDSRLDGRGHODGRRXGHIUHQWH3DUDFRORFDURSURMHWRUDSRLDGR
QDSDUWHGHWUiVSDUDVHUXWLOL]DGRVREUHRWDPSRGDPHVDpQHFHVViULRTXHVHMDP
XWLOL]DGDVDVSDUWHVRSFLRQDLVFRQFHELGDVSDUDWDO&RQVXOWHRVHXIRUQHFHGRU
‡&RQVXOWHRVHXIRUQHFHGRUDQWHVGHXPDLQVWDODomRHVSHFLDOWDOFRPR
VXVSHQGHUQRWHFWRRXHPTXDOTXHURXWUDSDUWH
Ź&RORTXHRSURMHWRUQXPORFDOIUHVFRSDUDDVVHJXUDUTXHH[LVWHYHQWLODomR
DGHTXDGD$WHPSHUDWXUDDOWDGRSURMHWRUSRGHFDXVDULQFrQGLRTXHLPDGXUD
HRXIXQFLRQDPHQWRSUHFiULRGRSURMHWRU
‡1mRWDSHREVWUXDRXFXEUDDVVDtGDVGHH[DXVWmRGRSURMHWRU
‡0DQWHQKDXPHVSDoRGHFPRXPDLVHQWUHRSURMHWRUHRXWURVREMHFWRV
FRPRSRUH[HPSORSDUHGHV
‡1mFRORTXHRSURMHWRUHPVXSHUItFLHPHWiOLFDRXiUHDFRPYHQWLODomRSUHFiULD
SDUDHYLWDUDTXHFLPHQWR
‡1mRFRORTXHRSURMHWRUQRFDUSHWHDOPRIDGDRXFDPD
‡1mRFRORTXHRSURMHWRUHPOX]VRODUGLUHFWDRXSUy[LPRGHREMHFWRVTXHQWHVWDO
FRPRDTXHFHGRUHV
‡1mRFRORTXHQDGDQDVSUR[LPLGDGHVGDSRUWDGDOHQWHOHQWHHVSHOKRRULItFLRV
GHYHQWLODomRRXHPFLPDGRSURMHWRU
‡1mRFRORTXHQDGDTXHSRVVDVHUVXJDGRRXFRODGRDRVRULItFLRVGHYHQWLODomR
QDSDUWHSRVWHULRUHLQIHULRUGRSURMHWRU(VWHSURMHWRUSRVVXLDOJXPDVHQWUDGDV
GHYHQWLODomRQDSDUWHSRVWHULRUHLQIHULRU
Ź1mRFRORTXHRSURMHWRUHPTXDOTXHUOXJDURQGHSRVVD¿FDUPROKDGR6H¿FDU
PROKDGRRXGHL[DUFDLUOtTXLGRGHQWURGRDSDUHOKRSRGHFDXVDULQFrQGLRFKRTXH
HOpFWULFRHRXIXQFLRQDUSUHFDULDPHQWH
‡1mRFRORTXHRSURMHWRUQREDQKHLURRXH[WHUQDPHQWH
‡1mRFRORTXHTXDOTXHUFRLVDTXHFRQWpPOtTXLGRSUy[LPRGRSURMHWRU
PRECAUÇÃO Ź(YLWHFRORFDURSURMHWRUHPORFDOHQSRHLUDGR~PLGRH
HVIXPDoDGR&RORFDURSURMHWRUHPWDLVORFDLVSRGHFDXVDULQFrQGLRFKRTXH
HOpFWULFRHRXIXQFLRQDPHQWRSUHFiULR
‡1mRFRORTXHRSURMHWRUSUy[LPRGHXPLGL¿FDGRUORFDOFRPIXPDoDRXFR]LQKD
Ź&RORTXHRSURMHWRUGHIRUPDTXHHYLWHTXHOX]GLUHFWDDWLQMDRVHQVRUUHPRWR
9
&RQÀJXUDomR
/LJDomRFRPRVVHXVDSDUHOKRV
$QWHVGH/LJDORVDVVHJXUHVHGHTXHRVHTXLSDPHQWRVVmRFRPSDWtYHLVFRPR
SURMHWRUHSUHSDUHRVFDERVGHOLJDomRHDGDSWDGRUHV&RQVXOWHVHXIRUQHFHGRU
VHIDOWDUDOJXPDFHVVyULRQHFHVViULRSDUDHVWHSURGXWR&RQVXOWHDVLQIRUPDo}HV
DVHJXLUSDUDOLJDomR6HGHVHMDUXWLOL]DUDSURWHFomRGRFDERFRQVXOWH8WLOL]DQGR
DSURWHFomRGRFDER13
PCs
USB-A
RS-232C
RGB OUT
AUDIO
OUT
AUDIO
OUT
RGB OUT
LAN
AUDIO IN
Monitor
RGB IN
COMPUTER IN2
MONITOR OUT
COMPUTER IN1
LAN
1
CONTROL
USB
AUDIO
OUT
S-VIDEO
Y
CB/PB CR/PR
VIDEO
L
Auto-falantes
FRPXPDPSOL¿FDGRU
2
AUDIO IN
R
AUDIO IN3
Y
CB/PB CR/PR
COMPONENT VIDEO OUT
L
R
AUDO OUT
VIDEO
OUT
L
R
AUDO OUT
S-VIDEO
OUT
L
R
AUDO OUT
Aparelhos de Vídeo
Cassete e DVD
AVISO Ź8WLOL]HDSHQDVDFHVVyULRVFRQWLGRVQHVWHSURGXWRRXUHFRPHQGDGRV
SHORVHXIRUQHFHGRU1mRPRGLILTXHRSURMHWRURXVHXVDFHVVyULRV
Ź8WLOL]HRFDERTXHSRVVXLDOLJDomRPHWiOLFDHPDSHQDVXPDGDVH[WUHPLGDGHV
SDUDOLJDomRFRPRSURMHWRUOLJDQGRHVVDPHVPDH[WUHPLGDGH'HDFRUGRFRPDV
UHJXODPHQWDo}HVSRGHVHUQHFHVViULRXPDH[WHQVmRHVSHFLDORXOLJDomRPHWiOLFD
Ź&XLGDGRSDUDQmRGDQLILFDURVFDERV3RVLFLRQHRVFDERVGHPDQHLUDDHYLWDU
TXHVHMDPSLVDGRVRXHQWDODGRVSRUDOJXPREMHWR
PRECAUÇÃO Ź1mROLJXHRXGHVOLJXHHTXLSDPHQWRVDRSURMHWRUHQTXDQWR
DPERVHVWLYHUHPOLJDGRVjFRUUHQWHHOpWULFDH[FHSWRTXDQGRLQGLFDGRSHORV
PDQXDLV
Ź$WHQomRSDUDQmRLQVHULURDGDSWDGRUQDHQWUDGDHUUDGDRXGHIRUPDLQGHYLGD
FRQWLQXDQDSiJLQDVHJXLQWH
10
&RQÀJXUDomR
Ligação com os seus aparelhos (continuação)
NOTA ‡/HLDHVWHPDQXDODQWHVGHOLJDURVGLVSRVLWLYRVQRSURMHWRUHYHUL¿TXHVH
WRGRVRVGLVSRVLWLYRVVmRDGHTXDGRVSDUDVHUHPOLJDGRVFRPHVWHSURGXWR$QWHVGH
OLJDUDXP3&YHUL¿TXHRQtYHOGHVLQDODWHPSRUL]DomRGRVLQDOHDUHVROXomR
&RQVXOWHRDGPLQLVWUDGRUGDUHGH1mROLJXHDSRUWD/$1HPTXDOTXHUUHGHFRP
YROWDJHPH[FHVVLYD
$OJXPWLSRGHVLQDOSRGHXVDUXPDGDSWDGRUSDUDHQWUDUHVWHSURMHWRU
$OJXQV3&VWrPPRGRVGHH[LELomRGHHFUmP~OWLSORVTXHSRGHPLQFOXLUDOJXQVVLQDLV
TXHQmRVmRVXSRUWDGRVSRUHVWHSURMHWRU
(PERUDRSURMHWRUSRVVDH[LELUVLQDLVFRPUHVROXomRGHDWp8;*$;R
VLQDOVHUiFRQYHUWLGRSDUDDUHVROXomRGHSDLQHOGHSURMHWRUDQWHVGHVHUH[LELGR3RGH
REWHUXPGHVHPSHQKRGHH[LELomRPHOKRUVHDVUHVROXo}HVGRVLQDOGHHQWUDGDHR
SDLQHOGHSURMHWRUIRUHPLGrQWLFRV
‡$RID]HUDOLJDomRYHUL¿TXHVHDIRUPDGRFRQHFWRUGHFDERVHDMXVWDjSRUWDSDUDOLJi
OR(QmRGHL[HGHDSHUWDURVSDUDIXVRVQRVFRQHFWRUHV
‡$ROLJDUXP3&SRUWiWLOYHUL¿TXHVHDFWLYDDVDtGD5*%H[WHUQDGR3&'H¿QDR
FRPSXWDGRUSRUWiWLOSDUDH[LELomR&57RXSDUDH[LELomR/&'H&57VLPXOWkQHD3DUD
REWHUGHWDOKHVVREUHFRPRLVWRpIHLWRFRQVXOWHRPDQXDOGHLQVWUXomRGRFRPSXWDGRU
SRUWiWLOFRUUHVSRQGHQWH
‡$RDOWHUDUDUHVROXomRGDLPDJHPQXP3&GHSHQGHQGRGHXPDHQWUDGDDIXQomR
GHDMXVWHDXWRPiWLFRSRGHOHYDUDOJXPWHPSRHWDOYH]QmR¿TXHFRPSOHWR1HVWHFDVR
QmRSRGHYHUXPDFDL[DGHVHOHFomRSDUDVHOHFFLRQDU³<HV1R´GDUHVROXomRQRYD
QR:LQGRZV(QWmRDUHVROXomRUHWRUQDUiSDUDRYDORURULJLQDO5HFRPHQGDVHXVDU
RXWURVPRQLWRUHV/&'RX&57SDUDDOWHUDUDUHVROXomR
‡(PDOJXQVFDVRVHVWHSURMHWRUQmRSRGHH[LELUXPDLPDJHPFRUUHFWDRXTXDOTXHU
LPDJHPQRHFUm3RUH[HPSORRDMXVWHDXWRPiWLFRQmRSRGHIXQFLRQDUFRUUHFWDPHQWH
FRPDOJXQVVLQDLVGHHQWUDGD8PVLQDOGHHQWUDGDGHVLQFFRPSRVWRRXVLQFHP*
SRGHFRQIXQGLUHVWHSURMHWRUHH[LELUXPDLPDJHPLQFRUUHFWD
&DSDFLGDGHGHOLJDUHUHSURGX]LU
/LJDUHUHSURGX]LUpXPVLVWHPDFRPSRVWRGHXP3&VHXVLVWHPDRSHUDWLYRH
HTXLSDPHQWRSHULIpULFRH[GLVSRVLWLYRVGHH[LELomR(VWHSURMHWRUpFRPSDWtYHOFRP
9(6$''&%/LJDUHUHSURGX]LUSRGHVHUXVDGRDRFRQHFWDUHVWHSURMHWRUFRPXP3&
TXHpFRPSDWtYHOFRP9(6$''&H[LEHGDGRVGHFDQDO
‡7LUHYDQWDJHPGHVWDIXQomRDRFRQHFWDUXPFDER5*%QDSRUWD&20387(5
,1FRPSDWtYHOFRP''&%$IXQomROLJDUHUHSURGX]LUWDOYH]QmRIXQFLRQH
FRUUHFWDPHQWHVHWHQWDUXVDUTXDOTXHURXWURWLSRGHFRQH[mR
‡8VHGULYHUVSDGU}HVQRVHXU3&XPDYH]TXHHVWHSURMHWRUpXPPRQLWRUFRPDIXQomR
OLJDUHUHSURGX]LU
11
&RQÀJXUDomR
/LJDomRHOpFWULFD
$QWHVGHHIHWXDUDOLJDomRFHUWLILTXHVHGHTXH
RFDERGHHQHUJLDGRSURMHWRUHDWRPDGDVmR
FRPSDWtYHLV
(PVHJXLGDVLJDDVLQVWUXo}HVDEDL[RSDUD
OLJDomR
7RPDGD$&
FRUUHQWHDOWHUQDGD
,QVLUDDH[WUHPLGDGHGHOLJDomRGRFDER
GHDOLPHQWDomRQDHQWUDGD$&FRUUHQWH
DOWHUQDGDGRSURMHWRU
&DERGHHQHUJLD
FRPDGDSWDGRU
/LJXHDRXWUDH[WUHPLGDGHGRFDERGH
DOLPHQWDomRQDWRPDGD
AVISO Ź&XLGDGRGXUDQWHDRSHUDomRSDUDHYLWDUTXHDWRPDGDFDXVHXP
FKRTXHHOpWULFRRXSULQFtSLRGHLQFrQGLR
‡1mRPDQXVHLHRFDERGHDOLPHQWDomRFRPPmRVPROKDGDV
‡8WLOL]HHVWHSURGXWRDSHQDVFRPRWLSRGHWRPDGDLQGLFDGDQRSURMHWRU
‡8WLOL]HXPDWRPDGDSUy[LPDDRSURMHWRUHGHIiFLODFHVVR
‡$VVHJXUHVHGHTXHRFDERGHHQHUJLDHVWiILUPHPHQWHOLJDGRSDUDHYLWDU
TXHVHGHVOLJXH1mRXWLOL]HWRPDGDVTXHQmRHVWLYHUHPILUPHVHHPERDV
FRQGLo}HV
‡1mRVREUHFDUUHJXHDWRPDGDLVVRSRGHUHVXOWDUHPULVFRGHLQFrQGLRRX
FKRTXHHOpWULFR
‡8WLOL]HDSHQDVRFDERGHDOLPHQWDomRRULJLQDODPHQRVTXHHVWHHVWHMD
GDQLILFDGR&DVRRFDERHVWHMDGDQLILFDGRFRQVXOWHRVHXIRUQHFHGRUSDUD
DGTXLULUXPQRYR1mRPRGLILTXHRFDERGHDOLPHQWDomR
12
&RQÀJXUDomR
8WLOL]DomRGDEDUUDHHQFDL[HGHVHJXUDQoD
(VWHSURMHWRUSRVVXLXPDEDUUDGHVHJXUDQoD
FRPHUFLDODQWLIXUWRRXFRUUHQWHGHDWp
PPGHGLkPHWUREHPFRPRXPHQFDL[HGH
VHJXUDQoDSDUDXPDIHFKDGXUD.HQVLQJWRQ
3DUDPDLVGHWDOKHVYHMDRPDQXDOGR
HTXLSDPHQWRGHVHJXUDQoD
NOTA ‡(VWHVUHFXUVRVQmRWRUQDPR
SURMHWRUWRWDOPHQWHjSURYDGHURXER
VHQGRDSHQDVPHGLGDVVXSOHPHQWDUHV
(QFDL[HGH6HJXUDQoD
%DUUDGH
6HJXUDQoD
AVISO Ź1mRSRVLFLRQHRILRXRXFRUUHQWHDQWLIXUWRSUy[LPRjVVDtGDVGH
H[DXVWmRGRSURMHWRURFDORUGRJiVHOLPLQDGRSRGHTXHLPDURILR
Ź1mRXWLOL]HDEDUUDRXRHQFDL[HGHVHJXUDQoDSDUDHYLWDUTXHGDGR
HTXLSDPHQWRHVWHVQmRIRUDPSURMHWDGRVSDUDHVVHILP
Utilização da protecção do cabo
8WLOL]HDSURWHFomRGRFDERSDUDSURWHJHUHJXLDUDVSHoDVGHOLJDomR
3ULPHLUDPHQWHOLJXHRVFDERVGH
VLQDOHGHDOLPHQWDomRDRSURMHWRU
3URWHFomRGRFDER
3UHQGDDSURWHFomRGRFDER
DRSURMHWRUXQLQGRDVSDUWHV
DFRSODGDV
$SHUWHRSDUDIXVRSDUDIL[DUR
SURWHFomRGRFDER
&RQHFWHRVFDERVUHVWDQWHVDRV
RXWURVHTXLSDPHQWRVHOLJXHR
FDERGHDOLPHQWDomRjWRPDGD
3DUDIXVR
3HoDVDFRSODGDV
&KDYHGHIHQGDV
PRECAUÇÃO Ź&XLGDGRSDUDQmRGREUDURVFDERVGHQWURGDSURWHFomRSDUD
HYLWDUGDQRVDRVFDERV
13
Controle remoto
&RQWUROHUHPRWR
Preparação para o telecomando
2WHOHFRPDQGRQHFHVVLWDSLOKDV8WLOL]HDVSLOKDV
LQFOXtGDVQHVWHSURGXWRRXGXDVSLOKDVQRYDVGRWLSR
HVSHFLILFDGRHITACHI MAXELLSDUWHQ~PHURLR6RX
R6P6LJDDVLQWUXo}HVDVHJXLU
5HPRYDDWDPSDGDVSLOKDVQRYHUVRGR
WHOHFRPDQGR
&RORTXHDVSLOKDVQRVXSRUWHGDVSLOKDVGHDFRUGRFRPDV
PDUFDVGHSRODULGDGHHLQGLFDGDVGHQWURGRVXSRUWH
&RORTXHQRYDPHQWHDWDPSDGDVSLOKDV
NOTA ‡&DVRRWHOHFRPDQGRQmRIXQFLRQH
H[SHULPHQWHWURFDUDVSLOKDV
‡(VWHFRQWURORUHPRWRIXQFLRQDFRPRVVHQVRUHV
UHPRWRVQRSURMHWRUXWLOL]DQGRUDLRVLQIUDYHUPHOKRV
/('&ODVVH2VVHQVRUHVDWLYRVUHFHEHPRVLQDO
GHVLJQDGRGHQWURGHXPkQJXORGHJUDXVjGLUHLWD
RXHVTXHUGDHHPXPDGLVWkQFLDGHDWpPHWURV
‡2VLQDOGHFRQWURORUHPRWRUHIOHFWLGRQRHFUmRX
VLPLODUWDOYH]QmRHVWHMDGLVSRQtYHO
‡(YLWHTXHRVVHQVRUHVUHPRWRVUHFHEDP
TXDOTXHUWLSRGHUDGLDomR,VVRSRGHFDXVDU
GDQRVDRSURMHWRUHDRWHOHFRPDQGR
6HQVRUHVUHPRWRV
JUDXV
JUDXV
PHWURV
DSUR[LPDGDPHQWH
AVISO Ź6HMDFDXWHORVRDRPDQXVHDUDVSLOKDVHODVSRGHPSURYRFDUH[SORV}HV
UDFKDVRXYD]DPHQWRVTXHSRGHPFDXVDUXPLQFrQGLRIHULPHQWRVRXSROXLomRDPELHQWDO
‡8WLOL]HDSHQDVSLOKDVQRYDVHGHQWURGDHVSHFLILFDomR1mRXWLOL]HSLOKDVGDQLILFDGDVFRQWHQGR
DUUDQK}HVPRVVDVIHUUXJHPRXYD]DPHQWRV1mRXWLOL]HXPDSLOKDQRYDFRPXPDXVDGD
‡4XDQGRRFRUUHURYD]DPHQWRGHXPDSLOKDOLPSHRYD]DPHQWRFRPXP
OHQoRGHVFDUWiYHO6HROtTXLGRWRFDUDOJXPDSDUWHGRVHXFRUSRHQ[DJH
LPHGLDWDPHQWHFRPiJXDFRUUHQWH4XDQGRKRXYHUYD]DPHQWRQRVXSRUWHGDV
SLOKDVWURTXHDVSLOKDVDSyVOLPSDURYD]DPHQWR
‡$RFRORFDUXPDSLOKDFRQILUDVHRVWHUPLQDLVSRVLWLYRHQHJDWLYRHVWmRQD
SRVLomRFRUUHWD
‡1mRWHQWHUHFXSHUDUXPDSLOKDFRPRSRUH[HPSORUHFDUUHJDURXVROGDU
‡5HWLUHDVSLOKDVGRWHOHFRPDQGRFDVRQmRWHQKDDLQWHQomRGHXWLOL]iORSRUXPORQJRWHPSR
0DQWHQKDDVSLOKDVHPORFDOHVFXURIUHVFRHVHFR1XQFDH[SRQKDXPDSLOKDDIRJRRXiJXD
‡$RGHVID]HUVHGHXPDSLOKDREHGHoDDOHJLVODomRORFDO
14
Controle remoto
Mudando a frequência do sinal de Controle remoto
2FRQWUROHUHPRWRDFHVVyULRWHPGXDVHVFROKDVVREUHDIUHTXrQFLD
GHVLQDO0RGR1250$/H0RGR$/726HRFRQWUROHUHPRWR
QmRIXQFLRQDUFRUUHFWDPHQWHWHQWHDOWHUDUDIUHTXrQFLDGHVLQDO
3DUDGH¿QLURPRGRFRQWLQXHSUHPLQGRDFRPELQDomRGHGRLVERW}HV
OLVWDGDDEDL[RVLPXOWDQHDPHQWHSRUDSUR[LPDGDPHQWHVHJXQGRV
'H¿QDSDUD0RGR1250$/%RW}HV087(H5(6(7
'H¿QDSDUD0RGR$/72%RW}HV0$*1,)<2))H(6&
VIDEO
COMPUTER
SEARCH
ASPECT
MAGNIFY
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
ON
MUTE
OFF
FREEZE
-
MY BUTTON
1
FOCUS
+
KEYSTONE
2
D-ZOOM
-
POSITION
/HPEUHVHTXHR)5(45(0272QRLWHP6(59,d2GRPHQX
23&$246GRSURMHWRUDVHUFRQWURODGRGHYHVHUGH¿QLGRSDUDR
PHVPRPRGRQRFRQWUROHUHPRWR
+
MENU
ENTER
ESC
RESET
Utilização como mouse e teclado simples para PC
2FRQWUROHUHPRWRDFHVVyULRIXQFLRQDFRPRXPUDWRH
WHFODGRVLPSOHVGR3&DROLJDUDSRUWD86%GRSURMHWRU
WLSR%QDSRUWD86%GR3&WLSR$DWUDYpVGRFDERGH
UDWR
7HFOD+20(3ULPDRERWmRHOME
7HFOD(1'3ULPDRERWmR(1'
7HFOD3$*(833ULPDRERWmR3$*(83
7HFOD3$*('2:13ULPDRERWmR3$*('2:1
%RWmRHVTXHUGRGRUDWR3ULPDRERWmR(17(5
0RYDDSRQWDGRU8VHRERW}HVFXUVRUŸźŻHŹ
7HFOD(6&3ULPDRERWmR(6&
%RWmRGLUHLWRGRUDWR3ULPDERWmR5(6(7
3RUWD86%
USB
VIDEO
COMPUTER
ASPECT
MAGNIFY
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
ON
-
MUTE
OFF
FREEZE
AVISO Ź2XVRLQFRUUHFWRGRUDWRVLPSOHVHIXQomR
GHWHFODGRSRGHGDQL¿FDURVHXHTXLSDPHQWR$RXVDU
HVWDIXQomROLJXHHVWHSURGXWRVRPHQWHQRVHX3&
9HUL¿TXHRVPDQXDLVGR3&DQWHVGHOLJDUHVWHSURGXWR
SEARCH
FOCUS
MY BUTTON
1
+
-
POSITION
KEYSTONE
2
D-ZOOM
+
MENU
ENTER
ESC
RESET
NOTA ‡6HDIXQomRGHWHFODGRHUDWRGHVWHSURGXWRQmRIXQFLRQDU
FRUUHFWDPHQWHYHUL¿TXHRVHJXLQWH
4XDQGROLJDUXPFDER86%QHVWHSURMHWRUQXP3&FRPXPGLVSRVLWLYR
GHDSRQWDUH[HVIHUDGHURODJHPFRPXP3&SRUWiWLODEUDRPHQXGH
FRQ¿JXUDomRGD%,26HGHSRLVVHOHFFLRQHRUDWRH[WHUQRHGHVDFWLYHR
GLVSRVLWLYRGHDSRQWDULQFRUSRUDGRSRUTXHSRGHWHUSULRULGDGHQHVWDIXQomR
:LQGRZV265RXVXSHULRUpQHFHVViULRSDUDHVWDIXQomR(HVWDIXQomR
WDPEpPSRGHIXQFLRQDUGHSHQGHQGRGDVFRQ¿JXUDo}HVGH3&HGULYHUVGRUDWR
1mRSRGHID]HUFRLVDVFRPRSUHPLUGRLVERW}HVDRPHVPRWHPSRH[SUHPLU
GRLVERW}HVDRPHVPRWHPSRSDUDPRYHURDSRQWDGRUGLDJRQDOPHQWH
(VWDIXQomRpDFWLYDGDVRPHQWHTXDQGRRSURMHWRUHVWLYHUIXQFLRQDQGRFRUUHFWDPHQWH
(VWDIXQomRQmRVHHQFRQWUDGLVSRQtYHOHQTXDQWRDOkPSDGDHVWLYHUDDTXHFHURLQGLFDGRU32:(5¿FDUi
YHUGHLQWHUPLWHQWHHGXUDQWHRDMXVWDPHQWRGRYROXPHHH[LELomRGHLPDJHPFRUUHFomRGDGLVWRUomR
WUDSH]RLGDODPSOLDomRGDWHODXWLOL]DomRGDIXQomR6835(66,0$RXH[LELomRGDWHODGHPHQX
15
/LJDUGHVOLJDU
/LJDUGHVOLJDU
/LJDUjFRUUHQWH
/LJXHRSURMHWRUHHTXLSDPHQWRVOLJDGRV/LJXHRSURMHWRUDQWHVGRVRXWURV
HTXLSDPHQWRVDHOHOLJDGRVVDOYRLQVWUXomRGLYHUVDGRPDQXDO
3DUDHVWHSURMHWRUVLJDRSURFHGLPHQWRDEDL[R
3UHVVLRQHRODGRPDUFDGRIGRERWmRGH
DOLPHQWDomRSDUDDSRVLomRSRZHURQOLJDGR
2LQGLFDGRU32:(5DFHQGHUiXPDOX]FRUGHODUDQMD
LQGLFDGRU32:(5
ERWmR67$1'%<21
LAMP
Ɣ$SyVRDFHQGLPHQWRGRLQGLFDGRU32:(5
DJXDUGHDOJXQVVHJXQGRVSDUDXVDURV
ERW}HVGHFRQWURORQRSURMHWRUHQRFRQWUROR
UHPRWR
TEMP
POWER
STANDBY/ON
INPUT
$VVHJXUHVHGHTXHDSRUWDGDOHQWHQmRLUi
EDWHUHPQDGDGXUDQWHVXDDEHUWXUD
(PVHJXLGDSUHVVLRQHHQWmRRERWmR
67$1'%<21QRSURMHWRURXQRWHOHFRPDQGR
$SRUWDGDOHQWHDEULUiDOkPSDGDGHSURMHomR
DFHQGHUiHDOX]GRLQGLFDGRU32:(5
FRPHoDUiDSLVFDUHPYHUGH
%RWmRGH
DOLPHQWDomR
4XDQGRRSURMHWRUHVWLYHUSURQWRSDUDVHUXWLOL]DGR
ERWmR67$1'%<21
DOX]GRLQGLFDGRUDFHQGHUiYHUGHHVHUiFRQWtQXD
3DUDH[LELUDLPDJHPVHOHFFLRQHXPVLQDOGHHQWUDGDGHDFRUGRFRPDVHFomR
6HOHFLRQDQGRXPVLQDOGHHQWUDGD18
NOTA ‡4XDQGRDRSomR/,*$5$8720GRPHQX23&$2HVWLYHUGH¿QLGD
SDUD/,*$5HDDOLPHQWDomRIRLGHVOLJDGDSHORLQWHUUXSWRUD~OWLPDYH]OLJDUR
LQWHUUXSWRUID]FRPTXHDOkPSDGDGHSURMHFomRDFHQGDVHPSUHPLURERWmR
67$1'%<2142)
AVISO Ź1XQFDROKHGHQWURGDOHQWHGRSURMHWRURXHVSHOKRTXDQGRD
OkPSDGDHVWLYHUDFHVDLVVRSRGHUiFDXVDUGDQRVjVXDYLVmR
Ź1mRWRTXHDRUHGRUGDWDPSDGDOHQWHHYHQWLODo}HVGHH[DXVWmRH[DWDPHQWH
GXUDQWHRXGHSRLVGHVHXXVRXPDYH]TXHRDSDUHOKRHVWiTXHQWH
PRECAUÇÃO Ź&XLGDGRSDUDQmRSUHQGHURVVHXVGHGRVTXDQGRDSRUWDGD
OHQWHHVWLYHUHPPRYLPHQWRLVVRSRGHUiFDXVDUIHULPHQWRV
16
/LJDUGHVOLJDU
'HVOLJDUGDFRUUHQWH
'HVOLJXHRSURMHWRUGHSRLVGHGHVOLJDURVRXWURVGLVSRVLWLYRVOLJDGRVVDOYR
LQGLFDomRFRQWUiULDQRVPDQXDLV3DUDHVWHSURMHWRUVLJDRSURFHGLPHQWRDEDL[R
3UHVVLRQHRERWmR67$1'%<21QRSURMHWRU
RXQRWHOHFRPDQGR
$FDL[DGHGLiORJR³'HVOLJDU"´pH[LELGDQD
WHODSRUVHJXQGRV
&HUWLILTXHVHGHTXHDWDPSDGDVOHQWHVQmR
EDWHHPQDGDDRVHUIHFKDGD
(PVHJXLGDSUHVVLRQHRERWmR67$1'%<21
QRYDPHQWHHQTXDQWRDPHQVDJHPpH[LELGD
$OkPSDGDGRSURMHWRUpGHVOLJDGDDWDPSD
GDVOHQWHVIHFKDHDOX]FRUGHODUDQMDGR
LQGLFDGRUGH32:(5FRPHoDDSLVFDU
Ɣ3DUDDUUHIHFHURSURMHWRUHVSHUHRLQGLFDGRU
GH32:(5SDUDUGHSLVFDUH[LELUXPDOX]QD
OX]FRUGHODUDQMD
2SURMHWRUSRGHVHUGHVOLJDGRVHPHVSHUDU
RDUUHIHFLPHQWR3RUpPRIDEULFDQWH
UHFRPHQGDTXHRSURMHWRUVHMDDUUHIHFLGRH
YROWHjWHPSHUDWXUDQRUPDO
1mRYROWHDOLJDURSURMHWRUSRUPLQXWRVRX
PDLVDSyVGHVOLJiORSDUDHYLWDUDUHGXomR
GDYLGD~WLOGRDSDUHOKR
LQGLFDGRU32:(5
ERWmR67$1'%<21
LAMP
TEMP
POWER
STANDBY/ON
INPUT
%RWmRGH
DOLPHQWDomR
ERWmR67$1'%<21
GDERWmRGHDOLPHQWDomRQDSRVLomRGHVOLJDGR
3UHVVLRQHRODGRFRPDPDUFD
$OX]GRLQGLFDGRU32:(5DSDJDVH
&DVRQmRXVHRSURMHWRUSRUXPSHUtRGRGHWHPSRGHVOLJXHHVHSDUHRFDERGH
DOLPHQWDomRGDWRPDGDSRUPRWLYRVGHVHJXUDQoD
NOTA ‡RLQWHUUXSWRUGHIHFKDPHQWR70VRPHQWHTXDQGRRSURMHWRUQmR
HVWLYHUGHVOLJDGRSHORSURFHGLPHQWRQRUPDO
‡1mROLJXHRSURMHWRUSRUDSUR[LPDGDPHQWHPLQXWRVRXPDLVGHSRLVGH
GHVOLJiOR/LJDURSURMHWRUQRYDPHQWHORJRSRGHGLPLQXLURFLFORGHYLGDGH
DOJXPDVSHoDV
PRECAUÇÃO Ź&XLGDGRSDUDQmRSUHQGHURVVHXVGHGRVTXDQGRDSRUWDGD
OHQWHHVWLYHUHPPRYLPHQWRLVVRSRGHUiFDXVDUIHULPHQWRV
Ź1mRWRTXHQDSURWHFomRGDOkPSDGDRXGDVKpOLFHVGRH[DXVWRUHQTXDQWR
HVWLYHUDXVDURSURMHWRUHGXUDQWHXPFXUWRSHUtRGRDSyVRXVRSDUDSUHYHQLU
TXHLPDGXUDV
17
Funcionamento
)XQFLRQDPHQWR
%RWmR92/80(
Ajuste do volume
VIDEO
3ULPDRERWmR92/80(QRFRQWUROHUHPRWR
$SDUHFHXPDFDL[DGHGLiORJRSDUDDX[LOLDUDFRUULJLUDGLVWRUomR
8VHRVERW}HVŸźGRFXUVRUSDUDDMXVWDURYROXPH
3UHVVLRQHRERWmR92/80(QRYDPHQWHSDUDIHFKDUDFDL[DGH
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
GLiORJRHFRQFOXLURDMXVWH0HVPRVHQmR¿]HUQDGDDFDL[DGH
GLiORJRGHVDSDUHFHUiDXWRPDWLFDPHQWHGHSRLVGHDOJXQVVHJXQGRV
-
MY BUTTON
1
FOCUS
+
-
KEYSTONE
2
D-ZOOM
POSITION
Ɣ$RVHOHFFLRQDU SDUDDSRUWDGHHQWUDGDGDLPDJHPDFWXDORDMXVWHGHYROXPH
pGHVDFWLYDGR&RQVXOWHRLWHP$8',2GRPHQX$-867(37
+
MENU
ENTER
ESC
RESET
'HVOLJDQGRWHPSRUDULDPHQWHRVRP
%RWmRŸź
3ULPDRERWmR087(QRFRQWUROHUHPRWR
8PDFDL[DGHGLiORJRDSDUHFHQRHFUmLQGLFDQGRTXHVLOHQFLRXRVRP
%RWmR087(
3DUDUHVWDXUDURVRPSULPDRERWmR087(RX92/80(0HVPRVHQmR¿]HUQDGD
DFDL[DGHGLiORJRGHVDSDUHFHUiDXWRPDWLFDPHQWHGHSRLVGHDOJXQVVHJXQGRV
Ɣ$RVHOHFFLRQDU SDUDDSRUWDGHHQWUDGDGDLPDJHPDFWXDORVRPp
VLOHQFLDGR&RQVXOWHRLWHP$8',2GRPHQX$-867(37
Ɣ4XDQGR IRUVHOHFFLRQDGRSDUDDSRUWD9,'(269,'(2RX
&20321(17D&&&ORVHG&DSWLRQpDFWLYDGDDXWRPDWLFDPHQWH
FDVRD&&HVWHMDUHJXODGDSDUD$872HP(;,%,5GRPHQX&&HR
VLQDOGHHQWUDGDGDVSRUWDVVXSRUWDUDIXQomR&&60
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
-
MY BUTTON
1
FOCUS
+
-
KEYSTONE
2
D-ZOOM
POSITION
+
MENU
Selecionando um sinal de entrada
3ULPDRERWmR,1387QRSURMHWRU
&DGDYH]TXHSUHPLURERWmRRSURMHWRUWURFDVXDSRUWDGHHQWUDGD
%RWmR,1387
FRPDSRUWDDFWXDOFRQIRUPHDVHJXLU
INPUT
&20387(5,1Æ&20387(5,1
9,'(2 69,'(2 &20321(17<&B3B&R3R
Æ
MENU
Æ
Ɣ4XDQGR/,*$5IRUVHOHFFLRQDGRSDUDRLWHP%86&$$8720QRPHQX
23&$242RSURMHWRUFRQWLQXDUiDYHUL¿FDUDVSRUWDVQDRUGHP
DFLPDUHSHWLGDPHQWHDWpTXHXPVLQDOGHHQWUDGDVHMDGHWHFWDGR
3ULPDRERWmR&20387(5QRFRQWUROHUHPRWR
%RWmR&20387(5
&DGDYH]TXHSUHPLURERWmRRSURMHWRUWURFDVXDSRUWDGHHQWUDGD
GDDFWXDOFRQIRUPHDEDL[R
&20387(5,1
&20387(5,1
Ɣ$RVHOHFFLRQDU/,*$5SDUDRLWHP%86&$$8720QRPHQX23&$2
RSURMHWRUPDQWHUiDYHUL¿FDomRGHFDGDSRUWDVHTXHQFLDOPHQWHDWp
TXHRVLQDOGHHQWUDGDVHMDGHWHFWDGR426HRERWmR&20387(5
IRUSUHPLGRTXDQGRDSRUWD9,'(269,'(2RX&20321(17IRU
VHOHFFLRQDGDRSURMHWRUYHUL¿FDUiDSRUWD&20387(5,1SULPHLUR
FRQWLQXDQDSiJLQDVHJXLQWH
18
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
-
FOCUS
POSITION
MY BUTTON
1
+
-
KEYSTONE
2
D-ZOOM
+
MENU
Funcionamento
Selecionando um sinal de entrada (continuação)
%RWmRVIDEO
3ULPDRERWmRVIDEOQRFRQWUROHUHPRWR
&DGDYH]TXHSUHPLURERWmRRSURMHWRUWURFDVXDSRUWDGHHQWUDGD
VIDEO
GDDFWXDOFRQIRUPHDEDL[R
COMPUTER
ASPECT
MAGNIFY
&20321(17<&B3B&R3RÆ69,'(2Æ9,'(2
ON
OFF
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
FREEZE
MY BUTTON
1
KEYSTONE
2
Ɣ$RVHOHFFLRQDU/,*$5SDUDRLWHP%86&$$8720QRPHQX23&$2RSURMHWRUPDQWHUiD
YHUL¿FDomRGHFDGDSRUWDVHTXHQFLDOPHQWHDWpTXHRVLQDOGHHQWUDGDVHMDGHWHFWDGR42
6HRERWmRVIDEOIRUSUHVVLRQDGRTXDQGRDSRUWD&20387(5,1RX&20387(5,1
IRUHPVHOHFFLRQDGDVRSURMHWRUYHUL¿FDUiSULPHLURDSRUWD&20321(17
Buscando um sinal de entrada
3ULPDRERWmR6($5&+QRFRQWUROHUHPRWR
2SURMHWRUFRPHoDUiDYHUL¿FDUVXDVSRUWDVGHHQWUDGDFRQIRUPH
DEDL[RSDUDHQFRQWUDUTXDLVTXHUVLQDLVGHHQWUDGD
'HSRLVDRHQFRQWUDUXPDHQWUDGDRSURMHWRULQWHUURPSHUiDEXVFD
HH[LEHDLPDJHP6HQmRHQFRQWUDUQHQKXPVLQDORSURMHWRU
UHWRUQDSDUDRHVWDGRVHOHFFLRQDGRDQWHVGDRSHUDomR
%RWmR6($5&+
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
&20387(5,1Æ&20387(5,1
9,'(2 69,'(2 &20321(17<&B3B&R3R
FREEZE
Æ
-
MY BUTTON
1
FOCUS
+
-
KEYSTONE
2
D-ZOOM
+
Æ
Ɣ4XDQGR/,*$5IRUVHOHFFLRQDGRSDUDRLWHP%86&$$8720QRPHQX23&$2
42RSURMHWRUFRQWLQXDUiDYHUL¿FDUDVSRUWDVQDRUGHPDFLPDUHSHWLGDPHQWHDWp
TXHXPVLQDOGHHQWUDGDVHMDGHWHFWDGR
Selecionando uma razão de aspecto
3ULPDRERWmR$63(&7QRFRQWUROHUHPRWR
&DDYH]TXHSUHPLURERWmRRSURMHWRUWURFDRPRGRGHUHODomR
HQWUHDOWXUDHDODUJXUDSRUVXDYH]
€ Para um sinal de computador
1250$/ÆÆ
%RWmR$63(&7
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
MY BUTTON
1
KEYSTONE
2
€3DUDXPVLQDOGHYtGHRVLQDOGHVYtGHRRXYtGHRFRPSRQHQWH
ÆÆ
€Para nenhum sinal
¿[R
Ɣ2ERWmR$63(&7QmRIXQFLRQDTXDQGRQmRLQWURGX]LUQHQKXPVLQDOFRUUHFWR
Ɣ0RGR1250$/PDQWpPDFRQ¿JXUDomRGHUHODomRHQWUHDOWXUDHODUJXUDRULJLQDO
19
Funcionamento
Ajustando a posição do projetor
(VWHSURMHWRUSRVVXLVXSRUWHVGHHOHYDomRQDVXDEDVH8WLOL]HRVSDUDDMXVWDUD
SRVLomRGDSURMHFomR
ER IN1
PUT
1
COM
ER IN2
PUT
COM
ER OUT
PUT
COM
USB
L
TRO
CON
LAN
IO
AUD
OUT
DEO
S-VI
2
IO IN
AUD
R
B
CB/P
CR/P
R
Y
L
IN3
O
VIDE AUDIO
Pi[LPRPP
6XSRUWHGHHOHYDomR
PRECAUÇÃO Ź1mRHOHYHRVXSRUWHDPDLVGHPP6HRVXSRUWHGH
HOHYDomRIRUDORQJDGRDOpPGROLPLWHSRGHVROWDUGRSURMHWRUHFDXVDUIHULPHQWRV
Ź,QFOLQHRSURMHWRUXQLFDPHQWHFRPHVWHVSpVGHHOHYDomR
Ź1mRLQFOLQHRSURMHWRUSDUDDOpPGHJUDXVTXDQGRHVWHHVWLYHUVXVSHQVRQR
WHFWRRXHPTXDOTXHURXWUDSDUWH
Ajustando o zoom
3UHVVLRQHRERWmRD-ZOOM +RXD-ZOOM –GRFRQWUROR
UHPRWRSDUDH[LELUQDWHODDFDL[DGHGLiORJR'=220
8VHRVERW}HVD-ZOOM +HD-ZOOM –SDUDDMXVWDUR
WDPDQKRGDLPDJHP
3DUDWHUPLQDUDRSHUDomRQmRWRTXHHVWHVERW}HVGXUDQWH
DOJXQVVHJXQGRVDWpTXHDFDL[DGHGLiORJRGHVDSDUHoD
%RWmRD-ZOOM +
END
PAGE DOWN
MUTE
OFF
FREEZE
-
FOCUS
MY BUTTON
1
+
-
KEYSTONE
2
D-ZOOM
POSITION
ENTER
ESC
Ɣ6HGHVHMDUDPSOLDUXPDSDUWHGDLPDJHPXWLOL]HDIXQomR
DXPHQWDU22
+
MENU
RESET
%RWmRD-ZOOM –
$MXVWDQGRDSRVLomRGDLPDJHP
3UHVVLRQHRERWmR326,7,21QRFRQWURORUHPRWRHQTXDQWRQmRKRXYHU
PHQXQDWHODSDUDH[LELUDFDL[DGHGLiORJR'(6/2&$5'QDWHOD
8VHRVERW}HVŸźŻHŹSDUDDMXVWDUDSRVLomRGDLPDJHP
3UHVVLRQHRERWmR326,7,21QRYDPHQWHSDUD¿QDOL]DUHVWDRSHUDomR
END
PAGE DOWN
MUTE
OFF
FREEZE
-
FOCUS
MY BUTTON
1
+
-
POSITION
KEYSTONE
2
D-ZOOM
+
MENU
ENTER
Ɣ(VWDpXPDIXQomRSDUDDOWHUDUDSRVLomRGHLPDJHP
UHGX]LGDSHODIXQomR]RRP
Ɣ(VWDIXQomRQmRVHHQFRQWUDGLVSRQtYHOQDHYHQWXDOLGDGH
GHKDYHUDOJXPPHQXHPH[LELomRQDWHOD
Ɣ(VWDIXQomRQmRVHHQFRQWUDGLVSRQtYHOVH'=220IRU
DMXVWDGRSDUDWHODLQWHLUDQDVXDFDL[DGHGLiORJR
20
ESC
RESET
%RWmR326,7,21
Funcionamento
$MXVWDQGRDIRFDJHP
%RWmR)2&86
3UHVVLRQHRERWmR)2&86RX)2&86±QRFRQWURORUHPRWR
RXRERWmR)2&86RX)2&86±GRSURMHWRUTXDQGRQmR
KRXYHUQHQKXPPHQXQDWHODSDUDH[LELUDFDL[D)2&2QDWHOD
8WLOL]HRVERW}HV)2&86H)2&86±SDUDDMXVWDUDIRFDJHP
GDWHOD$SyVRDMXVWHGDIRFDJHPDJXDUGHXPPRPHQWRDWp
TXHDFDL[D)2&2GHVDSDUHoDFDVRGHVHMHH[LELUTXDOTXHU
RXWURPHQXQDWHODSUHVVLRQDQGRRERWmR0(18GRSURMHWRU
END
PAGE DOWN
MUTE
OFF
FREEZE
-
MY BUTTON
1
FOCUS
+
-
KEYSTONE
2
D-ZOOM
POSITION
+
MENU
ENTER
ESC
RESET
%RWmR)2&86±
Usando o recurso de ajuste automático
3ULPDRERWmR$872QRFRQWUROHUHPRWR
3UHPLUHVWHERWmRH[HFXWDRVHJXLQWH
€Para um sinal de computador
$SRVLomRYHUWLFDOKRUL]RQWDOHDIDVHKRUL]RQWDOVHUi
DXWRPDWLFDPHQWHDMXVWDGD
9HUL¿TXHVHDMDQHODGHDSOLFDomRpGH¿QLGDSDUDVHX
WDPDQKRPi[LPRDQWHVGHWHQWDUXVDUHVWDIXQomR8PD
LPDJHPHVFXUDSRGHVHUDLQGDDMXVWDGDLQFRUUHFWDPHQWH
8VHXPDLPDJHPFODUDDRDMXVWDU
%RWmR$872
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
-
FOCUS
MY BUTTON
1
+
-
POSITION
KEYSTONE
2
D-ZOOM
+
MENU
€3DUDXPVLQDOGHYtGHRHVYtGHR
2IRUPDWRGHYtGHRTXHPHOKRUVHDGHTXDDRVLQDOGHHQWUDGDUHVSHFWLYRVHUi
VHOHFFLRQDGRDXWRPDWLFDPHQWH(VWDIXQomRHVWiGLVSRQtYHOVRPHQWHTXDQGR
VHOHFFLRQDU$872SDUDXPLWHP)250$729,'(2QRPHQX(175'34$V
SRVLo}HVYHUWLFDOHKRUL]RQWDOVHUmRDXWRPDWLFDPHQWHGH¿QLGDVSDUDRSDGUmR
€3DUDXPVLQDOGHYtGHRFRPSRQHQWH
$SRVLomRYHUWLFDOKRUL]RQWDOHDIDVHKRUL]RQWDOVHUiDXWRPDWLFDPHQWH
DMXVWDGD
Ɣ$RSHUDomRGHDMXVWHDXWRPiWLFRXVDDSUR[VHJXQWRV2EVHUYHWDPEpP
TXHWDOYH]QmRIXQFLRQHFRUUHFWDPHQWHFRPDOJXPDHQWUDGD$RH[HFXWDU
HVWDIXQomRSDUDXPVLQDOGHYtGHRpSRVVtYHODSDUHFHUXPLWHPH[WUDWDO
FRPRXPDOLQKDIRUDGDLPDJHP
Ɣ2VLWHQVDMXVWDGRVSRUHVWDIXQomRSRGHPYDULDUTXDQGR'(7$/+$'2RX
'(6/,*$5IRUVHOHFFLRQDGRSDUDRLWHP$-867($872GRLWHP6(59,d2
QRPHQX23&$245
21
Funcionamento
&RUULJLQGRGLVWRUo}HVNH\VWRQH
%RWmR.(<6721(
3ULPDRERWmR.(<6721(QRFRQWUROH
UHPRWR$SDUHFHXPDFDL[DGHGLiORJR
SDUDDX[LOLDUDFRUULJLUDGLVWRUomR
MAGNIFY
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
-
8VHRVERW}HVFXUVRUŸźSDUDDMXVWDUD
FRUUHFomRGDGLVWRUomRWUDSH]RLGDO
MY BUTTON
1
FOCUS
+
-
KEYSTONE
2
D-ZOOM
POSITION
+
MENU
ENTER
ESC
RESET
3DUDIHFKDUDFDL[DGHGLiORJRHFRQFOXLUHVWDRSHUDomRSULPDRERWmR
.(<6721(QRYDPHQWH0HVPRVHQmR¿]HUQDGDDFDL[DGHGLiORJR
GHVDSDUHFHUiDXWRPDWLFDPHQWHGHSRLVGHDOJXQVVHJXQGRV
Ɣ$IDL[DGHDMXVWHGHVWDFRUUHFomRYDULDUiGHDFRUGRFRPDVHQWUDGDV3DUD
DOJXPDHQWUDGDHVWDIXQomRWDOYH]QmRIXQFLRQHEHP
Ɣ(VWDIXQomR¿FDUiLQGLVSRQtYHOTXDQGR'HWHFWRUGHWUDQVLomRHVWLYHUOLJDGR51
%RWmR
0$*1,)<
212))
Usando o recurso de aumento
3ULPDRERWmR21GH0$*1,)<QRFRQWUROHUHPRWR
$LQGLFDomR³$80(17(´DSDUHFHUiQRHFUmHRSURMHWRU
HQWUDUiQRPRGR$80(17(6HRERWmR21GR0$*1,)<IRU
RSULPHLURDVHUSUHVVLRQDGRDSyVOLJDURSURMHWRURWDPDQKR
GDLPDJHPVHUiDXPHQWDGRHPGXDVYH]HV$LQGLFDomR
GHVDSDUHFHUiHPDOJXQVVHJXQGRVVHPQHQKXPDRSHUDomR
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
MY BUTTON
1
KEYSTONE
2
8VHRFXUVRUŸźSDUDDMXVWDURQtYHOGH]RRP$LPDJHGHVLQDOGHYtGHR
VYtGHRRXGHYtGHRFRPSRQHQWHSRGHVHUDXPHQWDGDHPDWpYH]HVHDGR
VLQDOGHFRPSXWDGRUSRGHVHUDXPHQWDGDHPDWpYH]HV
3DUDPRYHUSDUDDiUHDGH]RRPSULPDRERWmR326,7,21QRPRGR
$80(17(HGHSRLVXVHRVERW}HVFXUVRUŸźŻŹSDUDPRYHUDiUHD(
SDUD¿QDOL]DUDiUHDGH]RRPSULPDRERWmR326,7,21QRYDPHQWH
3DUDVDLUGRPRGR$80(17(HUHVWDXUDURHFUmSDUDQRUPDOSULPDRERWmR
2))GH0$*1,)<QRFRQWUROHUHPRWR
Ɣ2SURMHWRUVDLDXWRPDWLFDPHQWHGRPRGR$80(17(TXDQGRRVLQDOGH
HQWUDGDIRUDOWHUDGRRXTXDQGRDFRQGLomRGHH[LELomRIRUDOWHUDGD
Ɣ1RPRGR$80(17(DFRQGLomRGHGLVWRUomRSRGHYDULDUHVHUiUHVWDXUDGD
TXDQGRRSURMHWRUVDLUGRPRGR$80(17(
NOTA ‡RQtYHOGH]RRPSRGHVHUDMXVWDGRFRPSUHFLVmR2EVHUYH
FXLGDGRVDPHQWHRHFUmSDUHQFRQWUDURQtYHOTXHSUHWHQGH
22
Funcionamento
&RQJHODQGRDWHOD
%RWmR)5((=(
3ULPDRERWmR)5((=(QRFRQWUROHUHPRWR
$LQGLFDomR³3$5$'$´DSDUHFHUiQRHFUmFRQWXGRD
LQGLFDomRQmRDSDUHFHUiTXDQGRVHOHFFLRQDU'(6/,*$5
SDUDRLWHP0(16$*QRPHQX7(/$41HRSURMHWRU
HQWUDUiQRPRGR3$5$'$TXHFRQJHODDLPDJHP
3DUDVDLUGRPRGR3$5$'$HUHVWDXUDURHFUmSDUDQRUPDO
SULPDRERWmR)5((=(QRYDPHQWH
VIDEO
COMPUTER
ASPECT
MAGNIFY
SEARCH
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
-
MY BUTTON
1
FOCUS
+
-
KEYSTONE
2
D-ZOOM
POSITION
+
MENU
ENTER
Ɣ2SURMHWRUVDLDXWRPDWLFDPHQWHGRPRGR3$5$'$TXDQGRXPGRVERW}HVGR
SURMHWRURXGRFRQWUROHUHPRWRUHPRWR67$1'%<216($5&+&20387(5
9,'(2%/$1.$87292/80(087(.(<6721(0(180$*1,)<H
0<%87721H[FHSWR0,1+$0(0RX02'2)272pDWULEXtGRSDUD
44pSUHPLGR
Ɣ6HRSURMHWRUFRQWLQXDSURMHFWDUXPDLPDJHPSDUDGDSRUXPORQJRSHUtRGRR
SDLQHO/&'SRGHTXHLPDU1mRGHL[HRSURMHWRUQRPRGR3$5$'$SRUPXLWR
WHPSR
$SDJDQGRWHPSRUDULDPHQWHDWHOD
3ULPDRERWmR%/$1.QRFRQWUROHUHPRWR
2HFUm6835(66,0$VHUiH[LELGRHPYH]GRHFUmGRVLQDO
GHHQWUDGD&RQVXOWHRLWHP6835(66,0$QRPHQX7(/$
38
3DUDVDLUGRHFUm6835(66,0$HUHWRUQDUSDUDRHFUmGH
VLQDOGHHQWUDGDSULPDRERWmR%/$1.QRYDPHQWH
%RWmR%/$1.
VIDEO
COMPUTER
ASPECT
MAGNIFY
AUTO
BLANK
HOME
PAGE UP
VOLUME
END
PAGE DOWN
MUTE
ON
OFF
FREEZE
Ɣ2SURMHWRUUHJUHVVDDXWRPDWLFDPHQWHjWHODGHVLQDOGHHQWUDGD
TXDQGRXPGRVERW}HVGRSURMHWRURXERW}HVGRFRQWUROHUHPRWR
H[FHSWRSDUDRVERW}HV$63(&7326,7,210$*1,)<RX)5((=(
FRPH[FHSomRWDPEpPSDUD0<%87721FDVR0,1+$0(0RX
02'2)272HVWHMDPDWULEXtGRV44VHMDPSUHVVLRQDGRV
SEARCH
-
FOCUS
MY BUTTON
1
+
-
POSITION
KEYSTONE
2
D-ZOOM
+
MENU
ENTER
NOTA ‡2VRPQmRpFRQHFWDGRFRPDIXQomRGHHFUm6835(66,0$
6HQHFHVViULRGH¿QDRYROXPHRXVLOHQFLDUSULPHLUR
‡6HGHVHMDUVXSULPLUDLPDJHPGDWHODHWRUQDURVRPPXGRDRPHVPRWHPSR
XWLOL]HDIXQomR$908'2TXHpUHTXHULGDSDUDVHUDWULEXtGDDQWHFLSDGDPHQWH
DXPGRV0<%87721QRFRQWURORUHPRWR44
23
Funcionamento
Usando a função menu
(VWHSURMHWRUWHPRVVHJXLQWHVPHQXV
&(1$,0$*(0(175'$-867(7(/$23&$25('(&&H0(18)$&
20(18)$&FRQVLVWHGHIXQo}HVIUHTXHQWHPHQWHXVDGDHRXWURVPHQXVVmR
FODVVL¿FDGRVHPFDGDREMHFWLYRHDJUHJDGRVFRPRPHQX$YDQoDGR
&DGDXPGHVWHVPHQXVpRSHUDGRFRPRVPHVPRVPpWRGRV$VRSHUDo}HV
EiVLFDVGHVWHVPHQXVVmRFRQIRUPHDVHJXLU
%RWmR(17(5 %RWmR0(18
%RW}HVFXUVRU
LAMP
TEMP
%RWmR0(18
POWER
POSITION
MENU
STANDBY/ON
ENTER
ESC
INPUT
RESET
%RWmR(6&
%RWmR5(6(7
YS
KE
ZO
D-
ME
NU
OM
+
2
TT
ON
BU
-
1
MY
T
SE
+
EN
ES
C
PO
SITI
ON
-
TE
R
FO
RE
CU
S
ZE
F
EE
FR
+ FOCUS
ON
FOCUS -
OF
2
IN
EO
TO
NE
MU
WN
GE
PA
D
EN
AUDIO
OUT
S-VID
R
CR/P
B
CB/P
R
Y
L
IN3
VIDEO AUDIO
DO
VIDE
ME
CT
HO
PE
AS
IFY
GN
1
IN2
OUT
AUDIO
USB
ROL
LAN
IN1
MA
UTER
COMP
UTER
COMP
UTER
COMP
CONT
TE
ER
UT
O
PA
GE
CO
UP
MP
VO
AU
TO
LU
ME
SE
AR
BL
CH
AN
K
MENU
3ULPDRERWmR0(18QRSURMHWRURXFRQWUROHUHPRWR
2PHQX$YDQoDGRRX0(18)$&TXHWHPSULRULGDGHVRPHQWHGHSRLVTXH
OLJDGRDSDUHFHU
6HSUHWHQGHUPRYHUDSRVLomRGHPHQXXVHRVERW}HVFXUVRUGHSRLVGH
SUHPLWRERWmR326,7,21(QTXDQWRRSURMHWRUH[LELUTXDOTXHUPHQXRERWmR
0(18QRSURMHWRUIXQFLRQDFRPRRVERW}HVFXUVRU
1R0(18)$&
6HSUHWHQGHUDOWHUiORSDUDRPHQX$YDQoDGR
VHOHFFLRQH9i3DUD0HQX$YDQoDGR
8VHRVERW}HVFXUVRUŸźSDUDVHOHFFLRQDUXP
LWHPSDUDRSHUDU
8VHRVERW}HVFXUVRUŸźSDUDVHOHFFLRQDUXP
LWHP
0(18)$&
FRQWLQXDQDSiJLQDVHJXLQWH
24
Funcionamento
Usando a função menu (continuação)
1R0HQX$YDQoDGR
8VHRVERW}HVFXUVRUŸźSDUDVHOHFFLRQDUXPLWHPSDUDRSHUDU
6HSUHWHQGHDOWHUiORSDUD0(18)$&VHOHFFLRQH
0(18)$&
'HSRLVSULPDRERWmRFXUVRUŹRXRERWmR(17(5
SDUDVHOHFFLRQDUXPLWHP2PHQXGHFDPDGDLQIHULRU
GRLWHPVHOHFFLRQDGRDSDUHFHUi
0HQX$YDQoDGR
8VHRVERW}HVFXUVRUŸźSDUDVHOHFFLRQDUXPLWHPSDUDRSHUDU
'HSRLVSULPDRERWmRFXUVRUŹRX(17(5SDUDSURJUHGLU2PHQXGH
RSHUDomRGRLWHPVHOHFFLRQDGRDSDUHFHUi
8VHRVERW}HVFXUVRUŸźSDUDVHOHFFLRQDUXPLWHPSDUDRSHUDU
Ɣ$OJXPDVIXQo}HVQmRSRGHPVHUH[HFXWDGDVTXDQGRXPDFHUWDSRUWDp
VHOHFFLRQDGDRXTXDQGRXPFHUWRVLQDOGHHQWUDGDpH[LELGR
Ɣ6HSUHWHQGHUHDMXVWDUDRSHUDomRSULPDRERWmR5(6(7QRFRQWUROHUHPRWR
GXUDQWHDRSHUDomR2EVHUYHTXHDOJXQVLWHQVH[,',20$)$6(+
92/80(QmRSRGHPVHUUHDMXVWDGRV
Ɣ1RPHQX$YDQoDGRVHSUHWHQGHUHWRUQDUSDUDRHFUmDQWHULRUSULPDRERWmR
FXUVRUŻRX(6&QRFRQWUROHUHPRWR
3ULPDRERWmR0(18QRFRQWUROHUHPRWRQRYDPHQWHSDUDIHFKDURPHQX
HFRQFOXLUHVWDRSHUDomR0HVPRVHQmR¿]HUQDGDDFDL[DGHGLiORJR
GHVDSDUHFHUiDXWRPDWLFDPHQWHGHSRLVGHDOJXQVVHJXQGRV
25
MENU FAC.
0(18)$&
'R0(18)$&RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸź'HSRLV
H[HFXWHRGHDFRUGRFRPDWDEHODVHJXLQWH
Item
'HVFULomR
$63(&72
8VDURVERW}HVŻŹWURFDGHPRGRSDUDUHODomRHQWUHDOWXUDODUJXUD
&RQVXOWHRLWHP$63(&72QRPHQX,0$*(031
D-ZOOM
.(<6721(
8WLOL]DQGRRVERW}HVŻŹDMXVWDR]RRP
&RQVXOWHRLWHP'=220QRPHQX$-867(36
8VDURVERW}HVŻŹFRUULJHDGLVWRUomRYHUWLFDO
&RQVXOWHRLWHP.(<6721( QRPHQX$-867(36
8VDURVERW}HVŻŹWURFDGHPRGRGHLPDJHP
2VPRGRVGHLPDJHPVmRFRPELQDo}HGDVFRQ¿JXUDo}HVGH
*$0$H7(03&256HOHFFLRQHRPRGRDGHTXDGRGHDFRUGRFRP
DIRQWHSURMHFWDGD
1250$/Ù&,1(0$Ù',1Æ0,&2Ù7(/$35(7$
/8='2',$Ù7(/$%5$1&$Ù7(/$9(5'(
02'2)272
1250$/
&,1(0$
',1Æ0,&2
7(/$35(7$
7(/$9(5'(
7(/$%5$1&$
/8='2',$
7(03&25
0e',225,*,1$/
%$,;225,*,1$/
$/7225,*,1$/
$/7%5,/+225,*,1$/
$/7%5,/+225,*,1$/
0e',225,*,1$/
$/7%5,/+225,*,1$/
*$0$
25,*,1$/
25,*,1$/
25,*,1$/
25,*,1$/
25,*,1$/
25,*,1$/
25,*,1$/
‡4XDQGRDFRPELQDomRGH*$0$H7(03&25GLIHUHGRVPRGRV
SUpDWULEXtGRVDFLPDDH[LELomRQRPHQXSDUD02'2)272p
³3(5621´&RQVXOWH*$0$28H7(03&2529LWHQVQR
PHQX&(1$
‡4XDQGRDIXQomRpH[HFXWDGDXPFHUWRLWHPH[WUDWDOFRPRXPD
OLQKDDSDUHFH
FRQWLQXDQDSiJLQDVHJXLQWH
26
MENU FAC.
MENU FAC. (continuação)
Item
%5,/+2
&2175$67(
COR
MATIZ
1,7,'(=
6,/(1&,$0(
,0$*(63(/+
'HVFULomR
8VDURVERW}HVŻŹDMXVWDREULOKR
&RQVXOWHRLWHP%5,/+2QRPHQX&(1$28
8VDURVERW}HVŻŹDMXVWDRFRQWUDVWH
&RQVXOWHRLWHP&2175$67(QRPHQX&(1$28
8VDURVERW}HVŻŹDMXVWDDUHVLVWrQFLDGDFRULQWHLUD
&RQVXOWHRLWHP&25QRPHQX&(1$29
8VDURVERW}HVŻŹDMXVWDDPDWL]
&RQVXOWHRLWHP0$7,=QRPHQX&(1$29
8VDURVERW}HVŻŹDMXVWDDQLWLGH]
&RQVXOWHRLWHP1,7,'(=QRPHQX&(1$30
8VDURVERW}HVŻŹOLJDGHVOLJDRPRGRVLOHQFLDU
&RQVXOWHRLWHP6,/(1&,$0(QRPHQX$-867(36
8VDURVERW}HVŻŹOLJDGHVOLJDRHVWDGRGHHVSHOKR
&RQVXOWHRLWHP,0$*(63(/+QRPHQX$-867(36
5($-867(
([HFXWDUHVWHLWHPUHDMXVWDWRGRVRVLWHQV0(18)$&H[FHSWR
7(032),/752H,',20$
3UHVVLRQDURERWmR5(6(7RXRERWmRŹH[LEHXPDFDL[DGH
GLiORJR3DUDUHLQLFLDUVHOHFFLRQDU5($-867(XWLOL]DQGRRERWmR
ŸUHDOL]DRUHDMXVWDPHQWR
7(032),/752
2XVRGRWHPSRGR¿OWURGHDUpPRVWUDGRQRPHQX
([HFXWDUHVWHLWHPUHDMXVWDRWHPSRGR¿OWURTXHFRQWDRWHPSR
8PDFDL[DGHGLiORJRpH[LELGDSDUDFRQ¿UPDomR
3UHVVLRQDURERWmR5(6(7RXRERWmRŹH[LEHXPDFDL[DGH
GLiORJR3DUDUHLQLFLDURWHPSRUL]DGRUGR¿OWURVHOHFFLRQDU
5($-867(XWLOL]DQGRRERWmRŸUHDOL]DRUHDMXVWDPHQWR
&RQVXOWHRLWHP7(032),/752QRPHQX23&$243
IDIOMA
8VDQGRRVERW}HVŻŹDOWHUDRLGLRPDGHH[LELomR
&RQVXOWHRLWHP,',20$QRPHQX7(/$38
6HOHFFLRQH9i3DUD0HQX$YDQoDGRQRPHQXHSULPDRERWmRŹ
Vá Para
RXRERWmR(17(5SDUDXVDURPHQXGH&(1$,0$*(0(175'
0HQX$YDQoDGR
$-867(7(/$23&$25('(RX&&
27
Menu CENA
0HQX&(1$
'RPHQX&(1$RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸźHSULPD
RERWmRFXUVRUŹRXRERWmR(17(5SDUDH[HFXWDUR
LWHP'HSRLVH[HFXWHRGHDFRUGRFRPDWDEHODVHJXLQWH
'HVFULomR
Item
%5,/+2
8VDURVERW}HVŸźDMXVWDRYROXPH
$OWRÙ(VFXUR
&2175$67(
8VDURVERW}HVŸźDMXVWDRYROXPH
$OWRÙ)UDFR
8VDURVERW}HVŸźWURFDSDUDRPRGRJDPD
#1 ORIGINAL #1 PERSON #2 ORIGINAL #2 PERSON
#3 ORIGINAL
#6 PERSON
#3 PERSON
#6 ORIGINAL
#5 PERSON #5 ORIGINAL #4 PERSON #4 ORIGINAL
3DUDDMXVWDUR3(5621
*$0$
6HOHFFLRQDUXPPRGRFXMRQRPHLQFOXL
3(5621HGHSRLVSUHPLURERWmRŹ
RXERWmR(17(5H[LEHXPDFDL[DGH
GLiORJRSDUDDMXVWDURPRGR
(VWDIXQomRp~WLOTXDQGRSUHWHQGH
DOWHUDUREULOKRGHWRQVHPSDUWLFXODU
6HOHFFLRQHXPLWHPFRPRVERW}HVŻŹ
HDMXVWHRQtYHOFRPRVERW}HVŸź
3RGHH[LELUXPSDGUmRGHWHVWHSDUDYHUL¿FDURHIHLWRGHVHXDMXVWH
DRSUHPLURERWmR(17(5
&DGDYH]TXHSUHPLURERWmR(17(5RSDGUmRpDOWHUDGRFRQIRUPHDEDL[R
1HQKXPSDGUmRÖ(VFDODGHFLQ]DGHSDVVRV
5DPSDÕ(VFDODGHFLQ]DGHSDVVRV
$VRLWREDUUDVGHHTXDOL]DomRFRUUHVSRQGHQWHDRLWRQtYHLVGHWRQV
GRSDGUmRGHWHVWHHVFDODGHFLQ]DGHSDVVRVH[FHSWRRPDLV
HVFXURQRILQDOjHVTXHUGD
6HSUHWHQGHUDMXVWDURžWRPGRILQDOjHVTXHUGDQRSDGUmRGH
WHVWHXVHDEDUUDGHDMXVWHGHHTXDOL]DomR³´2WRPPDLVHVFXUR
QRILQDOjHVTXHUGDGRSDGUmRGHWHVWHQmRSRGHVHUFRQWURODGR
FRPTXDOTXHUEDUUDGHDMXVWHGHHTXDOL]DomR
‡$RH[HFXWDUHVWDIXQomRDVOLQKDVRXRXWUDVGLVWRUoRHVSRGHPRFRUUHU
FRQWLQXDQDSiJLQDVHJXLQWH
28
Menu CENA
Menu CENA (continuação)
'HVFULomR
Item
8VDURVERW}HVŸźWURFDRPRGRGHWHPSHUDWXUDGHFRU
#1 ALTO ORIGINAL #1 ALTO PERSON #2 MÉDIO ORIGINAL
#2 MÉDIO PERSON
#6 ALT-BRILHO-3 PERSON
#3 BAIXO ORIGINAL
#6 ALT-BRILHO-3 ORIGINAL
#3 BAIXO PERSON
#5 ALT-BRILHO-2 PERSON
#5 ALT-BRILHO-2 ORIGINAL #4 ALT-BRILHO-1 PERSON #4 ALT-BRILHO-1 ORIGINAL
3DUDDMXVWDUR3(5621
TEMP COR
6HOHFFLRQDUXPPRGRFXMRQRPHLQFOXLU
3(5621HGHSRLVSUHPLURERWmRŹ
RX(17(5H[LEHXPDFDL[DGHGLiORJR
SDUDDX[LOLDUQRDMXVWHGH'(69,2H
*$1+2GRPRGRVHOHFFLRQDGR
2VDMXVWHVGH'(69,2PXGDPD
LQWHQVLGDGHGDFRUQRVWRQVLQWHULURVGR
SDGUmRGHWHVWH
$MVXWHVGH*$1+2DIHFWDSULQFLSDOPHQWHDLQWHQVLGDGHGHFRUQRV
WRQVFODURVGRSDGUmRGHWHVWH
6HOHFFLRQHXPLWHPFRPRVERW}HVŻŹHDMXVWHRQtYHOFRPRV
ERW}HVŸź
3RGHH[LELUXPSDGUmRGHWHVWHSDUDYHUL¿FDURHIHLWRGHVHXDMXVWH
DRSUHPLURERWmR(17(5
&DGDYH]TXHSUHPLURERWmR(17(5RSDGUmRpDOWHUDGRFRQIRUPH
DEDL[R
1HQKXPSDGUmRÖ(VFDODGHFLQ]DGHSDVVRV
5DPSDÕ(VFDODGHFLQ]DGHSDVVRV
‡$RH[HFXWDUHVWDIXQomRDVOLQKDVRXRXWUDGLVWRUomRSRGHP
DSDUHFHU
COR
8VDURVERW}HVŸźDMXVWDDUHVLVWrQFLDGDFRULQWHLUD
)RUWHÙ)UDFD
‡(VWHLWHPVySRGHVHUVHOHFFLRQDGRSDUDXPVLQDOGHYtGHR
VYtGHRRXVLQDOGHFRPSRQHQWHYtGHR
MATIZ
8VDURVERW}HVŸźDMXVWDRYROXPH
(VYHUGHDGRÙ$YHUPHOKDGR
‡(VWHLWHPVySRGHVHUVHOHFFLRQDGRSDUDXPVLQDOGHYtGHR
VYtGHRRXVLQDOGHFRPSRQHQWHYtGHR
FRQWLQXDQDSiJLQDVHJXLQWH
29
Menu CENA
Menu CENA (continuação)
Item
'HVFULomR
1,7,'(=
8VDURVERW}HVŸźDMXVWDRYROXPH
)RUWHÙ)UDFD
‡3RGHRFRUUHUDOJXPUXtGRHRXHFUmSRGHFLQWLODUDRID]HURDMXVWH
,VWRpXPSUREOHPDGHIXQFLRQDPHQWR
(VWHSURMHWRUWHPPHPyULDVGHGDGRVGHDMXVWHSDUDWRGRVRV
LWHQVGRPHQX&(1$
6HOHFFLRQDUXPDIXQomRFRPRVERW}HVŸźHSUHPLUŹRXR
ERWmR(17(5H[HFXWDFDGDIXQomR
&$55(*Ù&$55(*Ù&$55(*Ù&$55(*
*8$5'$5Ù*8$5'$5Ù*8$5'$5Ù*8$5'$5
0,1+$0(0
30
&$55(*&$55(*&$55(*&$55(*
([HFXWDDIXQomR&$55(*RVGDGRVGDPHPyULDOLJDGDQRQ~PHUR
LQFOXtGRQRQRPHGDIXQomRHDMXVWDDLPDJHPDXWRPDWLFDPHQWH
GHSHQGHQGRGDGDWD
‡$VIXQo}HV&$55(*FXMDPHPyULDOLJDGDQmRWHPGDGRVVmR
GHVFDUWDGDV
‡/HPEUHVHGHTXHDFRQGLomRDMXVWDGDDFWXDOVHUiSHUGLGDDR
FDUUHJDURVGDGRVVHSUHWHQGHUPDQWHURDMXVWHDFWXDOJXDUGHR
DQWHVGHH[HFXWDUXPDIXQomR&$55(*
‡3RGHRFRUUHUDOJXPUXtGRHRHFUmSRGHFLQWLODUSRUXPPRPHQWR
DRFDUUHJDURVGDGRV,VWRQmRpXPSUREOHPDGHIXQFLRQDPHQWR
‡3RGHH[HFXWDUDIXQomR&$55(*FRP0<%87721&RQVXOWHR
LWHP0(8%27­2QRPHQX23&$244
*8$5'$5*8$5'$5*8$5'$5*8$5'$5
([HFXWDUDIXQomR*8$5'$5JXDUGDRVGDGRVDFWXDLVGHDMXVWH
QDPHPyULDOLJDGDFRPRQ~PHURLQFOXtGRQRQRPHGDIXQomR
‡/HPEUHVHGHTXHRVGDGRVDFWXDLVTXHVmRDUPD]HQDGRVQD
PHPyULDVHUmRSHUGLGRVDRJXDUGDUXPQRYRGDGRQDPHPyULD
Menu IMAGEM
0HQX,0$*(0
'RPHQX,0$*(0RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸźHSULPDR
ERWmRFXUVRUŹRXRERWmR(17(5'HSRLVH[HFXWHRGH
DFRUGRFRPDWDEHODVHJXLQWH
'HVFULomR
Item
8VDURVERW}HVŻŹWURFDGHPRGRSDUDUHODomRHQWUHDOWXUD
ODUJXUD
Para um sinal de computador
1250$/ÙÙ
$63(&72
3DUDXPVLQDOGHYtGHRVLQDOGHVYtGHRRXYtGHRFRPSRQHQWH
ÙÙ
Para nenhum sinal
¿[R
‡2PRGR1250$/PDQWpPDUHODomRHQWUHDOWXUDDOWXUDGHVLQDO
62%5((;3/
8VHRVERW}HVŸźSDUDDMXVWDUDSURSRUomRGHVREUHH[SORU
*UDQGHUHGX]DLPDJHPÙ3HTXHQRDXPHQWDDLPDJHP
‡(VWHLWHPVySRGHVHUVHOHFFLRQDGRSDUDXPVLQDOGHYtGHR
VYtGHRHVLQDOGHFRPSRQHQWHYtGHR
‡4XDQGRHVWHDMXVWHIRUPXLWRJUDQGHSRGHRFRUUHUXPDFHUWDGHJUDGDomR
GDiUHDGRTXDGURGDLPDJHP(PWDOFDVRDMXVWHRSHTXHQR
326,&$29
8VHRVERW}HVŸźSDUDDMXVWDUDSRVLomRYHUWLFDO
$FLPDÙ$EDL[R
‡6XSHUDMXVWDUDSRVLomRYHUWLFDOSRGHID]HUFRPTXHUXtGR
DSDUHoDQRHFUm6HLVWRRFRUUHUUHDMXVWHDSRVLomRYHUWLFDOSDUDD
FRQ¿JXUDomRSDGUmR
3ULHPLURERWmR5(6(7TXDQGRVHOHFFLRQDU326,&$29UHDMXVWDUi
326,&$29SDUDDFRQ¿JXUDomRSDGUmR
‡4XDQGRHVWDIXQomRIRUUHDOL]DGDSDUDXPVLQDOGHYtGHRVLQDO
VYtGHRRXVLQDOGHFRPSRQHQWHYtGHRRDOFDQFHDMXVWiYHO
GHSHQGHGDGH¿QLomRGD62%5((;3/acima1mRpSRVVtYHO
DMXVWDUTXDQGR62%5((;3/IRUGHILQLGRSDUD
FRQWLQXDQDSiJLQDVHJXLQWH
31
Menu IMAGEM
Menu IMAGEM (continuação)
Item
'HVFULomR
326,&$2+
8VHRVERW}HVŸźSDUDDMXVWDUDSRVLomRKRUL]RQWDO
(VTXHUGDÙ'LUHLWD
‡6XSHUDMXVWDUDSRVLomRKRUL]RQWDOSRGHID]HUFRPTXHUXtGR
DSDUHoDQRHFUm6HLVWRRFRUUHUUHDMXVWHDSRVLomRKRUL]RQWDOSDUD
DFRQ¿JXUDomRSDGUmR3UHPLURERWmR5(6(7TXDQGRVHOHFFLRQDU
326,&$2+UHDMXVWDUi326,&$2+SDUDDFRQ¿JXUDomRSDGUmR
‡4XDQGRHVWDIXQomRIRUUHDOL]DGDSDUDXPVLQDOGHYtGHRVLQDO
VYtGHRRXVLQDOGHFRPSRQHQWHYtGHRRDOFDQFHDMXVWiYHO
GHSHQGHGDGH¿QLomRGD62%5((;3/311mRpSRVVtYHO
DMXVWDUTXDQGR62%5((;3/IRUGH¿QLGRSDUD
)$6(+
8VDURVERW}HVŸźSDUDDMXVWDUDIDVHKRUL]RQWDOSDUDHOLPLQDUFLQWLODomR
'LUHLWDÙ(VTXHUGD
‡(VWHLWHPVySRGHVHUVHOHFFLRQDGRSDUDXPVLQDOGHFRPSXWDGRU
RXVLQDOGHFRPSRQHQWHYLGHR
7$0$1+2+
8VHRVERW}HVŸźSDUDDMXVWDURWDPDQKRKRUL]RQWDO
*UDQGHÙ3HTXHQR
‡(VWHLWHPVySRGHVHUVHOHFFLRQDGRSDUDXPVLQDOGHFRPSXWDGRU
‡$RDMXVWDUH[FHVVLYDPHQWHDLPDJHPWDOYH]QmRVHMDH[LELGD
FRUUHFWDPHQWH(PWDOFDVRIDoDRUHDMXVWHDRSUHPLURERWmR
5(6(7GXUDQWHHVWDRSHUDomR
(;(&87$$-86
$8720
([HFXWDUHVWHLWHPDFWLYDDIXQomRGHDMXVWHDXWRPiWLFR
Para um sinal de computador
$SRVLomRYHUWLFDODSRVLomRKRUL]RQWDOHIDVHKRUL]RQWDO31, 32VHUi
DXWRPDWLFDPHQWHDMXVWDGD9HUL¿TXHVHDMDQHODGDDSOLFDomRHVWiGH¿QLGDSDUD
VHXWDPDQKRPi[LPRDQWHVGHWHQWDUXVDUHVWDIXQomR8PDLPDJHPHVFXUD
SRGHVHUDLQGDDMXVWDGDLQFRUUHFWDPHQWH8VHXPDLPDJHPFODUDDRDMXVWDU
3DUDXPVLQDOGHYtGHRHVYtGHR
2IRUPDWRGHYtGHRTXHPHOKRUVHDGHTXDDRVLQDOGHHQWUDGDUHVSHFWLYR
VHUiVHOHFFLRQDGRDXWRPDWLFDPHQWH(VWDIXQomRHVWiGLVSRQtYHOVRPHQWH
TXDQGR$872pVHOHFFLRQDGRSDUDRLWHP)250$729,'(2QRPHQX
(175'34 $VSRVLo}HVYHUWLFDOHKRUL]RQWDOVHUmRDXWRPDWLFDPHQWH
FRQ¿JXUDGDSDUDDGH¿QLomRSDGUmR
3DUDXPVLQDOGHYtGHRFRPSRQHQWH
$VSRVLo}HVYHUWLFDOHKRUL]RQWDOHIDVHKRUL]RQWDOVHUmR
DXWRPDWLFDPHQWHGH¿QLGDVSDUDRYDORUSDGUmR
‡$RSHUDomRGHDMXVWHDXWRPiWLFRUHTXHUDSUR[VHJXQGRV2EVHUYH
WDPEpPTXHWDOYH]QmRIXQFLRQHFRUUHFWDPHQWHFRPDOJXPDHQWUDGD
4XDQGRH[HFXWDUHVWDIXQomRSDUDXPVLQDOGHYtGHRXPFHUWRH[WUDWDO
FRPXPOLQKDSRGHDSDUHFHUIRUDGDLPDJHP
‡2VLWHQVDMXVWDGRVSRUHVWDIXQomRSRGHYDULDUTXDQGRVHOHFFLRQDU
'(7$/+$'2RX'(6/,*$5SDUDRLWHP$-867($872GRLWHP
6(59,d2QRPHQX23&$245
32
Menu ENTRD
0HQX(175'
'RPHQX(175'RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸźH
SULPDRERWmRFXUVRUŹQRERWmR(17(5SDUH[HFXWDU
RLWHP'HSRLVH[HFXWHRGHDFRUGRFRPDWDEHOD
VHJXLQWH
'HVFULomR
Item
352*5(66
5(',179Ë
(63&25
&20321(17
8VDURVERW}HVŸźPXGDSDUDRPRGRGHSURJUHVVR
7(/(9,6­2Ù),/0(Ù'(6/,*$5
‡(VWDIXQomRVyIXQFLRQDQXPVLQDOHQWUHODoDGRGHXPDHQWUDGD
9,'(2RX69,'(2HSDUDXPVLQDOLLRXLLQD
HQWUDGD&20321(179,'(2
‡4XDQGR7(/(9,6­2R),/0(IRUDLPDJHP¿FDUiQtWLGD),/0(
VHDGDSWDDVLVWHPDGHFRQYHUVmRGHSXOOGRZQ0DVHVWHV
SRGHPFDXVDUFHUWRGHIHLWRSRUH[HPSOROLQKDUHFRUWDGD(PWDO
FDVRVHOHFFLRQH'(6/,*$5PHVPRTXHDLPDJHPQRHFUmQmR
¿TXHQtWLGD
8VDURVERW}HVŸźPXGDSDUDRPRGRGHUHGXomRGHUXtGR
$/72Ù0e',2Ù%$,;2
‡(VWDIXQomRVyIXQFLRQDSDUDXPVLQDOGHHQWUDGD9,'(2RX
69,'(2HSDUDXPVLQDOLLRXLLQDHQWUDGD
&20321(179,'(2
‡4XDQGRHVWDIXQo}IRUH[FHVVLYDSRGHFDXVDUXPDFHUWD
GHJUDGDomRGDLPDJHP
8VDURVERW}HVŻŹWURFDGHPRGRSDUDHVSDoRGHFRU
$872Ù5*%Ù6037(Ù5(&Ù5(&
‡(VWHLWHPSRGHVHUVRPHQWHVHOHFFLRQDGRSDUDXPVLQDOGHFRPSXWDGRU
RXVLQDOGHYtGHRFRPSRQHQWHH[FHSWRVLQDO6&$575*%
‡2PRGR$872VHOHFFLRQDDXWRPDWLFDPHQWHRPRGRLGHDO
‡$RSHUDomR$872WDOYH]QmRIXQFLRQHEHPHPDOJXQVVLQDLV(PWDO
FDVRSRGHVHULGHDOVHOHFFLRQDUXPPRGRDGHTXDGRH[FHSWR$872
8VDURVERW}HVŸźWURFDDIXQomRGDSRUWD&20321(17
<&B3B&R3R
&20321(17Ù6&$575*%
4XDQGR6&$575*%pVHOHFFLRQDGRHSRUWDV&20321(17
<&B3B&R3RH9,'(2IXQFLRQDUiFRPRXPDSRUWD6&$57
5*%8PFDER$6&$57pQHFHVViULRSDUDXPDHQWUDGD6&$57
5*%QRSURMHWRU3DUDVXDUHIHUrQFLDFRQVXOWHDSDUWH7e&1,&$
FRQWLQXDQDSiJLQDVHJXLQWH
33
Menu ENTRD
Menu ENTRD (continuação)
'HVFULomR
Item
2IRUPDWRGHYtGHRSDUDSRUWD69,'(2HSRUWD9,'(2SRGHVHUGH¿QLGR
8VHRVERW}HVŻŹSDUDVHOHFFLRQDUDSRUWDGHHQWUDGD
8VDURVERW}HVŸźWURFDGHPRGRSDUDR
IRUPDWRGHYtGHR
$872Ù176&Ù3$/Ù6(&$0
13$/Ù03$/Ù176&
)250$729,'(2
‡(VWHLWHPIRLH[HFXWDGRVRPHQWHSDUDXP
VLQDOGHYtGHRGDSRUWD9,'(2RX69,'(2
‡2PRGR$872VHOHFFLRQDDXWRPDWLFDPHQWHRPRGRLGHDO
‡$RSHUDomR$872WDOYH]QmRIXQFLRQHEHPSDUDDOJXQVVLQDLV
6HDLPDJHP¿FDULQVWiYHOH[XPDLPDJHPLUUHJXODUIDOWDGHFRU
VHOHFFLRQHRPRGRGHDFRUGRFRPRVLQDOGHHQWUDGD
%/24(67
'H¿QDDIXQomRGHEORTXHLROLJDGRGHVOLJDGRSDUDFDGDSRUWD
8VHRVERW}HVŸźSDUDVHOHFFLRQDU
DVSRUWDVVHJXLQWHV
&20387(5,1Ù&20387(5,1
8VDURVERW}HVŻŹSDUDOLJDUGHVOLJDU
DIXQomRGHEORTXHLRGRTXDGUR
/,*$5Ù'(6/,*$5
‡(VWHLWHPSRGHPVHUVRPHQWHH[HFXWDGRQXPVLQDOFRPD
IUHTXrQFLDYHUWLFDOGHD+]
‡4XDQGRVHOHFFLRQDU/,*$5XP¿OPHHPPRYLPHQWRpH[LELGR
VXDYHPHQWH
‡(VWDIXQomRSRGHFDXVDUXPDFHUWDGHJUDGDomRGDLPDJHP(P
WDOFDVRVHOHFFLRQH'(6/,*$5
(175$'$
&20387(5
2WLSRGHVLQDOGHHQWUDGDGRFRPSXWDGRUSDUDSRUWDV&20387(5
,1H,1SRGHVHUGH¿QLGR
8VHRVERW}HVŻŹSDUVHOHFFLRQDUD
SRUWDGHHQWUDGDSDUDVHUGH¿QLGD
&20387(5,1Ù&20387(5,1
8VHRVERW}HVŸźSDUDVHOHFFLRQDU
RWLSRGHVLQDOGHFRPSXWDGRU
6<1&21*/,*$5Ù6,1&21*'(6/,*$5
6HOHFFLRQDU6<1&21*/,*$5SHUPLWHDUHFHSomRGHVLQFQR
VLQDO*
‡4XDQGRVHOHFFLRQDU6<1&21*/,*$5DLPDJHPSRGH¿FDU
GLVWRUFLGDFRPFHUWRVVLQDLVGHHQWUDGD(PWDOFDVRUHPRYHR
FRQHFWRUGHVLQDOSULPHLURHVHOHFFLRQD6,1&21*'(6/,*$5QR
PHQXHGHSRLVUHFRQHFWDRVLQDO
FRQWLQXDQDSiJLQDVHJXLQWH
34
Menu ENTRD
Menu ENTRD (continuação)
Item
'HVFULomR
$UHVROXomRSDUDRVVLQDLVGHHQWUDGD&20387(5,1H,1
SRGHPVHUGH¿QLGRVQHVWHSURMHWRU
1RPHQX(175'VHOHFFLRQHD5(62/8d­2FRPRVERW}HV
ŸźHSULPDRERWmRŹ
2PHQX5(62/8d­2VHUiH[LELGR
1RPHQX5(62/8d­2VHOHFFLRQH
DUHVROXomRTXHSUHWHQGHH[LELUFRP
RVERW}HVŸź
6HOHFFLRQDU$872GH¿QLUiDUHVROXomR
DSURSULDGDSDUDRVLQDOGHHQWUDGD
1250$/
3UHVVLRQDURERWmRŹRX(17(5DR
VHOHFFLRQDUXPDUHVROXomR1250$/
DMXVWDDXWRPDWLFDPHQWHDVSRVLo}HV
KRUL]RQWDOHYHUWLFDOIDVHGHUHOyJLR
HWDPDQKRKRUL]RQWDOHVHOHFFLRQD
DXWRPDWLFDPHQWHXPDUHODomRGHDOWXUD
FRPSULPHQWR
5(62/8d­2
1250$/
Ļ
3(5621
3(5621
3DUDGH¿QLUXPDUHVROXomR
Ļ
SDGUmRXVHRVERW}HVŸźSDUD
VHOHFFLRQDUDFDL[D3(5621H
5(62/8d­23(5621$/,=$'$
DSDUHFHUi'H¿QDDVUHVROXo}HV
KRUL]RQWDO+25,=217$/HYHUWLFDO
9(57,&$/FRPRVERW}HVŸź
ŻŹ1mRpJDUDQWLGRWUDEDOKDU
FRPHVWDIXQomRFRUUHFWDPHQWHHP
TXDOTXHUUHVROXomR
3DUDJXDUGDUDFRQ¿JXUDomR
FRORTXHRFXUVRUQRGtJLWRjGLUHLWDH
SULPDRERWmRŹ
$VSRVLo}HVKRUL]RQWDOHYHUWLFDOIDVH
GHUHOyJLRHWDPDQKRKRUL]RQWDOVHUmR
DXWRPDWLFDPHQWHDMXVWDGDV
3DUDUHYHUWHUSDUDDUHVROXomR
DQWHULRVHPJXDUGDUDVDOWHUDo}HV
FRORTXHRFXUVRUQRGLJLWRj
HVTXHUGDHSULPDRERWmRŻ
2HFUmUHWRUQDUiHQWmRSDUDR
PHQX5(62/8d­2H[LELQGRD
UHVROXomRDQWHULRU
‡SDUDYHUDOJXPDVLPDJHQVHVWDIXQomRWDOYH]QmRIXQFLRQHEHP
35
Menu AJUSTE
0HQX$-867(
'RPHQX$-867(RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸźHSULPD
ŹRXRERWmR(17(5SDUDH[HFXWDURLWHP'HSRLV
H[HFXWHRGHDFRUGRFRPDWDEHODVHJXLQWH
'HVFULomR
Item
D-ZOOM
8WLOL]DQGRRVERW}HVŸźDMXVWDR]RRP
*UDQGHÙ3HTXHQR
'(6/2&$5'9
8WLOL]DQGRRVERW}HVŸźDMXVWDDSRVLomRYHUWLFDOGDLPDJHP
&LPDÙ%DL[R
‡(VWDIXQomRQmRVHHQFRQWUDGLVSRQtYHOVH'=220IRUDMXVWDGR
SDUDWHODLQWHLUDQDVXDFDL[DGHGLiORJR
'(6/2&$5'+
8WLOL]DQGRRVERW}HVŸźDMXVWDDSRVLomRKRUL]RQWDOGDLPDJHP
'LUHLWDÙ(VTXHUGD
‡(VWDIXQomRQmRVHHQFRQWUDGLVSRQtYHOVH'=220IRUDMXVWDGR
SDUDWHODLQWHLUDQDVXDFDL[DGHGLiORJR
.(<6721(
8VDURVERW}HVŸźFRUULJHDGLVWRUomRYHUWLFDO
'LPLQXHRWRSRGDLPDJHPÙ'LPLQXLRIXQGRGDLPDJHP
‡$IDL[DDMXVWiYHOGHVWDIXQomRYDULDUiFRPRWLSRGHVLQDOGH
HQWUDGD3DUDDOJXPDHQWUDGDHVWDIXQomRWDOYH]QmRIXQFLRQHEHP
‡(VWDIXQomR¿FDUiLQGLVSRQtYHOTXDQGR'HWHFomRRGHWUDQVLomR
¿FDUOLJDGR51
6,/(1&,$0(
8VDURVERW}HVŸźOLJDGHVOLJDRPRGRVLOHQFLDPH
&/$52Ù1250$/
‡4XDQGRVHOHFFLRQDU1250$/RUXtGRDF~VWLFRHEULOKRGRHFUm
VmRUHGX]LGRV
8VDURVERW}HVŸźWURFDGHPRGRSDUDHVWDGRHVSHOKR
,0$*(63(/+
92/80(
1250$/Ù+,19(56$2Ù9,19(56$2Ù+9,19(56$2
6H'HWHFWRUGHWUDQVLomRIRU/,*$5HRDOWHUDURHVWDGR,0$*
(63(/+$ODUPHGHGHWHFWRUGHWUDQVLomR51VHUiH[LELGR
TXDQGRUHLQLFLDURSURMHWRUGHSRLVTXHGHVOLJDURLQWHUUXSWRU
8VDURVERW}HVŸźDMXVWDRYROXPH
$OWRÙ%DL[R
FRQWLQXDQDSiJLQDVHJXLQWH
36
Menu AJUSTE
Menu AJUSTE (continuação)
Item
'HVFULomR
$/72)$/$17(
8VDURVERW}HVŸźOLJDGHVOLJDRPLFURIRQHLQFRUSRUDGR
/,*$5Ù'(6/,*$5
4XDQGRVHOHFFLRQDU'(6/,*$5PLFURIRQHLQFRUSRUDGRQmRIXQFLRQD
$8',2
$ORFDDVSRUWDVGHiXGLR
6HOHFFLRQHXPDSRUWDGHHQWUDGDGH
LPDJHPXVDQGRRVERW}HVŸź
6$,5Ù&20387(5,1Ù&20387(5,1
9,'(2Ù69,'(2Ù&20321(17
6HOHFFLRQHDSRUWDGHiXGLRSDUDVHU
LQWHUEORTXHDGDFRPDSRUWDGHHQWUDGD
FRPRVERW}HVŻŹ
ÙÙÙ
‡$RVHOHFFLRQDU DUDXPDHQWUDGDRiXGLRQmRVHUiRUHVXOWDGR
VHDHQWUDGDIRUHVFROKLGDFRPRDIRQWHGHH[LELomR
‡4XDQGR IRUVHOHFFLRQDGRSDUDDSRUWD9,'(269,'(2
RX&20321(17D&&&ORVHG&DSWLRQpDFWLYDGD
DXWRPDWLFDPHQWHFDVRD&&HVWHMDUHJXODGDSDUD$872HP
(;,%,5GRPHQX&&HRVLQDOGHHQWUDGDGDVSRUWDVVXSRUWDUD
IXQomR&&60
37
Menu TELA
0HQX7(/$
'RPHQX7(/$RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸźHSULPD
ŹRXRERWmR(17(5SDUDH[HFXWDURLWHP'HSRLV
H[HFXWHRGHDFRUGRFRPDWDEHODVHJXLQWH
'HVFULomR
Item
8VHRVERW}HVŸźSDUDDOWHUQDURLGLRPDGR26'GLVSOD\QDWHOD
IDIOMA
0(18326
뼑鞵㐕储Ё᭛ㅔԧЁ᭛ᣣᧄ⺆
8VDURVERW}HVŸźŻŹDMXVWDDSRVLomRGHPHQX
3DUDVDLUGDRSHUDomRSULPDRERWmR0(18QRFRQWUROHUHPRWRRX
PDQWHQKDDRSHUDomRSRUDSUR[LPDGDPHQWHVHJXQGRV
8VDURVERW}HVŸźWURFDRPRGRSDUDRHFUm6835(66,0$
2HFUm6835(66,0$pXPHFUmSDUDDIXQomRHPEUDQFR
WHPSRUDULDPHQWH23eH[LELGRDRSUHPLURERWmR%/$1.
0LQKD7HODÙ25,*,1$/Ù$=8/Ù%5$1&2Ù35(72
6835(66,0$
0LQKD7HOD
25,*,1$/
$=8/%5$1&2
35(72
)XQomR
2HFUmSRGHVHUUHJLVWDGRSHORLWHP0LQKD7HOD
40
(FUmSUpDMXVWDRHFUmSDGUmR
(FUmVLPSOHVHPFDGDFRU
‡3DUDHYLWDUPDQWHUXPDLPDJHPSRVWHULRU0LQKD7HODRXHFUm
25,*,1$/WURFDUiSDUDRHFUmSUHWRVLPSOHVGHSRLVGHYiULRV
PLQXWRV
FRQWLQXDQDSiJLQDVHJXLQWH
38
Menu TELA
Menu TELA (continuação)
'HVFULomR
Item
8VDURVERW}HVŸźWURFDRPRGRSDUDRHFUmLQLFLDO
2HFUmLQLFLDOpH[LELGRTXDQGRQHQKXPVLQDORXVLQDOLQFRUUHFWRIRU
GHWHFWDGR
0LQKD7HODÙ25,*,1$/Ù'(6/,*$5
0LQKD7HOD
,1,&,$5
25,*,1$/
'(6/,*$5
)XQomR
2HFUmSRGHVHUUHJLVWDGRSHORLWHPLQKD7HOD
40
(FUmSUpDMXVWDRHFUmSDGUmR
(FUmSUHWRVLPSOHV
‡3DUDHYLWDUPDQWHUXPDLPDJHPSRVWHULRU0LQKD7HODRXHFUm
25,*,1$/WURFDUiSDUDRHFUm6835(66,0$38GHSRLV
GHYiULRVPLQXWRV6HRHFUm6835(66,0$IRU0LQKD7HODRX
25,*,1$/RHFUmSUHWRHPEUDQFRpXVDGRHQWmR
‡$RVHOHFFLRQDU/,*$5SDUD3DO&KDYHGD0LQKD7HODGRLWHP
6(*85$1d$QRPHQX23&$248,1,&,$5p¿[DGRHP0LQKD
7HOD
FRQWLQXDQDSiJLQDVHJXLQWH
39
Menu TELA
Menu TELA (continuação)
Item
'HVFULomR
Minha Tela
(VWHLWHPSHUPLWHFDSWXUDUXPDLPDJHPSDUDXVRFRPRLPDJHP
0LQKD7HODTXHSRGHVHUXVDGRFRPRHFUmV6835(66,0$H
,1,&,$5([LEHDLPDJHPTXHSUHWHQGHFDSWXUDUDQWHVGHH[HFXWDU
RSURFHGLPHQWRVHJXLQWH
6HOHFFLRQDUHVWHLWHPH[LEHXPD
FDL[DGHGLiORJRFKDPDGD³0LQKD
7HOD´6ROLFLWDUiTXHLQLFLHDFDSWXUD
GHXPDLPDJHPGRHFUmDFWXDO
$JXDUGHSDUDTXHDLPDJHPDOYRVHMDH[LELGDHSULPDRERWmR
(17(5DRH[LELUDLPDJHP$LPDJHPVHUiFRQJHODGDHR
TXDGURGHFDSWXUDDSDUHFHUi
3DUDLQWHUURPSHURGHVHPSHQKRSULPD5(6(7RX(6&
8VDURVERW}HVŸźŻŹDMXVWDD
SRVLomRGRTXDGUR
0RYDRTXDGURSDUDDSRVLomRGD
LPDJHPTXHSUHWHQGHXVDU
2TXDGURWDOYH]QmRSRVVDVHUPRYLGR
SDUDDOJXQVVLQDLVGHHQWUDGD
3DUDLQLFLDURUHJLVWRSULPDRERWmR
(17(5
3DUDUHVWDXUDURHFUmHUHWRUQDUSDUD
DFDL[DGHGLiORJRDQWHULRUSULPDR
ERWmR5(6(7RX(6&
2UHJLVWROHYDDOJXQVPLQXWRV
$RFRQFOXLURUHJLVWRRHFUmGHUHJLVWRHDPHQVDJHPVHJXLQWH
VmRH[LELGDVSRUDOJXQVVHJXQGRV
“O registro de Minha Tela terminou.”
6HIDOKDURUHJLVWRDPHQVDJHPVHJXLQWHpH[LELGD
³2FRUUHXXPHUURGHFDSWXUD7HQWHGHQRYR
‡(VWDIXQomRQmRSRGHVHUVHOHFFLRQDGDDRVHOHFFLRQDU/,*$5
SDUDRLWHP%O0LQKD7HODabaixo
‡(VWDIXQomRQmRSRGHVHUVHOHFFLRQDGDTXDQGRVHOHFFLRQDU
/,*$5SDUDRLWHP3DO&KDYHGD0LQKD7HODGRLWHP6(*85$1d$
QRPHQX23&$248
%O0LQKD7HOD
8VDURVERW}HVŸźOLJDGHVOLJDDIXQomRGH%O0LQKD7HOD
/,*$5Ù '(6/,*$5
$RVHOHFFLRQDU/,*$5RLWHP0LQKD7HODpEORTXHDGR8VHHVWD
IXQomRSDUDSURWHJHU0LQKD7HODDFWXDO
‡(VWDIXQomRQmRSRGHVHUVHOHFFLRQDGDTXDQGRVHOHFFLRQDU
/,*$5SDUDRLWHP3DO&KDYHGD0LQKD7HODGRLWHP6(*85$1d$
QRPHQX23&$248
FRQWLQXDQDSiJLQDVHJXLQWH
40
Menu TELA
Menu TELA (continuação)
Item
'HVFULomR
0(16$*
8VDURVERW}HVŸźOLJDGHVOLJDDIXQomRGHPHQVDJHP
/,*$5Ù'(6/,*$5
$RVHOHFFLRQDU/,*$5DIXQomRGHPHQVDJHPVHJXLQWHSDVVDDIXQFLRQDU
³352*5(662$872´DRDMXVWDUDXWRPDWLFDPHQWH
³1­2)2,'(7(&7$'$(175$'$´
³6,1&521,=$d­2)25$'($/&$1&(´
³$SURFXUDU´DREXVFDUDHQWUDGD
³$GHWHFWDU«´TXDQGRRVLQDOGHHQWUDGDpGHWHFWDGR
$LQGLFDomRGHVLQDOGHHQWUDGDpH[LELGDDRDOWHUDU
$UHODomRHQWUHDOWXUDFRPSULPHQWRH[LELGDDRDOWHUDU
$LQGLFDomRGH02'2)272pH[LELGDDRDOWHUDU
$LQGLFDomRGH0,1+$0(0pH[LELGDDRDOWHUDU
$LQGLFDomRGH³3$5$'$´H³,,´HQTXDQWRRSURMHWRUHVWLYHUQRPRGR3$5$'$
‡6HRSURMHWRUHQWUDUQRPRGR3$5$'$DRVHOHFFLRQDU'(6/,*$5
DLPDJHPQRHFUmpFRQJHODGDVHPTXDOTXHUPHQVDJHPHLVWRQmR
pFRQVLGHUDGRIDOKDGHIXQFLRQDPHQWR23
&DGDSRUWDGHHQWUDGDSDUDHVWHSURMHWRUUHFHEHXPQRPH
8VHRVERW}HVŸźQRPHQX7(/$SDUD
VHOHFFLRQDU120('$)217(HSULPDRERWmR
Ź2PHQX120('$)217(VHUiH[LELGR
8VHRVERW}HVŸźQRPHQX120('$
)217(SDUDVHOHFFLRQDUDSRUWDDVHUQRPHDGD
HSULPDRERWmRŹ1RODGRGLUHLWRGRPHQX¿FD
HPEUDQFRDWpTXHHVSHFL¿TXHXPQRPH
$FDL[DGHGLiORJR120('$)217(VHUi
H[LELGD
2QRPHDFWXDOVHUiH[LELGRQDSULPHLUD
OLQKD8VHRVERW}HVŸźŻŹH(17(5
RX,1387SDUDVHOHFFLRQDUHLQWURGX]LURV
FDUDFWHUHV2ERWmR5(6(7SRGHVHUXVDGR
120('$)217( SDUDDSDJDURFDUDFWHUHGHFDGDYH]6H
PRYHURFXUVRUSDUD'(/(7$5RX/,03$5
78'2QRHFUmHSUHPLURERWmR(17(5RX
,1387
FDUDFWHUHRXWRGRVRVFDUDFWHUHVVHUmR
DSDJDGRV2QRPHSRGHWHUXPPi[LPRGH
FDUDFWHUHV
3DUDPXGDUXPFDUDFWHUMiLQWURGX]LGR
SULPDRERWmRŸSDUDPRYHURFXUVRUSDUDD
SULPHLUROLQKDHXVHRVERW}HVŻŹSDUDPRFHU
RFXUVRUQRFDUDFWHUHDVHUDOWHUDGR
'HSRLVGHSUHPLURERWmR(17(5RX,1387RFDUDFWHUpVHOHFFLRQDGR
(QWmRVHJXLURPHVPRSURFHGLPHQWRFRQIRUPHGHVFULWRQRLWHPDFLPD
3DUDWHUPLQDUGHLQWURGX]LURWH[WRPRYDRFXUVRUSDUD*8$5'$5
QRHFUmHSULPDRERWmR(17(5RX,13873DUDUHYHUWHUSDUDRQRPH
DQWHULRUVHPJXDUGDUDVDOWHUDo}HVPRYDRFXUVRUSDUD&$1&(/$5QR
HFUmHSULPDRERWmR(17(5RX,1387
41
Menu OPCAO
0HQX23&$2
'RPHQX23&$2RVLWHQVPRVWUDGRVQDWDEHODDEDL[R
SRGHPVHUH[HFXWDGRV
6HOHFFLRQHXPLWHPXVDQGRRVERW}HVFXUVRUŸźH
SULPDRERWmRFXUVRUŹRX(17(5SDUDH[HFXWDURLWHP
H[FHSWRSDUDRVLWHQV7(032/Æ03H7(032),/752
'HSRLVH[HFXWHRGHDFRUGRFRPDWDEHODVHJXLQWH
'HVFULomR
Item
%86&$$8720
8VDURVERW}HVŸźOLJDGHVOLJDDIXQomRGHEXVFDGHVLQDODXWRPiWLFD
/,*$5Ù'(6/,*$5
4XDQGR/,*$5IRUVHOHFFLRQDGRQmRGHWHFWDURFLFORV
DXWRPDWLFDPHQWHDWUDYpVGDVSRUWDVGHHQWUDGDQDRUGHPVHJXLQWH
$EXVFDpLQLFLDGDGDSRUWDDFWXDO'HSRLVDRHQFRQWUDUXPD
HQWUDGDRSURMHWRULQWHUURPSHUiDEXVFDHH[LEHDLPDJHP
&20387(5,1Ö&20387(5,1
9,'(2Õ69,'(2Õ&20321(17
/,*$5$8720
8VDURVERW}HVŸźOLJDGHVOLJDDIXQomR/,*$5$8720
/,*$5Ù'(6/,*$5
$RFRQILJXUDU/,*$5DOkPSDGDVHUiDXWRPDWLFDPHQWHOLJDGD
VHPRSURFHGLPHQWRQRUPDO16VRPHQWHTXDQGRRSURMHWRUp
IRUQHFLGRFRPDDOLPHQWDomRGHSRLVGHVHULQWHUURPSLGDHQTXDQWR
DOkPSDGDHVWLYHUOLJDGD
‡(VWDIXQomRQmRIXQFLRQDXPDYH]TXHDDOLPHQWDomRVHMD
IRUQHFLGDSDUDRSURMHWRUHQTXDQWRDOkPSDGDHVWiGHVOLJDGD
‡'HSRLVGHOLJDUDOkPSDGDFRPDIXQomR/,*$5$8720VH
QHQKXPDHQWUDGDRXRSHUDomRIRUGHWHFWDGDSRUDSUR[LPDGDPHQWH
PLQXWRVRSURMHWRUpGHVOLJDGRPHVPRTXHDIXQomR'(6/,*
$87243VHMDGHVDFWLYDGD
FRQWLQXDQDSiJLQDVHJXLQWH
42
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
8VDURVERW}HVŸźDMXVWDDKRUDSDUDDFRQWDJHPSDUDGHVOLJDU
DXWRPDWLFDPHQWHRWKHSURMHWRU
/RQJRPi[PLQXWRVÙ&XUWRPLQPLQXWR '(6/,*$5
'(6/,*$872
4XDQGRGH¿QLURWHPSRSDUDRSURMHWRUQmRIRLGHVOLJDGR
DXWRPDWLFDPHQWH
4XDQGRGH¿QLURWHPSRSDUDDHTXDQGRRWHPSRSDVVDU
VHPQHQKXPVLQDORXVLQDOLQFRUUHFWRDWLQJLXRWHPSRGH¿QLGRD
OkPSDGDGRSURMHWRUVHUiGHVOLJDGD
6HRVERW}HVGRSURMHWRURXGRFRQWUROHUHPRWRIRUSUHPLGRRXXP
GRVFRPDQGRVH[FHSWRREWHUFRPDQGRVpWUDQVPLWRSDUDDSRUWD
&21752/GXUQDWHRWHPSRFRUUHVSRQGHQWHRSURMHWRUQmRVHUi
GHVOLJDGR
&RQVXOWHDVHFomR³'HVOLJDUGDFRUUHQWH´17
TEMPO LÂMP.
2WHPSRGDOkPSDGDXVDRWHPSRFRQWDGRGHSRLVGHUHLQLFLDUSHOD
~OWLPDYH]pPRVWUDGDQRPHQX23&$2
3UHPLURERWmR5(6(7RXRERWmRŹH[LEHXPDFDL[DGHGLiORJR
3DUDUHDMXVWDURWHPSRGDOkPSDGDVHOHFFLRQH5($-867(FRPR
ERWmRŸ
5($-867(Õ&$1&(/$5
‡5HDMXVWHRWHPSRGDOkPSDGDVRPHQWHDRVXEVWLWXLUDOkPSDGD
SDUDXPDLQGLFDomRDGHTXDGDVREUHDOkPSDGD
‡3DUDDVXEVWLWXLomRGDOkPSDGDFRQVXOWHDVHFomR6XEVWLWXLomRGD
OkPSDGD61
7(032),/752
2WHPSRGR¿OWURpRWHPSRGHXVRGR¿OWURGHDUFRQWDGRGHSRLVGH
UHLQLFLDUSHOD~OWLPDYH]ePRVWUDGRQRPHQX23&$2
3UHPLURERWmR5(6(7RXRERWmRŹH[LEHDFDL[DGHGLiORJR
3DUDUHLQLFLDURWHPSRGR¿OWURVHOHFFLRQH5($-867(FRPRERWmRŸ
5($-867(Õ&$1&(/$5
‡5HDMXVWHRWHPSRGR¿OWURVRPHQWHDRVXEVWLWXLURXOLPSDUR¿OWUR
GHDUSDUDXPDLQGLFDomRDGHTXDGDVREUHR¿OWURGHDU
‡3DUDDOLPSH]DGR¿OWURGHDUFRQVXOWHDVHFomR0DQXWHQomRGR
¿OWURGHDU63
FRQWLQXDQDSiJLQDVHJXLQWH
43
Menu OPCAO
Menu OPCAO (continuação)
Item
'HVFULomR
0(8%27­2
(VWHLWHPDWULEXLXPDGDVVHJXLQWHIXQo}HVSDUD0<%87721HQR
FRQWUROHUHPRWR6
6HOHFFLRQHRXQRPHQX0(8%27­2FRPRERWmRŻŹSULPHLUR
8VHHQWmRRVERW}HVŸźGH¿QLGRVQDVIXQo}HVVHJXLQWHVSDUDRERWmR
VHOHFFLRQDGR
‡&20387(5'H¿QDDSRUWDSDUD&20387(5,1
‡&20387(5'H¿QDDSRUWDSDUD&20387(5,1
‡&20321(17'H¿QHDSRUWDSDUD&20321(17<&B3B&R3R
‡69,'(2'H¿QHDSRUWDSDUD69,'(2
‡9,'(2'H¿QHDSRUWDSDUD9,'(2
‡,1)2([LEH(175',1)246RX5('(,1)259RXQDGD
$FDL[DGHGLiORJRH[LELGDpWURFDGDFRQIRUPHDEDL[RFDGDYH]TXHSUHPLU
0<%87721
4XDQGRRVLQDOGHHQWUDGDIRUHQFRQWUDGR
(175',1)2Ö5('(,1)2Ö'(6/,*$5
4XDQGRXPVLQDOGHHQWUDGDQmRIRUHQFRQWUDGR
5('(,1)2Ù'(6/,*$5
‡0,1+$0(0&DUUHJDRVGDGRVGHDMXVWHDUPD]HQDGRV30
$RJXDUGDUXPRXPDLVGDGRVRDMXVWHPXGDDFDGDYH]TXHSUHPLU0<%87721
4XDQGRQmRJXDUGDUQHQKXPGDGRQD
PHPyULDDFDL[DGHGLiORJR6'DGRV
JXDUGDSDUHFH
4XDQGRQmRJXDUGDURDMXVWHDFWXDOQD
PHPyULDDFDL[DGHGLiORJRpPRVWUDGDj
GLUHLWD
6HSUHWHQGHUPDQWHURDMXVWHDFWXDOSULPDRERWmRŻSDUDVDLU&DVR
FRQWUiULRFDUUHJDUXPGDGRSHUGHUiDFRQGLomRGHDMXVWHDFWXDO
‡02'2)272$OWHUDR02'2)27226
‡5($-),/75([LEHDFDL[DGHGLiORJRGHFRQ¿UPDomRGHUHDMXVWHGH
WHPSRGH¿OWUR43
‡92/80('H¿QHRYROXPHDFLPD
‡92/80('H¿QHRYROXPHDEDL[R
‡$908'2/LJDHGHVOLJDDLPDJHPHRiXGLR
‡H6+27([LEHRPHQXH6+2758
6(59,d2
6HOHFFLRQDUHVWHLWHPH[LEHRPHQX6(59,d2
6HOHFFLRQHXPLWHPFRPRVERW}HVŸźHSULPDRERWmRŹRX(17(5
SDUDH[HFXWDURLWHP
9(/9(17Ù$-867($872Ù)$17$60$Ù0(16*),/752Ù%/247(&/$Ù%/24)2&2
$-867()$%5Ù,1)2Ù)5(45(0272Ù5(&(37255(0272
FRQWLQXDQDSiJLQDVHJXLQWH
44
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
9(/9(17
8VDURVERW}HVŸźSDUDDYHORFLGDGHGHURWDomRGRV
YHQWLODGRUHVGHUHVIULDPHQWR2$/7$pRPRGRSDUDXVDU
HPUHJLmRPRQWDQKRVDHWF2EVHUYHTXHRSURMHWRUHPLWH
PDLVUXtGRTXDQGR$/7$pVHOHFFLRQDGR
$/7$Ù1250$/
$-867($872
8VHRERW}HVŸźSDUDVHOHFFLRQDUXPGRVPRGRV
4XDQGR'(6/,*$5IRUVHOHFFLRQDGRD326,d­2+97$0$1+2
+H)$6(+VHUmRGH¿QLGDVSDUDRVVHXVYDORUHVSUHGH¿QLGRVVH
DIXQomRGHDMXVWDPHQWRDXWRPiWLFRIRUH[HFXWDGD
'(7$/+$'2Ù5È3,'2Ù'(6/,*$5
'(7$/+$'2$VLQWRQL]DomRPDLV¿QDLQFOXLQGRDMXVWHGH7$0$1+2+
5È3,'26LQWRQL]DomRPDLVUiSLGDGH¿QLU7$0$1+2+SDUDGDGRV
SUpDUUDQMDGRVSDUDRVLQDOGHHQWUDGD
‡'HSHQGHQGRGDVFRQGLo}HVWDLVFRPRLPDJHPGHHQWUDGDRFDERGH
VLQDOSDUDRSURMHWRUDPELHQWHDRUHGRUGRSURMHWRUHWFRDMXVWH
DXWRPiWLFRQmRSRGHIXQFLRQDUFRUUHFWDPHQWH(PWDOFDVRVHOHFFLRQH
'(6/,*$5SDUDGHVDFWLYDUDMXVWHDXWRPiWLFRHID]rORDXWRPDWLFDPHQWH
6(59,d2
FRQWLQXDomR
)$17$60$
6HOHFFLRQHXPHOHPHQWRGHIDQWDVPDFRPRV
ERW}HVŻŹ
$MXVWDURHOHPHQWRVHOHFFLRQDGRFRPRVERW}HV
ŸźSDUDGHVDSDUHFHURIDQWDVPD
0(16*),/752
8VHRERWmRŸźSDUDGH¿QLURWHPSRUL]DGRUSDUDR
LQWHUYDORSDUDPRVWUDUDPHQVDJHPSDUDOLPSDUR¿OWUR
KÙKÙKÙKÙKÙK
'(6/,*$5ÙKÙKÙK
'HSRLVGHVHOHFFLRDQUXPLWHPH[FHSWRU'(6/,*$5
DPHQVDJHP³$'9(57Ç1&,$+563$66$'$6
'(6'($8/7,0$9(5,),&$d­2'2),/752´
DSDUHFHUiGHSRLVTXHWHPSRUL]DGRUDWLQJHRLQWHUYDOR
GH¿QLGRSRUHVWDIXQomR68
$RVHOHFFLRQDU'(6/,*$5DPHQVDJHPQmRDSDUHFHUi8VHHVWD
IXQomRSDUDPDQWHUOLPSRR¿OWURGHDUGH¿QLQGRRWHPSRDGHTXDGR
GHDFRUGRFRPRDPELHQWHGHVWHSURMHWRU
‡9HUL¿TXHHOLPSHR¿OWURGHDUSHULRGLFDPHQWHPHVPRVHQmRH[LVWH
QHQKXPDPHQVDJHP6HR¿OWURGHDU¿FDUEORTXHDGRSRUSRHLUDRXWURV
HOHPHQWRVDWHPSHUDWXUDLQWHUQDDXPHQWDUiRTXHSRGHFDXVDUSUREOHPD
GHIXQFLRQDPHQWRRXUHGX]LURFLFORGHYLGDGRSURMHWRU
‡7HQKDFXLGDGRFRPRDPELHQWHGHRSHUDomRGRSURMHWRUHD
FRQGLomRGR¿OWURGHDU
FRQWLQXDQDSiJLQDVHJXLQWH
45
Menu OPCAO
Menu OPCAO (continuação)
Item
Description
%/247(&/$
8VDURVERW}HVŸźOLJDGHVOLJDDIXQomRGHEORTXHLRGHWHFOD$RVHOHFFLRQDU
/,*$5RVERW}HVSURMHWRUH[FHSWRRERWmR67$1'%<21VmREORTXHDGRV
/,*$5Ù'(6/,*$5
‡8VHSDUDHYLWDUXPHUURDRWRFDUDFLGHQWDOPHQWH(VWDIXQomRQmR
WHPTXDOTXHUHIHLWRQRFRQWUROHUHPRWR
%/24)2&2
8WLOL]HRVERW}HVŸźSDUDOLJDUGHVOLJDUDIXQomRGHEORTXHLRGDIRFDJHP
4XDQGR /,*$5 IRU VHOHFFLRQDGR RV ERW}HV )2&86 GR UHPRWR H
SURMHWRUVmRGHVDFWLYDGRV
/,*$5Ù'(6/,*$5
‡3RUIDYRUXWLOL]HDIXQomRSDUDHYLWDUXPHVWUDJRHWRFDUDFLGHQWDOPHQWH
RECEPTOR REMOTO
6HOHFFLRQHXPVHQVRUUHPRWRXWLOL]DQGRRVERW}HVŸź
)5(17(Ù$&,0$
/LJXHRXWLOL]DQGRRVERW}HV(17(5RX,1387
GHVOLJDUÙ OLJDU
‡8PVHQVRUQmRSRGHVHUGHVOLJDGRTXDQGRRRXWURVHQVRUHVWLYHU
GHVDFWLYDGR+DYHUiVHPSUHQRPtQLPRXPVHQVRUOLJDGR
6(59,d2
FRQWLQXDomR
)5(45(0272
8VHRERWmRŸźSDUDDOWHUDUDFRQ¿JXUDomRGHVHQVRUUHPRWRGRSURMHWRU
1250$/Ù$/72
2VLWHQVFRPXPDPDUFDGHYHUL¿FDomRHVWmRDFWLYDGRV
$FRQ¿JXUDomRSDGUmRGHIiEULFDpSDUDDPERV
1250$/H$/72HGHYHP¿FDUDFWLYDGRV6HRFRQWUROHUHPRWRQmR
IXQFLRQDUFRUUHFWDPHQWHGH¿QDLVWRSDUDRXVRPHQWH15
(QHPSRGHVHUGHVOLJDGRDRPHVPRWHPSR
,1)2
VHOHFFLRQDUHVWHLWHPH[LEHXPDFDL[DGHGLiORJRFKDPDGD³(175',1)2´
0RVWUDDLQIRUPDomRVREUHDHQWUDGDDFWXDO
‡$PHQVDJHP³%/24(67´QDFDL[DGHGLiORJRVLJQL¿FDDIXQomR
GHEORTXHLRGHTXDGURHVWiIXQFLRQDQGR34
‡(VWHLWHPQmRSRGHVHUVHOHFFLRQDGRSDUDVHPVLQDORXVLQFGHVDFWLYDGR
$-867()$%5
6HOHFFLRQDU5($-867$FRPRERWmRŸH[HFXWDHVWDIXQomR3RUHVWD
IXQomRWRGRVRVLWHQVHPWRGRVRVPHQXVUHWRUQDUmRFROHFWLYDPHQWHSDUDD
FRQ¿JXUDomRLQLFLDO2EVHUYHTXHDVFRQ¿JXUDo}HVGRVLWHQV7(032/Æ03
7(032),/752,',20$6(*85$1d$H5('(QmRVmRUHDMXVWDGDV
5($-867(Õ&$1&(/$5
46
FRQWLQXDQDSiJLQDVHJXLQWH
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
(VWHSURMHWRUHVWiHTXLSDGRFRPIXQo}HVGHVHJXUDQoD
2UHJLVWRGHXWLOL]DGRUpQHFHVViULRDQWHVGHXVDUDVIXQo}HVGHVHJXUDQoD
&RQWDFWHVHXIRUQHFHGRUORFDO
8VDUDVIXQo}HVGHVHJXUDQoD
,QWURGX]LUD3$/$95$3$66(
8VDURVERW}HVŸźQRPHQX23&$2
SDUDVHOHFFLRQDU6(*85$1d$HSULPD
RERWmRŹ$FDL[DGHGLiORJR,1752'
3$/$95$3$66(VHUiH[LELGD
$GH¿QLomRSDGUmR3$/$95$3$66(p4910.
(VWD3$/$95$&+$9(SRGHVHUDOWHUDGD$OWHUDUD3$/$95$
3$66(abaixo
‡5HFRPHQGDVHTXHD3$/$95$&+$9(SDGUmRGH¿QLGDSHODIiEULFD
VHMDDOWHUDGDORJRTXHIRUSRVVtYHO
6(*85$1d$
8VHRVERW}HVŸźŻŹSDUDLQWURGX]LUD
3$/$95$3$66(UHJLVWDGD0RYDRFXUVRU
jGLUHLWDGDFDL[DGHGLiORJR,1752'
3$/$95$3$66(HSULPDRERWmRŹSDUD
H[LELURPHQX6(*85$1d$
6HXPD3$/$95$3$66(LQFRUUHFWDIRULQWURGX]LGDDFDL[DGHGLiOJR,1752'
3$/$95$3$66(pH[LELGDQRYDPHQWH6H3$/$95$3$66(LQFRUUHFWDIRU
LQWURGX]LGDYH]HVRSURMHWRUVHUiGHVOLJDGR'HSRLVRSURMHWRUVHUi
GHVOLJDGRFDGDYH]TXHLQWURGX]LUD3$/$95$3$66(LQFRUUHFWD
1.2 Introduzir a PALAVRA-CHAVE
8VHRVERW}HVŸźQRPHQX
6(*85$1d$SDUDVHOHFFLRQDU08'$1d$
'$3$/$95$&+$9(HSULPDRERWmRŹ
SDUDH[LELUDFDL[DGHGLiORJR,175129$
3$/$95$3$66(
8VHRVERW}HVźŻŹSDUDLQWURGX]LUDQRYD3$/$95$3$66(
0RYDRFXUVRUjGLUHLWDGDFDL[DGHGLiORJR
5(3(7,53$/$95$'(3$66(HSULPD
RERWmRŹSDUDH[LELUDFDL[DQRYDPHQWH
,QWURGX]DDPHVPDSDODYUDFKDYHGHQRYR
0RYDRFXUVRUjGLUHLWDGDFDL[DGHGLiORJR
5(3(7,53$/$95$'(3$66(HSULPD
RERWmRŹHDFLD[DGHGLiORJR$127(
3$/$95$'(3$66(VHUiH[LELGDSRU
DSUR[LPDGDPHQWHVHJXQGRV$QRWHD
SDODYUDFKDYHGXUDQWHHVWHSHUtRGR
3UHPLURERWmR(17(5IHFKDUiDFDL[DGHGLiORJR$127(3$/$95$
'(3$66(
‡1mRHVTXHoDVXD3$/$95$'(3$66(
FRQWLQXDQDSiJLQDVHJXLQWH
47
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
6HHVTXHFHXVXD3$/$95$3$66(
VLJDRSURFHGLPHQWRHPSDUDH[LELUDFDL[DGHGLiORJR,1752'
3$/$95$3$66(
$RH[LELUDFDL[DGHGLiORJR,1752'
3$/$95$3$66(SULPDRERWmR
5(6(7SRUDSUR[LPDGDPHQWH
VHJXQGRVRXSULPDSRUDOJXQVVHJXQGRV
,1387HRVERW}HVŹQRSURMHWRUSRU
DSUR[LPDGDPHQWHVHJXQGRV
3FyGLJRGHSHVTXLVDGHGtJLWRVVHUiH[LELGR
‡6HQmR¿]HULQWURGX]LUDFKDYHSRUDSUR[LPDGDPHQWHVHJXQGRVDRH[LELUR
FyGLJRGHSHVTXLVDRPHQXVHUiIHFKDGR6HQHFHVViULRUHSLWDRSURFHVVRGH
&RQWDFWHVHXIRUQHFHGRUFRPRFyGLJRGHSHVTXLVDGHGtJLWRV6XDSDODYUD
FKDYHVHUiHQYLDGDGHSRLVTXHFRQ¿UPDUDVLQIRUPDo}HVGHUHJLVWRGRXWLOL]DGRU
8VDUDIXQomR3DO&KDYHGD0LQKD7HOD
6(&85$1d$
FRQWLQXDomR
$IXQomR3DO&KDYHGD0LQKD7HODSRGHVHUXVDGDSDUDSURLELURDFHVVRD
IXQomR0HX7HODHHYLWDUTXHDLPDJHPGH7HODUHJLVWDGDDFWXDOPHQWHVHMD
VREUHSRVWD
$FWLYDUDIXQomR3DO&KDYHGD0LQKD7HOD
8VHRVERW}HVŸźQRPHQX
6(*85$1d$SDUDVHOHFFLRQDU3DO
&KDYHGD0LQKD7HODHSUHPLURERWmRŹ
SDUDH[LELURPHQX3DO&KDYHGD0LQKD
7HODOLJDUGHVOLJDU
'H¿QLUD3$/$95$3$66(
([LEHRPHQX3DO&KDYHGD0LQKD7HODOLJDGRGHVOLJDGRFRPR
SURFHGLPHQWR
8VHRVER}HVŸźQRPHQX3DO&KDYHGD
0LQKD7HODOLJDUGHVOLJDUSDUDVHOHFFLRQDU
/,*$5$FDL[DGHGLiORJR3$/$95$3$66(
SHTXHQRVHUiH[LELGD
8VHRVERW}HVŸźŻŹSDUDLQWURGX]tOD
0RYDRFXUVRUjGLUHLWDGDFDL[DGHGLiORJR
,1752'3$/$95$3$66(SHTXHQRHSULPD
RERWmRŹSDUDH[LELUDFDL[DGHGLiORJR
5(3(7,5$3$/$95$'(3$66(HLQWURGX]DD
PHVPD3$/$95$'(3$66(QRYDPHQWH
FRQWLQXDQDSiJLQDVHJXLQWH
48
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
0RYDRFXUVRUjGLUHLWDGDFDL[DGHGLiORJR
5(3(7,5$3$/$95$'(3$66(H
SULPDRERWmRŹSDUDH[LELUD3$/$95$
'(3$66(SRUDSUR[LPDGDPHQWH
VHJXQGRV)DoDDQRWDo}HVGDSDODYUD
FKDYHGXUDQWHHVWHSHUtRGR
3UHPLURERWmR(17(5UHWRUQDUiSDUDRPHQXOLJDUGHVOLJDU3DO&KDYH
GD0LQKD7HOD
4XDQGR3$/$95$'(3$66(IRUGH¿QLGDSDUD0HX7HOD
‡$IXQomRGHUHJLVWR0HX7HODHPHQX¿FDUmRLQGLVSRQtYHO
‡2PHQX%ORTXHLRGHPHXHFUm¿FDUiLQGLVSRQtYHO
‡$FRQ¿JXUDomR,1,&,$5VHUiEORTXHDGDHP0HX7HODHRPHQX¿FDUi
LQGLVSRQtYHO
'HVOLJDU3DO&KDYHGD0LQKD7HODSHUPLWLUiDRSHUDomRQRUDPOGHVWDV
IXQo}HV
‡1mRHVTXHoDGHVXD3DO&KDYHGD0LQKD7HOD
2.3 Desligue a PALAVRA-CHAVE
6LJDRVSURFHGLPHQWRVQRSDUDH[LELURPHQX3DO&KDYHGD
0LQKD7HODOLJDUGHVOLJDU
6(&85$1d$
FRQWLQXDomR
6HOHFFLRQH'(6/,*$5SDUDH[LELUDFDL[DGHGLiORJR,1752'
3$/$95$3$66(JUDQGH,QWURGX]DDSDODYUDFKDYHUHJLVWDGDHR
HFUmUHWRUQDUiUSDUDRPHQX0HX7HODOLJDUGHVOLJDU
6HLQWURGX]LUDSDODYUDFKDYHLQFRUUHFWDRPHQXVHUiIHFKDGR6HIRU
QHFHVViULRUHSLWDRSURFHVVRGH
6HHVTXHFHXVXDSDODYUDFKDYH
6LJDRVSURFHGLPHQWRVQRSDUDH[LELURPHQX3DO&KDYHGD
0LQKD7HODOLJDUGHVOLJDU
6HOHFFLRQH'(6/,*$5SDUDH[LELUDFDL[D
GHGLiORJR,1752'3$/$95$3$66(
JUDQGH2FyGLJRGHSHVTXLVDGH
GtJLWRVVHUiH[LELGRGHQWURGDFDL[D
&RQWDFWHVHXIRUQHFHGRUFRPRFyGLJRGHSHVTXLVDGHGtJLWRV6XD
SDODYUDFKDYHVHUiHQYLDGDGHSRLVTXHFRQ¿UPDUDVLQIRUPDo}HVGH
UHJLVWRGRXWLOL]DGRU
8VDDIXQomR%/248(,23,1
%/248(,23,1pXPDIXQomRTXHHYLWDTXHRSURMHWRUVHMDXVDGRDPHQRV
TXHLQWURGX]DRFyGLJRUHJLVWDGR
5HJLVWHRFyGLJR3,1
8VHRVERW}HVŸźQRPHQX6(*85$1d$SDUD
VHOHFFLRQDU%/248(,23,1HSULPDRERWmRŹ
RX(17(5SDUDH[LELURPHQX%/248(,23,1
OLJDUGHVOLJDU
FRQWLQXDQDSiJLQDVHJXLQWH
49
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
8VHRVERW}HVŸźQRPHQX%/248(,2
3,1OLJDUGHVOLJDUSDUDVHOHFFLRQDU/,*$5
HD-$1(/$'(3,1VHUiH[LELGD
6(*85$1d$
FRQWLQXDomR
,QWURGX]DXPFyGLJR3,1FRPSDUWHV
XVDQGRRVERW}HVŸźŻŹ
&20387(5H,1387
$SDUHFHUiXPDFDL[DGH5HSHWLU&yGLJR
3,15HLQWURGX]DRPHVPRFyGLJR3,1,VWR
FRQFOXLUiRUHJLVWRGRFyGLJR3,1
‡6HQmRLQWURGX]LXQHQKXPDFKDYHSRUDSUR[LPDGDPHQWHVHJXQGRV
DRH[LELUR5HSHWLU&yGLJR3,1RX-$1(/$'(3,1RPHQXVHUiIHFKDGR
6HQHFHVViULRUHSLWDRSURFHVVRGH
(PVHJXLGDDTXDOTXHUPRPHQWRRSURMHWRUpUHLQLFLDGRGHSRLVTXHD
DOLPHQWDoD}&$IRUGHVOLJDGD$-$1(/$'(3,1VHUiH[LELGD,QWURGX]D
RFyGLJR3,1UHJLVWDGR
2SURMHWRUSRGHVHUXVDGRGHSRLVGHLQWURGX]LURFyGLJR3,1UHJLVWDGR
6HLQWURGX]LURFyGLJR3,1D-$1(/$'(3,1VHUiH[LELGDQRYDPHQWH
6HLQWURGX]LUXPFyGLJR3,1YH]HVRSURMHWRUVHUiGHVOLJDGR
'HSRLVRSURMHWRUVHUiGHVOLJDGRFDGDYH]TXHLQWURGX]LUD&yGLJR3,1
LQFRUUHFWD2SURMHWRUVHUiWDPEpPGHVOLJDGRVHQmRLQWURGX]LUQHQKXPD
FKDYHSRUDSUR[LPDGDPHQWHPLQXWRVDRH[LELUD-$1(/$'(3,1
(VWDIXQomRVHUiVRPHQWHDFWLYDGDDRLQLFLDURSURMHWRUGHSRLVTXHD
DOLPHQWDomR&$IRUGHVOLJDGD
‡1mRHVTXHoDVHXFyGLJR3,1
'HVOLJDUDIXQomR%/248(,2'23,1
6LJDRSURFHGLPHQWRHPSDUDH[LELURPHQX%/248(,2'(3,1
OLJDUGHVOLJDU8VHRVERW}HVŸźSDUDVHOHFFLRQDU'(6/,*$5HD
&$,;$'(3,1VHUiH[LELGD
,QWURGX]DRFyGLJR3,1UHJLVWDGRSDUDGHVOLJDUDIXQomR%/248(,2'(3,1
6HD3$/$95$3$66(IRULQWURGX]LGDLQFRUUHFWDPHQWHYH]HVR
SURMHWRUGHVOLJDUVHi
6HHVTXHFHXVXDSDODYUDFKDYH
$RH[LELUD-$1(/$'(3,1SULPDSRU
DOJXQVVHJXQGRVRERWmR5(6(7RX
,1387HŹ2FRQ¿UPDUFyGLJRGH
GtJLWRVVHUiH[LELGR
‡VDHSDVVDUDSUR[LPDGDPHQWHPLQXWRVGHSRLVTXHD-$1(/$'(3,1
IRUH[LELGDRSURMHWRUVHUiGHVOLJDGR
&RQWDFWHVHXIRUQHFHGRUFRPFRQ¿UPDURFyGLJRGHGtJLWRV6XD
SDODYUDFKDYHVHUiHQYLDGDGHSRLVTXHFRQ¿UPDUDVLQIRUPDo}HVGH
UHJLVWRGRXWLOL]DGRU
FRQWLQXDQDSiJLQDVHJXLQWH
50
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
8VDUDIXQomRGHGHWHFWRUGHWUDQVLomR
(QTXDQWRDIXQomR'HWHFWRUGHWUDQVLomRHVWLYHU/,*$5TXDQGRRLQWHUUXSWRU
GHDOLPHQWDomRFRPHoDUDIRUQHFHUHQHUJLDSDUDRSURMHFWRUSRGHUHDJLU
FRQIRUPHDEDL[R
‡2DODUPHGHGHWHFomRGHWUDQVLomRPRVWUDGRDEDL[RSRGHDSDUHFHUQR
HFUmVHRSURMHWRUIRLUHPRYLGRRXUHLQVWDODGR
‡2DODUPHGRGHWHFWRUGHWUDQVLomRPRVWUDGRDEDL[RSRGHDSDUHFHUQRHFUm
VHDFRQ¿JXUDomR,1*(63(/+IRLDOWHUDGD
‡$IXQomRGHDMXVWHGHNH\VWRQHIRLSURLELGDGDGRTXHDIXQomRGHGHWHFWRU
GHWUDQVLomRHVWHMD/,*$5
/LJDUDIXQomRGHGHWHFWRUGHWUDQVLomR
8VHRVERW}HVŸźQRPHQX6(*85$1d$
SDUDVHOHFFLRQDU'(7(&'(326,d­2H
SULPDRERWmRŹRX(17(5SDUDH[LELURPHQX
'(7(&'(326,d­2OLJDUGHVOLJDU
6HOHFFLRQH/,*$5HDFRQ¿JXUDomRGHHVSHOKR
HkQJXORDFWXDOVHUmRJUDYDGDV
‡(VWDIXQomRQmRSRGHIXQFLRQDUFRUUHFWDPHQWHVHRSURMHWRUQmRHVWLYHUQXPD
SRVLomRHVWiYHODRVHOHFFLRQDU/,*$5
6(*85$1d$
FRQWLQXDomR
4 XDQGR R SURMHWRU IRU OLJDGR VH HVWD IXQomR
HVWLYHU GHILQLGD SDUD /,*$5 H VH D FRQGLomR
GH LQVWDODomR GR SURMHWRU XWLOL]DomR QRUPDO
VXVSHQVRQRWHFWRRXXWLOL]DomRVREUHRWDPSR
GD PHVD RX D UHJXODomR GR HVSHOKR IRUHP
DOWHUDGDVUHODWLYDPHQWHjDQWHULRUPHQWHJUDYDGD
RDODUPHGR'(7(&'(326,d­2VHUiH[LELGR
HRSURMHWRUQmRH[LELUiDLPDJHPGHHQWUDGD
(VWDIXQomRVHUiVRPHQWHDFWLYDGDTXDQGRRSURMHWRUIRULQLFLDGRGHSRLVGHGHVOLJDU
DDOLPHQWDomR&$
&RQ¿JXUDomRGDSDODYUDFKDYHGRGHWHFWRUGHWUDQVLomR
8VHRVERW}HVŸźQRPHQX6(*85$1d$SDUDVHOHFFLRQDU'(7(&
'(326,d­2HSULPDRERWmRŹRX(17(5SDUDH[LELURPHQX
'(7(&'(326,d­2OLJDGRGHVOLJDGR
8VHRVERW}HVŸźQRPHQX'(7(&'(
326,d­2OLJDGRGHVOLJDGRSDUDVHOHFFLRQDU
/,*$5$FDL[DGHGLiORJR3$/$95$&+$9(
SHTXHQRVHUiH[LELGD
8VHRVERW}HVŸźŻŹSDUDLQWURGX]tOD
0RYDRFXUVRUjGLUHLWDGDFDL[DGHGLiORJR
,1752'3$/$95$3$66(SHTXHQRHSULPD
RERWmRŹSDUDH[LELUDFDL[DGHGLiORJR
SDODYUDFKDYHQRYDPHQWHHLQWURGX]DDPHVPD
SDODYUDFKDYHQRYDPHQWH
FRQWLQXDQDSiJLQDVHJXLQWH
51
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
0RYDRFXUVRUjGLUHLUDGDFDL[DGHGLiORJR
5(3(7,5$3$/$95$'(3$66(HSULPD
RERWmRŹSDUDH[LELUD3$/$95$&+$9(
SRUDSUR[LPDGDPHQWHVHJXQGRV$QRWH
D3$/$95$&+$9(GXUDQWHHVWHSHUtRGR
3UHPLURERWmR(17(5UHWRUQDUiSDUDRPHQX'(7(&'(326,d­2
OLJDUGHVOLJDU
‡1mRHVTXHoDGHVXD3$/$95$&+$9(GH'HWHFWRUGH7UDQVLomR
&RQ¿JXUDUR'HWHFWRUGH7UDQVLomRSDUDGHVOLJDGR
6LJDRVSURFHGLPHQWRVQRSDUDH[LELURPHQX'(7(&'(
326,d­2QRPHXHFUmOLJDUGHVOLJDU
6(*85$1d$
FRQWLQXDomR
6HOHFFLRQH'(6/,*$5SDUDH[LELUDFDL[DGHGLiORJR,1752'
3$/$95$3$66(JUDQGH,QWURGX]DD3$/$95$&+$9(UHJLVWDGDH
RHFUmUHWRUQDUiSDUDRPHQX'(7(&'(326,d­2OLJDGRGHVOLJDGR
HXVDUXPD3$/$95$&+$9(LQFRUUHFWDRPHQXGHHQWUDGDVHUi
IHFKDGR6HIRUQHFHVViULRUHSLWDRSURFHVVRGH
6HHVTXHFHXVXD3$/$95$&+$9(
6LJDRVSURFHGLPHQWRVQRSDUDH[LELURPHQX'(7(&'(
326,d­2QRPHXHFUmOLJDUGHVOLJDU
6HOHFFLRQH'(6/,*$5SDUDH[LELUDFDL[D
GHGLiORJR,1752'3$/$95$3$66(
JUDQGH2FyGLJRGHSHVTXLVDGH
GtJLWRVVHUiH[LELGRGHQWURGDFDL[D
&RQWDFWHVHXIRUQHFHGRUFRPR&RQ¿UPDU&yGLJRGHGtJLWRV6XD
3$/$95$&+$9(VHUiHQYLDGDGHSRLVTXHFRQ¿UPDUDVLQIRUPDo}HV
GHUHJLVWRGRXWLOL]DGRU
FRQWLQXDQDSiJLQDVHJXLQWH
52
Menu OPCAO
Menu OPCAO (continuação)
'HVFULomR
Item
8VDQGRDIXQomR6(1+$37(;72
(VWHLWHPSHUPLWHH[LELUXPDPHQVDJHPSHUVRQDOL]DGD7(;72QDWHODV
,1,&,$5H(175'±,1)23RGHVHSURWHJrODXVDQGRXPDVHQKDSDUD
SUHYHQLUTXHHODVHMDVREUHVFULWD
5.1 Exibindo o TEXTO
6(*85$1d$
FRQWLQXDomR
8VHRVERW}HVŸźGRPHQX6(*85$1d$
SDUDVHOHFLRQDURPHQX(6&5(9(57(;72H
HQWmRSUHVVLRQHRERWmRŹ$FDL[DGHGLiORJR
(6&5(9(57(;72VHUiH[LELGD
HR7(;72DWXDOVHUiPRVWUDGRQDVSULPHLUDV
WUrVOLQKDV6HQmRKRXYHUWH[WRDVOLQKDV
DSDUHFHUmRHPEUDQFR
8VHRVERW}HVŸźŻŹHDVWHFODV(17(5RX,1387SDUDVHOHFLRQDU
HDGLFLRQDUFDUDFWHUHV2ERWmR5(6(7SRGHVHUXVDGRSDUDDSDJDUXP
FDUDFWHUHGHFDGDYH]$OpPGLVVRVHPRYHURFXUVRUSDUD'(/(7$5RX
/,03$578'2QDWHODHDSHUWDURERWmR(17(5RX,1387FDUDFWHUH
RXWRGRVRVFDUDFWHUHVVHUmRDSDJDGRV27(;72SRGHFRQWHUDWp
FDUDFWHUHVHPFDGDOLQKD
3DUDPXGDUXPFDUDFWHUHMiSUHVHQWHSUHVVLRQH
RVERW}HVŸźSDUDPRYHURFXUVRUSDUDXPD
GDVSULPHLUDVWUrVOLQKDVHGHSRLVXVHRVERW}HV
ŻŹSDUDPRYHURFXUVRUDWpRFDUDFWHUHDVHU
PRGL¿FDGR$SyVSUHVVLRQDURVERW}HV(17(5
RX,1387RFDUDFWHUHpVHOHFLRQDGR(P
VHJXLGDUHSLWDRSURFHGLPHQWRGHVFULWRQRLWHP
DFLPD
3DUDWHUPLQDUDHQWUDGDGHWH[WRPRYDRFXUVRU
DWpDRSomR*8$5'$5QDWHODHSUHVVLRQHR
ERWmR(17(5RXRERWmR,13873DUDUHVWDXUDU
R7(;72DQWHULRUVHPVDOYDUDVDOWHUDo}HV
PRYDRFXUVRUDWpDRSomR&$1&(/$5QDWHOD
HSUHVVLRQH(17(5RX,1387
‡$IXQomR(6&5(9(57(;72HVWDUiGLVSRQtYHODSHQDV
VHD6(1+$37(;72HVWLYHUFRQ¿JXUDGDHP'(6/,*$5
5.2 Exibindo o TEXTO
8VHRVERW}HVŸźGRPHQX6(*85$1d$
SDUDVHOHFLRQDURPHQX02675$57(;72H
GHSRLVSUHVVLRQHRERWmRŹSDUDH[LELURPHQX 0HQX02675$57(;72
OLJDUGHVOLJDU
02675$57(;72OLJDUGHVOLJDU
8VHRVERW}HVŸźHP02675$57(;72
OLJDUGHVOLJDUSDUDOLJDURXGHVOLJDU
/,*$5Ù'(6/,*$5
4XDQGRDRSomR/,*$5pVHOHFLRQDGDR7(;72VHUi
H[LELGRQDWHOD,1,&,$5,QGHSHQGHQWHGDVHOHomRR
7(;72VHUiH[LELGRQD(175',1)2VHPSUHTXH
IRUVHOHFLRQDGDDRSomR,1)2QRPHQX6(59,d2
‡(VWDIXQomRHVWDUiGLVSRQtYHODSHQDVTXDQGRDIXQomR
6(1+$37(;72HVWLYHUFRQ¿JXUDGDHP'(6/,*$5
FRQWLQXDQDSiJLQDVHJXLQWH
53
Menu OPCAO
Menu OPCAO (continuação)
Item
'HVFULomR
/LJDQGRD6(1+$37(;72
6(*85$1d$
FRQWLQXDomR
54
$IXQomR6(1+$37(;72SRGHLPSHGLUTXHR7(;72VHMDVREUHVFULWR
/LJDQGRDIXQomR6(1+$37(;72
8VHRVERW}HVŸźGRPHQX6(*85$1d$
SDUDVHOHFLRQDURPHQX6(1+$37(;72H
SUHVVLRQHRERWmRŹSDUDH[LELURPHQX6(1+$
6(1+$37(;72
37(;72OLJDUGHVOLJDU
(VFROKHQGRD6(1+$37(;72
$FHVVHRPHQX6(1+$37(;72OLJDUGHVOLJDU
XVDQGRRSURFHGLPHQWRGRLWHP
8VHRVERW}HVŸźGRPHQX6(1+$37(;72
HHVFROKDDRSomR/,*$5$MDQHOD,1752'
-DQHOD,1752'3$/$95$
3$/$95$3$66(SHTXHQDVHUiH[LELGD
3$66(SHTXHQD
8VHRVERW}HVŸźŻŹSDUDHQWUDUFRPXPD
3$/$95$'(3$66(0RYDRFXUVRUSDUDR
ODGRGLUHLWRGDMDQHOD,1752'3$/$95$3$66(
SHTXHQDSUHVVLRQHRERWmRŹSDUDH[LELUD
MDQHOD5(3(7,5$3$/$95$'(3$66(HHQWUH
-DQHOD5(3(7,5$
FRPD3$/$95$'(3$66(QRYDPHQWH
3$/$95$'(3$66(
0RYDRFXUVRUSDUDRODGRGLUHLWRGDMDQHOD5(3(7,5
$3$/$95$'(3$66(SUHVVLRQHRERWmRŹSDUD
H[LELUD3$/$95$'(3$66(SRUFHUFDGH
VHJXQGRV4XDQGRHODDSDUHFHUDQRWHD
6HYRFrSUHVVLRQDURERWmR(17(5GRFRQWUROHUHPRWR
-DQHOD$127(
RXRERWmR,1387GRSURMHWRUHOHYROWDUiSDUDRPHQX
3$/$95$3$66(
6(1+$37(;72OLJDUGHVOLJDU6HD3$/$95$'(
3$66(HVWLYHUFRQ¿JXUDGDSDUD7(;72
‡2PHQX02675$57(;72QmRHVWDUiGLVSRQtYHORTXHSRGHUiLPSHGLUD
PXGDQoDGDFRQ¿JXUDomRGD9,68$/,=$d­2
‡2PHQX(6&5(9(57(;72QmRHVWDUiGLVSRQtYHORTXHSRGHLPSHGLU
TXHR7(;72VHMDVREUHVFULWR
'HVOLJDQGRD6(1+$37(;72
6LJDRSURFHGLPHQWRGRLWHPSDUDH[LELUR
PHQX3DO&KDYHGD0LQKD7HODOLJDUGHVOLJDU
6HOHFLRQH'(6/,*$5SDUDID]HUDSDUHFHUD
MDQHOD,1752'3$/$95$3$66(JUDQGH(QWUH
D3$/$95$'(3$66(UHJLVWUDGDHDWHODUHWRUQDUi MDQHOD,1752'3$/$95$3$66(
JUDQGH
DRPHQX6(1+$37(;72OLJDUGHVOLJDU
6HIRUGDGDXPD3$/$95$'(3$66(LQFRUUHWDRPHQXGHHQWUDGDVH
IHFKDUi6HQHFHVViULRUHSLWDRSURFHGLPHQWRGRLWHP
6HYRFrHVTXHFHUD3$/$95$'(3$66(
6LJDRSURFHGLPHQWRGRLWHPSDUDH[LELURPHQX6(1+$37(;72
OLJDUGHVOLJDU
6HOHFLRQH'(6/,*$5SDUDID]HUDSDUHFHUD-$1(/$,1752'
3$/$95$3$66(JUDQGH2&RQ¿UPDU&yGLJRGtJLWRVVHUi
H[LELGRQDiUHDGDMDQHOD
(QWUHHPFRQWDWRFRPRUHYHQGHGRUFRPR&RQ¿UPDU&yGLJRGH
GtJLWRVHPPmRV$VXD3$/$95$'(3$66(VHUiHQYLDGDDSyV
FRQ¿UPDomRGHVXDVLQIRUPDo}HVGHUHJLVWURGHXVXiULR
Menu REDE
0HQX5('(
/HPEUHVHGHTXHDVFRQ¿JXUDo}HVGHUHFHQHVWHSURMHWRU
SRGHFDXVDUIDOKDQDUHGH&RQVXOWHRVHXDGPLQLVWUDGRUGH
UHGHDQWHVGHFRQHFWDUXPSRQWRGHDFHVVRH[LVWHQWHQD
VXDUHGH
6HOHFFLRQH³5('(´GRPHQXSULQFLSDOSDUDDFHGHUDV
VHJXLQWHVIXQo}HV
6HOHFFLRQHXPLWHPFRPRVERW}HVFXUVRUŸźHSULPDRERWmRFXUVRUŹQR
SURMHWRURXFRQWUROHUHPRWRRXRERWmR(17(5SDUDH[HFXWDUHVWHLWHP'HSRLV
H[HFXWHRGHDFRUGRFRPDWDEHODVHJXLQWH
&RQVXOWHR0DQXDOGR8VXiULRGHWDOKDGR*XLDGH5HGHSDUDREWHUGHWDOKHV
VREUHDRSHUDomR5('(
NOTA ‡$FRQ¿JXUDomRSDGUmRGHIiEULFDSDUD'+&3p'(6/,*$56H
DFWLYDUVXDUHGH'+&3HFRQ¿JXUDUR(1'(5(d2'(,368%1(70$6.H
3257$3$'5­2DXWRPDWLFDPHQWHGH¿QD'+&3SDUD/,*$5
( 1HWZRUN6HWWLQJV&RQ¿JXUDo}HVGHUHGHGR0DQXDOGR8VXiULR
GHWDOKDGR*XLDGH5HGH
‡6HQmRXVDU6173('DWH7LPH6HWWLQJV&RQ¿JXUDo}HVGHGDWDKRUD
GR0DQXDOGR8VXiULRGHWDOKDGR*XLDGH5HGHHQWmRGH¿QDD'$7$(
+25$56GXUDQWHDLQVWDODomRLQLFLDO
'HVFULomR
Item
6HOHFFLRQDUHVWHLWHPH[LEHRPHQX&21),*
SDUDDUHGH
8VHRVERW}HVŸźSDUDVHOHFFLRQDUXPLWHP
HŹRX(17(5SDUDH[HFXWiOR
&21),*
8VHRVERW}HŸźSDUDOLJDUGHVOLJDUWR'+&3
/,*$5Ù'(6/,*$5
6HOHFFLRQH'(6/,*$5TXDQGRD
DHCP
UHGHQmRDFWLYDU'+&3
(Dynamic
‡4XDQGRDFRQILJXUDomR³'+&3´PXGDUSDUD³/,*$5´
Host
&RQ¿JXUDWLRQ OHYDXPWHPSRSDUDREWHUXPHQGHUHoR,3GRVHUYLGRU
'+&3
3URWRFRO
‡$IXQomR,3DXWRPiWLFRVHUiDWULEXLGDXPHQGHUHoR,3
VHRSURMHWRUQmRREWLYHUXPHQGHUHoR,3GRVHUYLGRU
PHVPRTXH'+&3HVWHMD³/,*$5´
FRQWLQXDQDSiJLQDVHJXLQWH
55
Menu REDE
Menu REDE (continuação)
'HVFULomR
Item
8VHRVERW}HVŸźŻŹSDUD
LQWURGX]LUR(1'(5(d2'(,3(VWD
IXQomRSRGHVRPHQWHVHUXVDGRTXDQGR
(1'(5(d2 '+&3IRUGH¿QLGRSDUD'(6/,*$'2
DE IP
‡1mRSRGHWHUGRLVGLVSRVLWLYRVFRPRVPHVPR(1'(5(d2
'(,3QDPHVPDUHGH1mRSRGHWHUGRLVGLVSRVLWLYRVFRPRV
PHVPR(1'(5(d2'(,3QDPHVPDUHGH
‡2(1'(5(d2'(,3³´pSURLELGR
8VHRVERW}HVŸźŻŹSDUD
LQWURGX]LUDPHVPD68%1(70$6.
68%1(7 XVDGDSHORVHX3&(VWDIXQomR
SRGHVRPHQWHVHUXVDGDTXDQGR
0$6.
'+&3IRUGH¿QLGRSDUD'(6/,*$'2
‡$PiVFDUDGHVXEUHGH´´pSURLELGD
&21),*
FRQWLQXDomR
8VHRVERW}HVŸźŻŹSDUD
LQWURGX]LUXPHQGHUHoRGH3257$
3$'5­2XPQRGHQXPDUHGHGH
PORTA
FRPSXWDGRUTXHVHUYHSDUDXP
3$'5­2
SRQWRGHDFHVVRSDUDRXWUDUHGH
(VWDIXQomRSRGHVRPHQWHVHUXVDGDTXDQGR'+&3
IRUGH¿QLGRSDUD'(6/,*$'2
8VHRVERW}HVŸźŻŹSDUD
LQWURGX]LURHQGHUHoRGR6(59,'25
6(59,'25
'1626(59,'25'16pXP
'16
VLVWHPDSDUDFRQWURODURVQRPHVGH
GRPtQLRHHQGHUHoRV,3QDUHGH
8VHRVERW}HVŸźŻŹSDUD
LQWURGX]LU',)(5(1d$+25È5,$
'H¿QDDPHVPD',)(5(1d$
+25È5,$GDTXHOHGH¿QLGRQR
',)(5(1d$
VHX3&6HQmRWLYHUFHUWH]D
HORÁRIA
FRQVXOWHVHXDGPLQLVWUDGRUGH7,
8VHRERWmRŻSDUDUHWRUQDU
SDUDRPHQXGHSRLVGHFRQ¿JXUDU
',)(5(1d$+25È5,$
DATA E
HORA
FRQWLQXDQDSiJLQDVHJXLQWH
56
8VHRVERW}HVŸźŻŹSDUD
LQWURGX]LURDQR~OWLPRVGRLV
GtJLWRVPrVGDWDKRUDHPLQXWR
‡2SURMHWRUVXEVWLWXLUiHVWDFRQ¿JXUDomRHUHFXSHUDUi
DVLQIRUPDo}HVGH'$7$(+25$GRVHUYLGRUGH
WHPSRDRDFWLYDU6173('DWH7LPH6HWWLQJV
&RQ¿JXUDo}HVGHGDWDKRUDGR0DQXDOGR8VXiULR
GHWDOKDGR*XLDGH5HGH
Menu REDE
Menu REDE (continuação)
'HVFULomR
Item
120('2
PROJETOR
8VHRVERW}HVŸźQRPHQX5('(SDUDVHOHFFLRQDURPHQX
120('2352-(725HSULPDRERWmRŹ$FDL[DGHGLiORJR
120('2352-(725VHUiH[LELGD
2120('2352-(725VHUi
H[LELGRQDVSULPHLUDVOLQKDV
6HQmRHVWLYHUHVFULWRDOLQKD¿FDUi
HPEUDQFR
8VHRVERW}HVŸźŻŹH(17(5
RX,1387SDUDVHOHFFLRQDUH
LQWURGX]LURVFDUDFWHUHV2ERWmR
5(6(7SRGHVHUXVDGRSDUDDSDJDU
RFDUDFWHUHGHFDGDYH]$OpP
GLVVRVHPRYHURFXUVRUSDUD
'(/(7$5RX/,03$578'2QR
HFUmHSUHPLURERWmR(17(5RX
,1387FDUDFWHUHRXWRGRVVHUmR
DSDJDGRV
2120('2352-(725SRGHWHU
DWpFDUDFWHUHV
3DUDPXGDUXPFDUDFWHUHMi
LQWURGX]LGRSULPDRERWmRWKH
ŸźSDUDPRYHUSDUDXPDGDV
SULPHLUDVOLQKDVHXVHRVERW}HV
ŻŹSDUPRYHURFXUVRUQR
FDUDFWHUHDVHUDOWHUDGR'HSRLVGH
SUHPLURERWmR(17(5RX,1387
RFDUDFWHUHpVHOHFFLRQDGR(QWmR
VHJXLURPHVPRSURFHGLPHQWR
FRQIRUPHGHVFULWRQRLWHPDFLPD
3DUDWHUPLQDUGHLQWURGX]LURWH[WR
PRYDRFXUVRUSDUD*8$5'$5QR
HFUmHSULPDRERWmR(17(5RX
,13873DUDUHYHUWHUR120('2
352-(725DQWHULRUVHPJXDUGDU
DVDOWHUDo}HVPRYDRFXUVRUSDUD
&$1&(/$5QRHFUmHSULPDRERWmR
(17(5RX,1387
FRQWLQXDQDSiJLQDVHJXLQWH
57
Menu REDE
Menu REDE (continuação)
'HVFULomR
Item
H6+27
6HOHFFLRQHHVWHLWHPSDUDH[LELURPHQX
H720$'$
$DSOLFDomR³7UDQVIHUrQFLD3-´pXVDGD
SDUDDUPD]HQDGDLPDJHPQVQRSURMHWRU
8VHRVERW}HVŸźSDUDVHOHFFLRQDUXPLWHPTXHpXPDLPDJHP
SDUDGDSHORH720$'$ (H6+27WUDQVIHUrQFLDGHLPDJHP
SDUDGD([LEHR0DQXDOGR8VXiULRGHWDOKDGR*XLDGH5HGH
HGHSRLVRERWmRŹRX(17(5SDUDH[LELUDLPDJHP
‡2LWHPVHDLPDJHPDUPD]HQDGDQmRSRGHVHUVHOHFFLRQDGR
‡2VQRPHVGDLPDJHPVmRFDGDXPH[LELGRHPFDUDFWHUHVRXPHQRV
Para trocar de imagem exibida
8VHRVERW}HVŸź
Para retornar para o menu
SULPDRERWmRŻRX(6&FRQWUROHUHPRWR
3DUDDSDJDUDLPDJHPH[LELGDHRVHXDUTXLYRIRQWHQRSURMHWRU
3ULPDRERWmR5(6(7QRFRQWUROH
UHPRWRDRH[LELUXPDLPDJHP
SDUDPRVWUDURPHQXH720$'$
5($-867(
3ULPDRERWmR(17(5QRFRQWUROHUHPRWRRX,1387QRSURMHWRU
SDUDDSDJDU
3DUDSDUDUGHDSDJDUSULPDRERWmR(6&QRFRQWUROHUHPRWRRX
ŻQRSURMHWRU
FRQWLQXDQDSiJLQDVHJXLQWH
58
Menu REDE
Menu REDE (continuação)
Item
'HVFULomR
6HOHFFLRQDUHVWHLWHPH[LEHDFDL[DGHGLiORJR5('(,1)2SDUD
FRQ¿UPDUDVFRQ¿JXUDo}HVGHUHGH
,1)2
‡2120('2352-(725pH[LELGR
‡1mRVHUiH[LELGRQDGDHPEUDQFRQRFDPSRGR³120('2
352-(725´DWpTXHFRQILJXUHRLWHP57
‡4XDQGRRQtYHOGHYROWDJHPGDEDWHULDSDUDDFRQVWUXomRGR
UHOyJLRGLPLQXLURWHPSRGH¿QLGRSRGH¿FDULQFRUUHFWRPHVPRTXH
DGDWDHDKRUDDFXUDGDVHMDPLQWURGX]LGDV6XEVWLWXDDEDWHULD
FRUUHFWD65
‡(1'(5(d2'(,368%1(70$6.H3257$3$'5­2LQGLFDP
³´TXDQGR'+&3HVWLYHU/,*$5HRSURMHWRUQmRREWLYHU
QHQKXPHQGHUHoRGRVHUYLGRU'+&3
([HFXWDUHVWHLWHPUHVWDEHOHFHHLQLFLDOL]DDVIXQo}HVGHUHGH
6HOHFFLRQH5(,1Ë&,$5XWLOL]DQGRRERWmRŹ
6HJXLGDPHQWHXWLOL]HRERWmRŸSDUDH[HFXWDU
6(59,d2
$UHGHVHUiFRUWDGDGHXPDYH]VHVHOHFFLRQDUUHLQLFLDU6H'+&3
IRUVHOHFFLRQDGRRHQGHUHoRGH,3SRGHVHUDOWHUDGR'HSRLV
GHVHOHFFLRQDU5(,1Ë&,$5RPHQXGD5('(SRGHUiQmRVHU
FRQWURODGRGXUDQWHDSUR[LPDGDPHQWHVHJXQGRV
59
Menu C.C.
0HQX&&
$FRQ¿JXUDomROHJHQGDSRGHVHUDOWHUDGDDWUDYpVGRPHQX&&QR
PRGRDYDQoDU6HOHFFLRQHRLWHPTXHDOWHUDUiFRPRVERW}HVFXUVRU
Ÿź
‡&&OHJHQGDpDIXQomRTXHH[LEHXPDWUDQVFULomRRXFDL[DGH
GLiORJRGDSDUWHGHiXGLRGHXPYtGHR¿FKHLURVRXRXWUDDSUHVHQWDomR
RXVRQVUHOHYDQWHV5HTXHUTXHWHQKDRIRUPDWRYtGHR176&RXDIRQWH
&RPSRQHQWHYtGHRLLVXSRUWDQGR&&SDUDXWLOL]DUHVWDIXQomR
Item
'HVFULomR
6HOHFFLRQHDFRQ¿JXUDomR(;,%,5OHJHQGDGDV
RSo}HVVHJXLQWHVFRPRVERW}HVŸź
(;,%,5
MODO
'(6/,*$5Ù/,*$5Ù$872
'(6/,*$5 /HJHQGDp'(6/,*$'$
/,*$5
/HJDQGDp/,*$'$
$872
/HJHQGDH[LEHDXWRPDWLFDPHQWHTXDQGRRYROXPH
pVLOHQFLDGR
‡$OHJHQGDQmRpH[LELGDDRDFWLYDURPHQX26'
‡$OHJHQGDpDIXQomRSDUDH[LELUDFDL[DGHGLiORJRQDUUDomRHRXHIHLWRVGHVRPGHXP
SURJUDPDGHWHOHYLVmRHRXHIHLWRVGHVRPGHXPSURJUDPDGHWHOHYLVmRRXRXWUDIRQWHV
GHYtGHR$GLVSRQLELOLGDGHGHOHJHQGDpGHSHQGHQWHGRWUDQVPLVVRUHRXFRQWH~GR
‡$FDSWXUDHVWiGLVSRQtYHOVHDIRQWHGHYtGHRIRUGRIRUPDWR176&HD
VHOHFomRSDUDRIRUPDWRYtGHRIRU$872RX176&QRPHQX(175'TXDQGR
TXHU9,'(2RX69,'(2IRUHPVHOHFFLRQDGRVFRPRSRUWDGHHQWUDGD
‡$FDSWXUDWDPEpPVHHQFRQWUDGLVSRQtYHOVHRVLQDOGHYtGHRLLHQWUDU
SHODSRUWD&20321(17TXDQGRHVWDIRUVHOHFFLRQDGDFRPRSRUWDGHHQWUDGD
‡7DOYH]QmRIXQFLRQHFRUUHFWDPHQWHGHSHQGHQGRGRHTXLSDPHQWR
RXIRQWHGHVLQDO1HVWHFDVRGHVOLJXHDIXQomRGHOHJHQGD
6HOHFFLRQHDFRQ¿JXUDomR02'2OHJHQGDGDV
RSo}HVVHJXLQWHVFRPRVERW}HVŸź
/(*(1'$6Ù7(;72
/(*(1'$6([LEHR7(;72GHOHJHQGD
7(;72([LEHRWH[WRGHGDGRVTXHpXVDGRSDUDLQIRUPDo}HVDGLFLRQDLVWDLVFRPR
QRWtFLDVRXXPJXLDGHSURJUDPDomRGH79$LQIRUPDomRFREUHRHFUm
LQWHLUR1HPWRGRVRVSURJUDPDVGHOHJHQGDWHPLQIRUPDo}HVGHWH[WR
6HOHFFLRQHDFRQ¿JXUDomR&$1$/GHOHJHQGDGDVRSo}HV
VHJXLQWHVFRPRVERW}HVŸź
ÙÙÙ
&$1$/
60
&DQDOFDQDOSULPiULRLGLRPD
&DQDO
&DQDO
&DQDO
2VGDGRVGHFDQDOSRGHPYDULDUGHSHQGHQGRGRFRQWH~GR$OJXQV
FDQDLVSRGHPVHUXVDGRVSDUDLGLRPDVHFXQGiULRRXYD]LR
Manutenção
0DQXWHQomR
Substituição da lâmpada
$OkPSDGDGHSURMHFomRWHPXPFLFORGHYLGDILQLWRTXHpGLIHUHQWHHPFDGDOkPSDGD6XEVWLWXDD
OkPSDGDRPDLVEUHYHSRVVtYHOTXDQGRDVILJXUDVSDUHFHUHPHVFXUDVRXTXDQGRDWRQDOLGDGHGDFRU
HVWLYHUIUDFD2XVRSURORQJDGRGDOkPSDGDSRGHID]HUFRPHODVHTXHLPHRXTXHEUH
5HFRPHQGDVHDSUHSDUDomRGHXPDOkPSDGDGHUHVHUYDHVXEVWLWXLomRDQWHFLSDGDGHOkPSDGD
3DUDSUHSDUDUXPDQRYDOkPSDGDIDOHFRPRVHXIRUQHFHGRUHIRUQHoDRQ~PHURGRWLSRDT00891
'HVOLJXHRSURMHWRUHGHVOLJXHRFDERGHDOLPHQWDomRGDWRPDGD
(GHL[HRSURMHWRUDUUHIHFHUSRUPLQXWRVGDIRUPDFRPRHVWi
4XDQGRRSURMHWRUHVWLYHUSUHVRQRWHWRRXHPDOJXPORFDOVREUHDVXDFDEHoDRXTXDQGR
DOkPSDGDQHFHVVLWHVHUVXEVWLWXLGDFHUWLILTXHVHGHFRQVXOWDUVHXIRUQHFHGRURXYHQGHGRU
SRUTXHSRGHVHUSHULJRVR
6RPHQWHSDUDRVFDVRVHPTXHSUHFLVDUID]HUDVXEVWLWXLomRVHPDMXGDVLJDRVHJXLQWH
SURFHGLPHQWR
7DPSDGD
OkPSDGD
6ROWHRSDUDIXVRDVVLQDODGRFRPXPDVHWD
GDWDPSDGDOkPSDGDHGHSRLVGHVOL]HD
WDPSDGDOkPSDGDSDUDRODGRHUHWLUHD
6ROWHRVSDUDIXVRVDVVLQDODGRVFRP
VHWDVGDWDPSDGDOkPSDGDSX[H
FXLGDGRVDPHQWHDOkPSDGDSHORVHQFDL[HV
,QVLUDDOkPSDGDHWHQKDFXLGDGRSDUDQmRWRFDU
RLQWHULRUGDFREHUWXUDGDOkPSDGD$RLQVHULU
SULPHLURSUHVWHDWHQomRSDUDDSRVLomRGDWRPDGD
HVHJXLGDPHQWHSDUDDSRVLomRGRVSLQRV
$SHUWHILUPHPHQWHRVSDUDIXVRVGD
OkPSDGDTXHHVWDYDPVROWRVQRSURFHVVR
3DUDIXVR
DQWHULRUSDUDDSHUWDORVQRYDPHQWH
(QFDL[HDWDPSDGDOkPSDGDQRYDPHQWHQR
OXJDUHDSHUWHILUPHPHQWHDWDPSDGDOkPSDGD &REHUWXUDGD
OkPSDGD
/LJXHHUHLQLFLHRSURMHWRU12, 16
$VHJXLUDFHUWHQRYDPHQWHRWLPHUWLPHU
QRLQWHULRU
3LQRSDUD
SRVLFLRQDPHQWR
7RPDGD
GDWDPSDGD
SDUDXVRGDOkPSDGD
OkPSDGD
3UHVVLRQHRERWmRŸRXźQRSURMHWRU
RXRERWmR0(18QRWHOHFRPDQGR
2³0(18)$&´pH[LELGR
3DUDIXVR
$SRQWHSDUD³9i3DUD0HQX$YDQoDGR´
3LQRSDUDSRVLFLRQDPHQWR
QRPHQXXVDQGRRERWmRŸRXźHPVHJXLGD
SUHVVLRQHRERWmRŹ2³0(18´pH[LELGR
$SRQWHSDUD³23&$2´QDFROXQDGDHVTXHUGDXVDQGRRERWmRŸRXźHP
VHJXLGDSUHVVLRQHRERWmRŹ2FXUVRUPRYHVHSDUDDFROXQDjGLUHLWD
$SRQWHSDUD³7(032/Æ03´XVDQGRRERWmRŸRXźHPVHJXLGDSUHVVLRQH
RERWmRŹ8PGLiORJRpH[LELGR
3UHVVLRQHRERWmRŸSDUDVHOHFLRQDU³5($-867(´QRGLiORJR([HFXWDXPQRYR
DFHUWRQRWLPHUGDOkPSDGD
61
Manutenção
Substituição da lâmpada (continuação)
NOTA ‡5HLQLFLHRFRQWDGRUDSHQDVGHSRLVGHWURFDUDOkPSDGDSDUDPDQWHU
VHPSUHXPYDORUFRUUHWRQRLQGLFDGRUGHWHPSRGHXVR
$/7$92/7$*(0
$/7$7(03(5$785$
$/7$35(66­2
AVISO Ź2SURMHWRUXWLOL]DXPDOkPSDGDGHYLGURGHPHUF~ULRGHDOWDSUHVVmR$OkPSDGD
SRGHUiTXHEUDUVHFRPEDUXKORHOHYDGRRXTXHLPDUVHVHDUUDQKDGDRXDJLWDGDPDQXVHDGDHQTXDQWR
HVWLYHUTXHQWHRXXVDGDGHYLGRDRWHPSR2EVHUYHTXHFDGDOkPSDGDWHPXPFLFORGHYLGDGLIHUHQWH
HDOJXPDVSRGHPUHEHQWDURXTXHLPDUORJRDSyVRLQtFLRGDXWLOL]DomR$OpPGLVVRTXDQGRDOkPSDGD
UHEHQWDUpSRVVtYHOTXHRVFDFRVGHYLGURVHHVSDOKHPQRLQWHULRUGRFRPSDUWLPHQWRGDOkPSDGDHQR
FDVRGHJiVTXHDFRQWDPLQDomRGHPHUF~ULRHVFDSHSHORVRULItFLRVGHYHQWLODomRGRSURMHWRU
Sobre a eliminação da lâmpada(VWHSURGXWRFRQWpPXPDOkPSDGDGHPHUF~ULRQmRD
FRORTXHQROL[R'HVIDoDVHGHODGHDFRUGRFRPDOHJLVODomRGHPHLRDPELHQWH
‡3DUDUHFLFODJHPGDOkPSDGDDFHGDwww.lamprecycle.orgQRV(8$
‡3DUDHOLPLQDomRGRSURGXWRHQWUHHPFRQWDWRFRPDVDXWRULGDGHVORFDLVRXwww.eiae.
orgQRV(8$RXwww.epsc.caQR&DQDGi
3DUDREWHUPDLVLQIRUPDo}HVHQWUHHPFRQWDWRFRPRIRUQHFHGRU
‡6HDOkPSDGDTXHEUDUVHRFRUUHUYRFrRXYLUiXPEDUXOKRDOWRGHVOLJXHR
FDERGHHOHWUHFLGDGHGDWRPDGDHFHUWLILTXHVHGHVROLFLWDUDVXEVWLWXLomRGD
OkPSDGDDRVHXIRUQHFHGRU2EVHUYHTXHRVFDFRVGHYLGURSRGHPGDQLILFDUDV
SDUWHVLQWHUQDVGRSURMHWRURXFDXVDUIHULPHQWRVGXUDQWHRPDQXVHLRSRULVVR
QmRWHQWHOLPSDURSURMHWRURXVXEVWLWXLUDOkPSDGDVHPDMXGD
‡6HDOkPSDGDTXHEUDUDOkPSDGDSURGX]XPHVWURQGRTXDQGRVHTXHEUH
PDQWHQKDDVDODEHPYHQWLODGDHSURFXUHQmRUHVSLUDURJiVH[SHOLGRSRUPHLR
GDVDtGDGRSURMHWRURXGHL[DUTXHRJiVDWLQMDRVROKRVRXDERFD
‡$QWHVGHVXEVWLWXLUDOkPSDGDGHVOLJXHRSURMHWRUHGHVOLJXHRFDERGHHOHWUHFLGDGH
HDVHJXLUHVSHUHSHORPHQRVPLQXWRVSDUDTXHDOkPSDGDDUUHIHoDRVXILFLHQWH2
PDQXVHLRGDOkPSDGDHQTXDQWRTXHQWHSRGHFDXVDUTXHLPDGXUDVHHVWUDJRVQDOkPSDGD
‡1XQFDGHVDSHUWHRVSDUDIXVRVH[FHWRRVSDUDIXVRVDVVLQDODGRVFRPXPDVHWD
‡1mRDEUDDWDPSDGDOkPSDGDHQTXDQWRRSURMHWRUHVWLYHUVXVSHQVRQRWHWR
RXHPTXDOTXHUOXJDUQRDOWRVREUHDVXDFDEHoDeSHULJRVRSRLVVHDOkPSDGD
VHTXHEUDURVFDFRVFDLUmRTXDQGRDWDPSDIRUDEHUWD$OpPGLVVRWUDEDOKDU
HPORFDLVDOWRVpSHULJRVRSRUWDQWRSURFXUHRVHXIRUQHFHGRUSDUDREWHUDMXGD
SDUDVXEVWLWXLUDOkPSDGDPHVPRVHQmRHVWLYHUTXHEUDGD
‡1mRXVHRSURMHWRUFRPRILOWURGHDUUHPRYLGR$RVXEVWLWXLUDOkPSDGD
FHUWLILTXHVHGHTXHRVSDUDIXVRVHVWmRDSHUWDGRVILUPHPHQWH3DUDIXVRVVROWRV
SRGHPFDXVDUGDQRVRXIHULPHQWRV
‡8VHDSHQDVDOkPSDGDGRWLSRHVSHFLILFDGR
‡6HDOkPSDGDVHTXHEUDUDSyVDSULPHLUDYH]GHXVRpSRVVtYHOTXHKDMD
SUREOHPDVHOpWULFRVHPRXWURORFDOSDUDDOpPGDOkPSDGD6HLVVRRFRUUHU
HQWUHHPFRQWDWRFRPVHXIRUQHFHGRURXUHSUHVHQWDQWHORFDO
‡0DQXVHLHFRPFXLGDGRDJLWDURXDUUDQKDUDOkPSDGDSRGHFDXVDUGDQRVGXUDQWHRXVR
‡2XVRGDOkPSDGDSRUORQJRVSHUtRGRVSRGHHVFXUHFHUFODUHDUGHPDLV
RXHVWRXUDU6XEVWLWXDDOkPSDGDRPDLVEUHYHSRVVtYHOTXDQGRDVILJXUDV
SDUHFHUHPHVFXUDVRXTXDQGRDWRQDOLGDGHGDFRUHVWLYHUIUDFD1mRXVH
OkPSDGDVYHOKDVXVDGDVLVVRSRGHFDXVDUTXHEUDV
62
Manutenção
0DQXWHQomRGRÀOWURGHDU
)DoDDYHULILFDomRHOLPSH]DGRILOWURGHDUSHULGRFDPHQWHSDUDPDQWHUDYHQWLODomR
QRUPDO4XDQGRRVLQGLFDGRUHVRXDVPHQVDJHQVVmRH[LELGDVHVROLFLWDPTXHYRFr
OLPSHRILOWURGHDURPDLVEUHYHSRVVtYHO
4XDQGRHVWLYHUGDQLILFDGRRXJDVWRGHPDLVVXEVWLWXDDXQLGDGHGHILOWUR3DUDSUHSDUDU
XPDQRYDOkPSDGDIDOHFRPRVHXIRUQHFHGRUHIRUQHoDRQ~PHURGRWLSR4'
'HVOLJXHRSURMHWRUHGHVOLJXHRFDERGH
DOLPHQWDomRGDWRPDGD'HL[HRSURMHWRUDUUHIHFHU
SRUDOJXQVPLQXWRVGDIRUPDFRPRHVWi
8VHRDVSLUDGRUGHSyQDXQLGDGHGRILOWURHP
WRGDDSDUWHH[WHUQD
'HVOLJXHDXQLGDGHGHILOWURSDUDFLPDSDUD
GHVWDFiODGRSURMHWRU
8QLGDGH
GH¿OWUR
8VHRDVSLUDGRUGHSyQDHQWUDGDGHYHQWLODomR
GRSURMHWRU
8VHRDVSLUDGRUGHSyQDSDUWHODWHUDOGDXQLGDGHGR
ILOWUR1mRSDVVHRDVSLUDGRUGHSyGLUHWDPHQWHQR
ILOWURSRUTXHRXWLOL]DGRUSRGHUiLQDODURILOWURGHDU
4XDQGRRILOWURGHDUHVWLYHUGDQLILFDGRRXJDVWR
GHPDLVSUHSDUHXPDQRYDXQLGDGHGHILOWUR
(QWUDGDGH
YHQWLODomR
&HUWLILTXHVHGHTXHH[LVWDILOWURGHDUQRLQWHULRU
HHQFDL[HDWDPSDGRILOWURQROXJDU
/LJXHHUHLQLFLHRSURMHWRU12, 16)
$VHJXLUDFHUWHQRYDPHQWHRWLPHUWLPHUSDUDXVRGRILOWURGHDU
3UHVVLRQHRERWmRŸRXźQRSURMHWRURXRERWmR0(18QRWHOHFRPDQGR
2³0(18)$&´pH[LELGR
$SRQWHSDUD³7(032),/752´QRPHQXXVDQGRRERWmRŸRXźHP
VHJXLGDSUHVVLRQHRERWmRŹ8PGLiORJRpH[LELGR
3UHVVLRQHRERWmRŸSDUDVHOHFLRQDU³5($-867(´QRGLiORJR([HFXWD
XPQRYRDFHUWRQRWLPHUGDOkPSDGD
FRQWLQXDQDSiJLQDVHJXLQWH
63
Manutenção
0DQXWHQomRGR¿OWURGHDU(continuação)
NOTA ‡8PDXQLGDGHGHILOWURGHXPWLSRHVSHFLILFDGRYLUiFRPDOkPSDGDGH
VXEVWLWXLomRSDUDHVWHSURMHWRU5HFRPHQGDVHDVXEVWLWXLomRGDXQLGDGHGHILOWUR
DRPHVPRWHPSRTXHDOkPSDGD
‡5HLQLFLHRFRQWDGRUGHWHPSRGHILOWURDSHQDVGHSRLVGHOLPSDURXWURFDUR
ILOWURGHDUSDUDPDQWHUVHPSUHXPYDORUFRUUHWRSDUDRILOWURGHDU
‡RSURMHWRUSRGHH[LELUDPHQVDJHPWDOFRPR³9(5,),&$5)/8;2'($5´RX
GHVOLJXHRSURMHWRUSDUDHYLWDUTXHRQtYHOGHWHPSHUDWXUDLQWHUQDDXPHQWH
AVISO Ź$QWHVGHFXLGDUGR¿OWURGHDUYHUL¿TXHRLQWHUUXSWRUGHDOLPHQWDomRHVWi
GHVOLJDGDHRFDERGHDOLPHQWDomRQmRHVWiOLJDGRHGHSRLVSHUPLWDTXHRSURMHWRU
UHVIULHRVX¿FLHQWH&XLGDUGR¿OWURGHDUQXPHVWDGRGHWHPSHUDWXUDDOWDGRSURMHWRU
SRGHFDXVDUFKRTXHHOpFWULFRTXHLPDGXUDRXIXQFLRQDPHQWRSUHFiULRQRDSDUHOKR
Ź8WLOL]HXQLFDPHQWHDXQLGDGHGH¿OWURGHDUGRWLSRHVSHFL¿FDGR1mRXVH
RSURMHWRUVHPR¿OWURGHDURXWDPSDGH¿OWUR3RGHFDXVDULQFrQGLRRX
IXQFLRQDPHQWRSUpFDULRQRSURMHWRU
Ź/LPSHR¿OWURGHDUSHULRGLFDPHQWH6HR¿OWURGHDU¿FDUHQWXSLGRFRP
VXMHLUDRXVLPLODUDVWHPSHUDWXUDVLQWHUQDVDXPHQWDPHSRGHFDXVDULQFrQGLR
TXHLPDGXUDRXIXQFLRQDPHQWRSUHFiULRGRSURMHWRU
64
Manutenção
6XEVWLWXLomRGDSLOKDGRUHOyJLR
(VVHSURMHWRUSRVVXLXPUHOyJLRLQWHUQRTXHQHFHVVLWDGHSLOKD4XDQGRRUHOyJLR
GDUHGHQmRIXQFLRQDUFRUUHWDPHQWHH[SHULPHQWHWURFDUDSLOKDHITACHI
MAXELLSDUWHQ~PHURCR2032
&DSDGDSLOKD
'HVOLJXHRSURMHWRUHGHVOLJXHRFDERGH
DOLPHQWDomRGDWRPDGD'HL[HRSURMHWRUDUUHIHFHU
SRUDOJXQVPLQXWRVGDIRUPDFRPRHVWi
*HQWLOPHQWHSRVLFLRQHRSURMHWRUGHFDEHoD
SDUDEDL[R
5HPRYDDWDPSDGDSLOKD
*LUHDWDPSDGDSLOKDQDGLUHomRLQGLFDGDSDUD
)HFKDU
³23(1´DWpTXHHODVHGHVHQFDL[HXWLOL]DQGR
XPDPRHGDRXREMHWRVHPHOKDQWH$SyVJLUDUD
WDPSDGDSLOKDXWLOL]HDDOoDSDUDUHPRYrOD
$EULU
5HWLUHDSLOKDDQWLJD
3UHVVLRQHDJDUUDPHWiOLFDGRVXSRUWHGDSLOKD
*DUUDPHWiOLFD
'HVVDIRUPDYRFHSRGHUHWLUDUDSLOKD5HWLUHD
CLO
SE
OPE
N
&RORTXHDQRYDSLOKDQRVXSRUWHGHDFRUGRFRP
DVPDUFDVGHSRODULGDGHGHQWURGRVXSRUWHGH
IRUPDTXHRODGRPDUFDGRGDSLOKDILTXHSDUD
FLPD3UHVVLRQHDSLOKDSDUDGHQWURGRVXSRUWHDWp
TXHHVWHMDILUPHPHQWHHQFDL[DGD
&RORTXHDFDSDGDSLOKDGHYROWDJLUHQDGLUHomR
LQGLFDGDSDUD³&/26(´XWLOL]DQGRXPDPRHGDRXDOJXP
REMHWRVHPHOKDQWHDWpTXHDWDPSDHVWHMDILUPH
NOTA ‡$UHPRomRVXEVWLWXLomRGDSLOKDDFLRQDUiRUHOyJLRLQWHUQR3DUD
SURJUDPDURUHOyJLRFRQVXOWHR*XLDGH5HGHQR&'
AVISO Ź6HMDFDXWHORVRDRPDQXVHDUDVSLOKDVHODVSRGHPSURYRFDUH[SORV}HV
UDFKDVRXYD]DPHQWRVTXHSRGHPFDXVDUXPLQFrQGLRIHULPHQWRVRXSROXLomRDPELHQWDO
‡8WLOL]HDSHQDVSLOKDVQRYDVHGHQWURGDHVSHFLILFDomR1mRXWLOL]HSLOKDV
GDQLILFDGDVFRQWHQGRDUUDQK}HVPRVVDVIHUUXJHPRXYD]DPHQWRV
‡4XDQGRRFRUUHURYD]DPHQWRGHXPDSLOKDOLPSHRYD]DPHQWRFRPXPOHQoR
GHVFDUWiYHO6HROtTXLGRWRFDUDOJXPDSDUWHGRVHXFRUSRHQ[DJHLPHGLDWDPHQWH
FRPiJXDFRUUHQWH4XDQGRKRXYHUYD]DPHQWRQRVXSRUWHGDVSLOKDVWURTXHDVSLOKDV
DSyVOLPSDURYD]DPHQWR
‡$RFRORFDUXPDSLOKDFRQILUDVHRVWHUPLQDLVSRVLWLYRHQHJDWLYRHVWmRQDSRVLomRFRUUHWD
‡1mRWHQWHUHFXSHUDUXPDSLOKDFRPRSRUH[HPSORUHFDUUHJDURXVROGDU
‡0DQWHQKDDVSLOKDVHPORFDOHVFXURIUHVFRHVHFR1XQFDH[SRQKDXPDSLOKDDIRJRRXiJXD
‡$RGHVID]HUVHGHXPDSLOKDREHGHoDDOHJLVODomRORFDO
65
Manutenção
Cuidados com o espelho e com as lentes
6HDOHQWHHVWLYHUGHIHLWXRVDVXMDRXEDoDSRGHKDYHUSHUGDGHTXDOLGDGHQD
LPDJHPH[LELGD3URFXUHFXLGDUEHPGRHVSHOKRHGDVOHQWHVPDQXVHDQGRRV
FRPFXLGDGR
'HVOLJXHRSURMHWRUHGHVOLJXHRFDERGH
DOLPHQWDomRGDWRPDGD'HL[HRSURMHWRUDUUHIHFHU
SRUDOJXQVPLQXWRVGDIRUPDFRPRHVWi
$SRUWDGDOHQWHSRGHVHUDEHUWDPDQXDOPHQWH
6HJXUHDPERVRVODGRVGDSRUWDGDOHQWHH
DEUDGHYDJDUDWpRXYLURFOLTXHGHWUDYDJHP
/LPSHRHVSHOKRHOHQWHVVXDYHPHQWHFRPXPSDQRPDFLR
DSURSULDGRSDUDOLPSH]DGHOHQWHVTXHSRGHVHUHQFRQWUDGR
ER IN1
PUT
1
COM
ER IN2
PUT
COM
ER OUT
PUT
COM
USB
L
TRO
CON
LAN
IO
AUD
OUT
DEO
S-VI
2
IO IN
AUD
R
CR/P
B
CB/P
R
Y
L
IN3
O
VIDE AUDIO
ER IN1
PUT
1
COM
ER IN2
PUT
COM
ER OUT
PUT
COM
USB
L
TRO
CON
B
CR/P
LAN
IO
AUD
OUT
DEO
S-VI
CB/P
2
IO IN
AUD
R
R
Y
L
IN3
O
VIDE AUDIO
QRPHUFDGRWHQGRFXLGDGRSDUDQmRRVGDQLILFDU
3DUDOLPSH]DGDVH[WUHPLGDGHVGRHVSHOKRHGDVOHQWHV
iUHDVGHGLItFLODFHVVRXWLOL]HXPDYHQWRLQKDDSURSULDGD
GLVSRQtYHOQRPHUFDGR
3DUDIHFKDUDSRUWDGDVOHQWHVDGHTXDGDPHQWHVLJD
DVLQVWUXo}HVDEDL[R
/LJXHRSURMHWRU
/LJXHDERWmRGHDOLPHQWDomR
$LQGDTXHDSRUWDFRPHFHDIHFKDUHODSRGHQmR
IHFKDUDGHTXDGDPHQWH
3UHVVLRQHRERWmR67$1'%<21SDUDTXHD
OkPSDGDGRSURMHWRUDFHQGD
4XDQGRDOX]GR32:(5LQGLFDGRUGHIRUoD
VHWRUQDUYHUGHHFRQWtQXDSUHVVLRQHRERWmR
67$1'%<21GXDVYH]HVSDUDGHVOLJDURSURMHWRU
$SRUWDGDOHQWHIHFKDUiGHIRUPDDSURSULDGD
3DQRPDFLR
YHQWRLQKD
NOTA ‡4XDQGRDSRUWDGDOHQWHpIHFKDGDPDQXDOPHQWHHODSRGHQmRIHFKDUGHIRUPDDGHTXDGD
AVISO Ź$QWHVGHFXLGDUGRHVSHOKRGHSURMHomRHGDVOHQWHVGHVOLJXHRSURMHWRUGHVOLJXH
RFDERGHDOLPHQWDomRHDJXDUGHDWpTXHRSURMHWRUDUUHIHoDRVXILFLHQWHSDUDVHUPDQXVHDGR
Ź1mRXWLOL]HDVSLUDGRUGHSyQDOLPSH]DGRHVSHOKRGHSURMHFomRHGDVOHQWHV
SDUDHYLWDUSRVVtYHLVGDQRV
Ź1mRXWLOL]HSURGXWRVGHOLPSH]DRXSURGXWRVTXtPLFRVTXHQmRHVWHMDP
HVSHFLILFDGRVQHVWHPDQXDO7RPHFXLGDGRHVSHFLDOQDOLPSH]DGRHVSHOKRGH
SURMHomRPDWHULDLVLQDGHTXDGRVSRGHPFDXVDUGDQRVVHYHURVQRHVSHOKR
PRECAUÇÃO Ź&XLGDGRSDUDQmRSUHQGHURVVHXVGHGRVTXDQGRDSRUWDGD
OHQWHHVWLYHUHPPRYLPHQWRLVVRSRGHUiFDXVDUIHULPHQWRV
66
Manutenção
Outros cuidados
Interior do projetor
3DUDDVVHJXUDUXVRVHJXURGHVHXSURMHWRUOLPSHRHLQVSHFFLRQHRFRPVHX
IRUQHFHGRUDFDGDDQR
Tratamento da cabine e controle remoto
7UDWDPHQWRLQFRUUHFWRSRGHWHUHIHLWRDGYHUVRWDLVFRPRGHVFRORUDomRWLQWD
GHVFDVFDGDHWF
'HVOLJXHRSURMHWRUHUHWLUHRFDERGHDOLPHQWDomR3HUPLWDTXHRSURMHWRU
UHVIULHDGHTXDGDPHQWH
'HSRLVGHYHUL¿FDUVHRSURMHWRUHVWiIULROLPSHOHYHPHQWHFRPJD]HRXXP
SDQRVXDYH
6HRSURMHWRUHVWLYHUPXLWVXMROLPSHRFRPXPSDQROHYHPHQWH~PLGRFRP
OLPSDGRUQHXWURRXiJXDGRFH'HSRLVSDVVHXPSDQRVHFRHVXDYH
AVISO Ź$QWHVGHFXLGDUGRDSDUHOKRYHUL¿TXHVHRFDERGHDOLPHQWDomR
QmRHVWiOLJDGRHGHSRLVSHUPLWDTXHRSURMHWRUUHVIULHVX¿FLHQWHPHQWH2
FXLGDGRQRHVWDGRGHWHPSHUDWXUDDOWDGRSURMHWRUSRGHFDXVDUTXHLPDGXUDHRX
IXQFLRQDPHQWRSUHFiULRDRSURMHWRU
Ź1XQFDWHQWHUHSDUDURXOLPSDUDSDUWHLQWHUQDGRSURMHWRUSHVVRDOPHQWHXPD
YH]TXHpSHULJRVR
Ź(YLWHPROKDURSURMHWRURXGHL[HFDLUOtTXLGRQRSURMHWRU,VWRSRGHFDXVDU
LQFrQGLRFKRTXHHOpFWULFRHRXIXQFLRQDPHQWRSUHFiULRDRSURMHWRU
‡1mRFRORTXHQDGDFRPiJXDOLPSDGRUHVRXSURGXWRVTXtPLFRVSUy[LPRGR
SURMHWRU
‡1mRXVHDHURVVRORXYDSRUL]DGRU
PRECAUÇÃO ŹWHQKDRFXLGDGRFRUUHFWRFRPRSURMHWRUGHDFRUGRFRPR
VHJXLQWH&XLGDGRLQFRUUHFWRSRGHFDXVDUQmRVRPHQWHOHVmRFRPRWDPEpP
LQÀXrQFLDDGYHUVDWDLVFRPRGHVFRORUDomRGHVFDVFDUDWLQWDHWF
Ź1mRXVHOLPSDGRUHVRXSURGXWRVTXtPLFRVGRTXHHVWHVHVSHFL¿FDGRVQHVWHPDQXDO
Ź1mRIDoDSROLPHQWRRXOLPSHFRPREMHFWRVGXURV
67
Solução de problemas
6ROXomRGHSUREOHPDV
6HRFRUUHUXPDRSHUDomRDQRUPDOLQWHUURPSDRXVRGRSURMHWRULPHGLDWDPHQWH
AVISO Ź1XQFDXVHRSURMHWRUVHRSHUDo}HVDQRUPDLVWDLVFRPRIXPDoD
VRPH[FHVVLYRHPEDODJHPHOHPHQWRVRXFDERVGDQL¿FDGRVSHQHQWUDomR
GHOtTXLGRRXFRUSRHVWUDQKRHWFGHYHPRFRUUHU(PWDLVFDVRVGHVOLJXH
LPHGLDWDPHQWHRDSDUHOKRHGHVFRQHFWHRFRQHFWRUGD¿FKDGHSDUHGH'HSRLV
GHYHUL¿FDUTXHDIXPDoDRXRGRUIRLLQWHUURPSLGRFRQWDFWHVHXIRUQHFHGRURX
SUHVWDGRUGHVHUYLoR
&DVRFRQWUiULRVHRFRUUHUXPSUREOHPDFRPRSURMHWRUVLJDDVYHUL¿FDo}HVH
UHFRPHQGDo}HVUHFRPHQGDGDVDQWHVGHVROLFLWDUUHSDUR
6HQmRUHVROYHURSUREOHPDFRQWDFWHVHXUHSUHVHQWDQWHRXSUHVWDGRUGHVHUYLoR
6DEHUiDVFRQGLo}HVGHJDUDQWLDTXHVHDSOLFDP
0HQVDJHQVUHODFLRQDGDV
4XDQGRDSDUHFHDOJXPDPHQVDJHPYHUL¿TXHRVHXFRQWH~GRHUHVROYDGHDFRUGRFRP
DWDEHODVHJXLQWH(PERUDHVWDVPHQVDJHPVGHVDSDUHFHUmRDXWRPDWLFDPHQWHHP
DSUR[LPDGDPHQWHDOJXQVPLQXWRVUHDSDUHFHUiDFDGDYH]TXHOLJDUDDOLPHQWDomR
Mensagem
'HVFULomR
1mRH[LVWHVLQDOGHHQWUDGD
&RQ¿UPHDFRQH[mRGHHQWUDGDGHVLQDOHRHVWDGRGD
IRQWHGHVLQDO
$IUHTXrQFLDKRUL]RQWDORXYHUWLFDOGRVLQDOGHHQWUDGD
QmRHVWiGHQWURGDIDL[DHVSHFL¿FDGD
&RQ¿UPHDVHVSHFL¿FDo}HVSDUDVHXSURMHWRURXGDIRQWH
GHVLQDO
A temperatura interna está aumentando.
'HVOLJXHDDOLPHQWDomRHSHUPLWDTXHRSURMHWRUUHVIULHSRUSHORPHQRV
PLQXWRV'HSRLVGHFRQ¿UPDURVLWHQVVHJXLQWHVOLJXHRQRYDPHQWH
‡6HRFRUUHUEORTXHLRQDDEHUWXUDGDSDVVDJHPGHDU"
‡R¿OWURGHDUHVWiVXMR"
‡$WHPSHUDWXUDSHULIpULFDH[FHGHXƒ&"
6HH[LELUDPHVPDLQGLFDomRGHSRLVGRUHSDURFRQ¿JXUH
9(/9(17GRLWHP6(59,d2QRPHQX23&$2SDUD$/7$
$QRWHRISUHFDXWLRQZKHQFOHDQLQJWKHDLU¿OWHU
'HVOLJXHLPHGLDWDPHQWHDDOLPHQWDomRHOLPSHHWURTXH
R¿OWURGHDUPHQFLRQDGRQDVHFomR³0DQXWHQomRGR
¿OWURGHDU´GHVWHPDQXDO'HSRLVGHWHUOLPSRRXWURFDGR
R¿OWURGHDUDVVHJXUHVHGHTXHUHLQLFLDRWHPSRUL]DGRUGR
¿OWUR43, 63
68
Solução de problemas
(PUHODomRjVOkPSDGDVLQGLFDGRUDV
4XDQGRDRSHUDomRGRVLQGLFDGRUHVLAMPTEMPH32:(5GLIHULUHPGRQRUPDO
YHUL¿TXHHUHVROYDRSUREOHPDGHDFRUGRFRPDWDEHODVHJXLQWH
Indicador Indicador Indicador
32:(5
LAMP
TEMP
'HVFULomR
Iluminação
em Laranja
Desli
gado
Desli
gado
O projetor está no estado em espera.
&RQVXOWHDVHFomR³/LJDUGHVOLJDU´
Cintilar em
Verde
Desli
gado
Desli
gado
2SURMHWRUHVWiDTXHFHQGR
$DJXDUGDU
Iluminação
em Verde
Desli
gado
Desli
gado
O projetor está no estado ligado.
$VRSHUDo}HVRUGLQiULDVSRGHPVHUH[HFXWDGDV
Cintilar em
Laranja
Desli
gado
Desli
gado
O projetor esta resfriando.
$DJXDUGDU
Cintilar em
Vermelho
Cintilar em
Vermelho
ou
iluminação
em
Vermelho
Cintilar em
Vermelho
ou
iluminação
em
Vermelho
Cintilar em
Vermelho
ou
iluminação
em
Vermelho
Iluminação em
Vermelho
2SURMHWRUHVWDUHVIULDQGR8PHUURIRLGHWHFWDGR
$JXDUGHDWpTXHRLQGLFDGRU32:(5WHUPLQDGHFLQWLODUH
(opcional) (opcional)
GHSRLVH[HFXWHDPHGLGDFRUUHFWDFRPDVGHVFULo}HVGR
LWHPDEDL[R
$OkPSDGDQmRDFHQGHHH[LVWHDSRVVLELOLGDGHGHTXH
DSDUWHLQWHULRU¿FRXDTXHFLGD
'HVOLJXHDDOLPHQWDomRHSHUPLWDTXHRSURMHWRUUHVIULH
SRUSHORPHQRVPLQXWRV'HSRLVTXHRSURMHWRUWHQKD
UHVIULDGRRVX¿FLHQWHFRQ¿UPHRVLWHQVVHJXLQWHVHGHSRLV
Iluminação em Desli
OLJXHRQRYDPHQWH
Vermelho
gado
‡([LVWHXPEORTXHLRGDDEHUWXUDGDSDVVDJHPGHDU"
‡2¿OWURGHDUHVWiVXMR"
‡$WHPSHUDWXUDSHULIpULFDH[FHGHƒ&"
6HDPHVPDLQGLFDomRIRUH[LELGDGHSRLVGDVROXomR
PXGHDOkPSDGDPHQFLRQDGDQDVHFomR/kPSDGD
Cintilar em
Vermelho
Desli
gado
Desli
gado
Desli
gado
$WDPSDGDOkPSDGDQmRIRL¿[DGDFRUUHFWDPHQWH
'HVOLJXHDDOLPHQWDomRHSHUPLWDTXHRSURMHWRUUHVIULH
SRUSHORPHQRVPLQXWRV'HSRLVTXHRSURMHWRUUHVIULDU
FRQ¿UPHRHVWDGRGHDQH[DomRGDWDPSDGDOkPSDGD'HSRLV
GHID]HUTXDOTXHUPDQXWHQomROLJXHRDSDUHOKRQRYDPHQWH
6HDPHVPDLQGLFDomRIRUPRVWUDGDGHSRLVGRUHSDUR
FRQWDFWHVHXIRUQHFHGRURXDVVLVWrQFLDWpFQLFD
Cintilar em
Vermelho
$YHQWRLQKDGHUHVIULDPHQWRQmRHVWiRSHUDQGR
'HVOLJXHDDOLPHQWDomRHSHUPLWDTXHRSURMHWRUUHVIULH
SRUSHORPHQRVPLQXWRV'HSRLVTXHRSURMHWRU
WLYHUUHVIULDGRRVX¿FLHQWHFRQ¿UPHVHQmRWHPQHQKXP
FRUSRHVWUDQKRGHQWURGDYHQWRLQKDHWFHGHSRLVOLJXHR
DSDUHOKRQRYDPHQWH
6HDPHVPDLQGLFDomRIRUH[LELGDGHSRLVTXHDVROXomRIRLIHLWD
FRQWDFWHVHXIRUQHFHGRURXRSHUDGRUGHVHUYLoR
Desli
gado
$SRUWDGDOHQWHQmRHVWiDEHUWDRXIHFKDGDGHYLGDPHQWH
2FRUUHXXPDGDVFLUFXQVWkQFLDVVHJXLQWHV
‡$SRUWDGDOHQWHQmRHVWiGHYLGDPHQWHDEHUWDTXDQGRRSURMHFWRUpOLJDGR
‡$SRUWDGDOHQWHQmRHVWiGHYLGDPHQWHIHFKDGDTXDQGRRSURMHFWRUpGHVOLJDGR
‡$SRVLomRGDSRUWDGDOHQWHpPXGDGDHQTXDQWRRSURMHFWRUHVWiDIXQFLRQDU
5HLQLFLHRSURMHFWRUGHSRLVGHFRQ¿UPDUTXHQmRH[LVWHQDGD
TXHREVWUXDDSRUWDGDOHQWHTXDQGRHVWDDEUHRXIHFKD
FRQWLQXDQDSiJLQDVHJXLQWH
69
Solução de problemas
Em relação às lâmpadas indicadoras (continuação)
Indicador Indicador Indicador
32:(5
LAMP
TEMP
'HVFULomR
([LVWHDSRVVLELOLGDGHGHTXHDSDUWHLQWHULRU
HVWHMDTXHQWH
Cintilar em
Vermelho
ou
iluminação
em
Vermelho
Desli
gado
'HVOLJXHDDOLPHQWDomRHSHUPLWDTXHRSURMHWRUUHVIULHSRUSHOR
PHQRVPLQXWRV'HSRLVTXHRSURMHWRUWHQKDUHVIULDGRR
VX¿FLHQWHFRQ¿UPHRVLWHQVVHJXLQWHVHGHSRLVOLJXHRQRYDPHQWH
Iluminação
‡([LVWHXPEORTXHLRGDDEHUWXUDGDSDVVDJHPGHDU"
em Vermelho
‡2¿OWURGHDUHVWiVXMR"
‡$WHPSHUDWXUDSHULIpULFDH[FHGHƒ&"
6HDPHVPDLQGLFDomRIRUH[LELGDGHSRLVGDVROXomR
GH¿QD9(/9(17GRLWHP6(59,d2QRPHQX
23&$2SDU$/7$45
eKRUDGHOLPSDUR¿OWURGHDU
Iluminação
em Verde
Cintila
simultaneamente
EN Vermelho
'HVOLJXHLPHGLDWDPHQWHDDOLPHQWDomRHOLPSHRXWURTXHR
¿OWURGHDUPHQFLRQDGRQDVHFomR³0DQXWHQomRGR¿OWURGH
DU´GHVWHPDQXDOGHSRLVGHOLPSDURXWURFDUR¿OWURGHDU
UHDMXVWHRWHPSRUL]DGRUGH¿OWUR
'HSRLVGDVROXomRUHDMXVWHDDOLPHQWDomRSDUD/,*$'2
([LVWHDSRVVLELOLGDGHGHTXHDSDUWHLQWHULRUHVWHMDIULD
Cintila
Iluminação
8VHDXQLGDGHGHQWURGRVSDUkPHWURVGHWHPSHUDWXUD
alternadamente em
em Verde
GHXVRƒ&Dƒ&
Vermelho
'HSRLVGRWUDWDPHQWRUHDMXVWHDDOLPHQWDomRSDUD/,*$'2
Cintila em
Verde por
aprox. 3
segundos
desligado é guardada no projetor.
Desli
gado
Desli
gado
&RQVXOWHVHFomR'H¿QLUSURJUDPDo}HVGR0DQXDO
GR8VXiULRGHWDOKDGR*XLDGH5HGH
NOTA ‡4XDQGRVREUHDTXHFHUDSDUWHLQWHUQDSRUTXHVW}HVGHVHJXUDQoD
RSURMHWRUVHUiDXWRPDWLFDPHQWHIHFKDGRHDOkPSDGDGRLQGLFDGRUVHUi
GHVOLJDGD(PWDOFDVRGHVOLJXHRFDERGHDOLPHQWDomRHDJXDUGHSHORPHQRV
PLQXWRV'HSRLVTXHRSURMHWRUUHVIULDUDGHTXDGDPHQWHFRQ¿UPHRHVWDGR
DQH[RGDOkPSDGDHWDPSDGDOkPSDGDHGHSRLVOLJXHRQRYDPHQWH
Fechar o projetor
6RPHQWHRSURMHWRUQmRSRGHVHUGHVOLJDGRGDPDQHLUD
QRUPDO17SULPDRLQWHUUXSWRUFRPXPSLQRXVLPLODU
HGHVOLJXHD¿FKDGHSDUHGH$QWHVGHOLJDUQRYDPHQWH
DJXDUGHSHORPHQRVPLQXWRVSDUDID]HUFRPTXHR
SURMHWRUUHVIULHRVX¿FLHQWH
,QWHUUXSWRUGHIHFKDPHQWR
MONITOR OUT
5HDMXVWDUWRGDVDVFRQÀJXUDo}HV
4XDQGRIRUGLItFLOGHFRUULJLUDOJXPDVGH¿QLo}HVHUUDGDVDIXQomR$-867()$%5GRLWHP6(59,d2
QRPHQX23&$246SRGHUHDMXVWDUWRGDVDVFRQ¿JXUDo}HVH[FHSWR,',20$7(032),/752
7(032/Æ030(16*),/752FRQ¿JXUDo}HV5('(HHWFSDUDDGH¿QLomRGHIiEULFD
70
Solução de problemas
Eventos que podem ser facilmente confundidos com defeitos do equipamento
6REUHRIHQ{PHQRFRQIXQGLQGRFRPGHIHLWRGHPiTXLQDYHUL¿TXHHUHVROYDGH
DFRUGRFRPDWDEHODVHJXLQWH
)HQ{PHQR
&DVRVTXHQmRHQYROYHPXPGHIHLWRGRHTXLSDPHQWR
2FDERGHDOLPHQWDomRQmRHVWiFRQHFWDGR
&RQHFWHRFDERGHDOLPHQWDomRFRUUHFWDPHQWH
$IRQWHGHDOLPHQWDomRSULQFLSDOIRLLQWHUURPSLGD
GXUDQWHDRSHUDomRWDOFRPRLQWHUUXSomRGR
IRUQHFLPHQWRGHHQHUJLDEODFNRXWHWF
'HVFRQHFWHD¿FKDGHDOLPHQWDomRGDSDUHGHHSHUPLWD
2DSDUHOKRQmR TXHRSURMHWRUUHVIULHSRUSHORPHQRVPLQXWRGH
GHSRLVOLJXHRQRYDPHQWH
OLJD
Página de
UHIHUrQFLD
12
2XQmRH[LVWHQHQKXPDOkPSDGDHRXDWDPSDGD
OHQWHRXQmRIRUDP¿[DGDVFRUUHFWDPHQWH
'HVFRQHFWHD¿FKDGHDOLPHQWDomRGDSDUHGHHSHUPLWD
TXHRSURMHWRUUHVIULHSRUSHORPHQRVPLQXWRV
'HSRLVTXHRSURMHWRUUHVIULDUDGHTXDGDPHQWHFRQ¿UPH
RHVWDGRDQH[RGDOkPSDGDHWDPSDGDOkPSDGDH
GHSRLVOLJXHRQRYDPHQWH
61
2VFDERVGHVLQDLVQmRHVWmRFRQHFWDGRVFRUUHWDPHQWH
&RQHFWHRVFDERVGHiXGLRFRUUHFWDPHQWH
10
$IRQWHGHVLQDOQmRIXQFLRQDFRUUHFWDPHQWH
'H¿QDFRUUHFWDPHQWHRGLVSRVLWLYRGHIRQWHGHVLQDODR
PHQFLRQDURPDQXDOGRGLVSRVLWLYRGHIRQWH
±
1HPVRPQHP $VFRQ¿JXUDo}HVGHWURFDGHHQWUDGDQmRFRUUHVSRQGHP
LPDJHPVmR
6HOHFFLRQHRVLQDOGHHQWUDGDHFRUULMDDVFRQ¿JXUDo}HV
HPLWLGDV
$IXQomR6835(66,0$SDUDLPDJHQVHDIXQomR
6,/(1&,$5SDUDVRQVHVWmRIXQFLRQDQGR
%/$1.HPEUDQFRH087(PXGRRX$908'2SRGHP
HVWDUDFWLYDGDV&RQVXOWHRLWHP6RPQmRpHPLWLGRH
1HQKXPDLPDJHPpH[LELGDQDSiJLQDVHJXLQWHSDUD
GHVOLJDUDVIXQo}HV6,/(1&,$5H6835(66,0$
FRQWLQXDQDSiJLQDVHJXLQWH
71
Solução de problemas
Eventos que podem ser facilmente confundidos com defeitos do equipamento (continuação)
)HQ{PHQR
&DVRVTXHQmRHQYROYHPXPGHIHLWRGRHTXLSDPHQWR
Página de
UHIHUrQFLD
2VFDERVGHVLQDLVQmRHVWmRFRQHFWDGRVFRUUHWDPHQWH
&RQHFWHRVFDERVGHiXGLRFRUUHFWDPHQWH
10
$IXQomR6,/(1&,$5HVWiIXQFLRQDQGR
5HVWDXUHRVRPSUHPLQGRRERWmR087(RX92/80(
QRFRQWUROHUHPRWR
18
2VRPQmRHVWi 2YROXPHpDMXVWDGRQXPQtYHOPXLWREDL[R
QtWLGR
$MVXWHRYROXPHQXPQtYHOPDLVDOWRFRPDIXQomRGH
18
PHQXRXQRFRQWUROHUHPRWR
DFRQ¿JXUDomR$8',2$/72)$/$17(QmRHVWi
correcta.
'H¿QDFRUUHFWDPHQWH$8',2$/72)$/$17(QRPHQX
$-867(
37
$SRUWDGDOHQWHQmRHVWiWRWDOPHQWHDEHUWD
'HVOLJXHRSURMHWRUHGHSRLVOLJXHRQRYDPHQWHSDUDVH
DVVHJXUDUGHTXHDSRUWDHVWiDEHUWDFRUUHFWDPHQWH
1HQKXPD
LPDJHPp
H[LELGD
2VFDERVGHVLQDLVQmRHVWmRFRQHFWDGRVFRUUHWDPHQWH
&RQHFWHRVFDERVGHiXGLRFRUUHFWDPHQWH
10
2EULOKRIRLDMXVWDGRQXPQtYHOH[WUHPDPHQWHEDL[R
$MXVWH%5,/+2SDUDXPQtYHOPDLVDOWRFRPDIXQomRGH
PHQX
2FRPSXWDGRUQmRSRGHGHWHFWDURSURMHWRUFRPR
um monitor tipo ligar e reproduzir.
9HUL¿TXHVHRFRPSXWDGRUSRGHGHWHFWDUXPPRQLWRUWLSR
OLJDUHUHSURGX]LUFRPRXWURGRPHVPRWLSR
11
2HFUm6835(66,0$pH[LELGR
3ULPDRERWmR%/$1.QRFRQWUROHUHPRWR
23
FRQWLQXDQDSiJLQDVHJXLQWH
72
Solução de problemas
Eventos que podem ser facilmente confundidos com defeitos do equipamento (continuação)
)HQ{PHQR
&DVRVTXHQmRHQYROYHPXPGHIHLWRGRHTXLSDPHQWR
2HFUmGHYtGHR $IXQomR3$5$'$HVWiIXQFLRQDQGR
FRQJHOD
3ULPDRERWmR)5((=(SDUUHVWDXUDURHFUmSDUDRQRUPDO
$VGH¿QLo}HVGHFRUQmRIRUDPFRUUHFWDPHQWHDMXVWDGDV
H[HFXWHRVDMXVWHVGHLPDJHPDRDOWHUDU7(03&25
$VFRUHV
GHVDSDUHFHUDP &250$7,=HRX(63&25FRPDVIXQo}HVGHPHQX
RXRWRPGH &RQ¿JXUDomRGH(63&25QmRpDGHTXDGR
FRUpSUHFiULR $OWHUHDFRQ¿JXUDomR(63&25SDUD$8725*%
6037(5(&RX5(&
$VLPDJHQV
DSDUHFHP
HVFXUD
$VLPDJHQV
DSDUHFHP
QHEXORVDV
Página de
UHIHUrQFLD
23
33
33
2EULOKRHRXRFRQWUDVWHVmRDMXVWDGRVSDUDXP
QtYHOH[WUHPDPHQWHEDL[R
$MXVWH%5,/+2HR&2175$67(SDUDXPQtYHOPDLV
DOWRFRPDIXQomRGHPHQX
$IXQomR6,/(1&,$0(HVWiIXQFLRQDQGR
6HOHFFLRQH&/$52SDUDRLWHP6,/(1&,$0(QRPHQX
$-867(
$OkPSDGDHVWiDWLQJLQGRVHXFLFORGHYLGD~WLO
6XEVWLWXLDOkPSDGD
2XRIRFRHRXDVFRQ¿JXUDo}HVGHIDVHKRUL]RQWDO
QmRIRUDPFRUUHFWDPHQWHDMXVWDGDV
$MXVWHRIRFRFRPRDQHOGHIRFRHRX)$6(+FRPD
IXQomRGHPHQX
A lente ou espelho encontram-se sujos ou
embaciados.
/LPSHDOHQWHRXHVSHOKRUHSRUWDQGRVHjVHFomR³&XLGDQGR
GRHVSHOKRHGDVOHQWHV´
66
NOTA ‡(PERUDDSDUHoDSRQWRVHVFXURVQHVWHHFUDLVWRpXPDFDUDFWHUtVWLFD
H[FOXVLYDGHHFUmVGHFULVWDLVOtTXLGRHQmRFRQVWLWXLRXLPSOLTXHHPGHIHLWRGH
PiTXLQD
73
(VSHFLÀFDo}HV
(VSHFL¿FDo}HV
(VSHFLÀFDo}HV
Item
(VSHFL¿FDo}HV
1RPHGR3URGXWR
3URMHWRUGH&ULVWDLV/tTXLGRV
7DPDQKRGR
3DLQHOGH SDLQHO
&ULVWDLV 6LVWHPDGH
/tTXLGRV GULYH
3L[HOV
FPWLSR
0DWUL]DWLYD7)7
SL[HOVKRUL]RQWDO[YHUWLFDO
/HQWHV
) I PP
/kPSDGD
:8+%
6DtGDGHiXGLR
:
)RQWHGHDOLPHQWDomR
$&9$$&9$
&RQVXPRGHHQHUJLD
:
9DULDomRGHWHPSHUDWXUD aƒ&HPIXQFLRQDPHQWR
(QWUDGDV
&20387(5,1 'VXESLQPLQL[
&20387(5,1 'VXESLQPLQL[
<&B3B&R3RYtGHRGRFRPSRQHQWH 5&$[
69,'(2PLQL',1SLQ[
9,'(2 5&$[
021,725287 'VXESLQPLQL[
$8',2,1 6WHUHRPLQL[
$8',2,1 6WHUHRPLQL[
$8',2,1/5 5&$[
$8',2287 6WHUHRPLQL[
&21752/ 'VXESLQ[
86% 86%%[
/$1 5-[
3HoDVRSFLRQDLV
/kPSDGD8QLGDGHGH)LOWUR'7
.LWGHPHVD4'
%ROVDTT100
&DVRPDFLR&$
3DUDREWHUPDLVLQIRUPDo}HVFRQWDFWHVHXIRUQHFHGRU
3HVRPDVVD
NJDSUR[LPDGDPHQWH
7DPDQKR
:[+['PP
([FOXLQGRDGLVWLQomR&RQVXOWHD¿JXUDVHJXLQWH
74
(VSHFLÀFDo}HV
(VSHFL¿FDo}HVFRQWLQXDomR
366
378
356
397
113
225
131
139
>[email protected]
75
Projetor
ED-A100/ED-A110/CP-A100W
Manual do Usuário (detalhado)
Guia de Rede
Obrigado pela compra deste projector.
Este projector tem a função de rede que fornece as seguintes características principais.
9C
ontrolo via internet
2SURMHFWRUSRGHVHUFRQWURODGRHPRQLWRUDGRFRPXPSURJUDPDGHQDYHJDGRU
GHLQWHUQHWQRVHX3&HDX[LOLiORDFRQ¿JXUDUHPDQWHURDSDUHOKR
9 Ecrã e-SHOT (transferência de imagem parada)
2SURMHFWRUSRGHH[LELULPDJHQVSDUDGDVTXHVmRWUDQVIHULGDVDWUDYpVGDUHGH
(VWHPDQXDOSUHWHQGHH[SOLFDUXQLFDPHQWHRIXQFLRQDPHQWRGD5HGH
Para obter informações sobre de segurança, as operações ou outras funções,
FRQVXOWHR*XLDGH6HJXUDQoDH0DQXDOGR8VXiULRUHVXPLGRHGHWDOKDGR
AVISO Ź$QWHVGHXVDUHVWHSURGXWRQmRGHL[HGHOHURPDQXDOIRUQHFLGR
'HSRLVGHOHUHVWHPDQXDOJXDUGHRQXPORFDOVHJXURSDUDUHIHUrQFLDIXWXUD
NOTA ‡$LQIRUPDomRQHVWHPDQXDOHVWiVXMHLWDDDOWHUDomRVHPDYLVRSUpYLR
‡2IDEULFDQWHQmRDVVXPHQHQKXPDUHVSRQVDELOLGDGHSRUTXDLVTXHUHUURVRX
RPLVV}HVQHVWHPDQXDO
• eSURLELGRUHSURGX]LUWUDQVPLWLURXFRSLDUHVWHGRFXPHQWRWRWDORX
SDUFLDOPHQWHVHPDXWRUL]DomRSUpYLDSRUHVFULWR
Reconhecimento de marca registada
‡:LQGRZVpXPDPDUFDUHJLVWDGDGD0LFURVRIW&RUSRUDWLRQ
7RGDVDVRXWUDVPDUFDVSHUWHQFHPDVHXVUHVSHFWLYRVSURSULHWiULRV
1
Conteúdo
&RQWH~GR
Conteúdo ....................................................................................... 2
1. Funções principais .................................................................... 3
&RQ¿JXUDUHFRQWURODUDWUDYpVGRQDYHJDGRUGHLQWHUQHW ........................... 3
(FUmH6+27WUDQVIHUrQFLDGHLPDJHPSDUDGD ....................................... 3
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH ................... 4
3UHSDUDomRGHHTXLSDPHQWRQHFHVViULR .................................................... 4
&RQ¿JXUDomRPDQXDOGDFRQH[mRGDUHGH ................................................. 5
&RQH[mRFRPHTXLSDPHQWRV................................................................. 5
&RQ¿JXUDo}HVGHUHGH .......................................................................... 5
&RQ¿JXUDo}HV³2So}HVGHLQWHUQHW´ ..................................................... 8
9HUL¿TXHDFRQH[mR............................................................................... 9
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW................ 10
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHW .... 11
5HJLVWDUVH .......................................................................................... 13
1HWZRUN,QIRUPDWLRQ,QIRUPDo}HVGHUHGH........................................ 14
1HWZRUN6HWWLQJV&RQ¿JXUDo}HVGHUHGH ......................................... 15
3RUW6HWWLQJV&RQ¿JXUDo}HVGHSRUWD ............................................... 17
0DLO6HWWLQJV&RQ¿JXUDo}HVGHPHQVDJHP ..................................... 18
$OHUW6HWWLQJV&RQ¿JXUDo}HVGHDOHUWD.............................................. 19
6FKHGXOH6HWWLQJV&RQ¿JXUDo}HVGHSURJUDPDomR.......................... 21
'DWH7LPH6HWWLQJV&RQ¿JXUDomRHVGHGDWDKRUD ............................ 23
6HFXULW\6HWWLQJV&RQ¿JXUDo}HVGHVHJXUDQoD ................................ 25
3URMHFWRU&RQWURO&RQWURORGRSURMHFWRU .......................................... 27
3URMHFWRU6WDWXV(VWDGRGHSURMHFWRU .............................................. 30
1HWZRUN5HVWDUW5HLQLFLDUUHGH ....................................................... 31
/RJRII6DLU....................................................................................... 31
$OHUWDVGHHPDLOV ..................................................................................... 32
*HVWmRGHSURMHFWRUFRPR6103 ............................................................ 34
3URJUDPDomRGHHYHQWR............................................................................ 35
(FUmH6+27WUDQVIHUrQFLDGHLPDJHPSDUDGD ..................................... 38
&RQWURORGHFRPDQGRDWUDYpVGDUHGH...................................................... 40
2
1. Funções principais
1. Funções principais
&RQÀJXUDUHFRQWURODUDWUDYpVGRQDYHJDGRUGHLQWHUQHW
3RGHDMXVWDURXFRQFRQWURODURSURMHFWRUDWUDYpVGHXPDUHGHGHXPQDYHJDGRU
YLDZHEGHXP3&TXHHVWiFRQHFWDGRQDPHVPDUHGH
5HJLVWHVHQDUHGHGRQDYHJDGRUZHESDUDDFHGHURVPHQXVHFRQ¿JXUDUDV
GH¿QLo}HVGHUHGHPRQLWRUDURSURMHFWRUHDVVLPSRUGLDQWH
(FUmH6+27WUDQVIHUrQFLDGHLPDJHPSDUDGD
2VDUTXLYRVGHLPDJHQVSRGHPVHUHQYLDGRVDWUDYpVGDUHGHSRGHQGRVHU
DUPD]HQDGRVQRSURMHFWRUDWpDUTXLYRVGHLPDJHPHH[LELGRVQDWHODXPDXP38
7UDQVIHULU¿FKHLUR
de imagem
0RVWUDUDUTXLYRGHLPDJHP 1 4 3
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH
&RQH[mRGHHTXLSDPHQWRHFRQ¿JXUDomRGHUHGH
2.1 Preparação de equipamento necessário
2VVHJXLQWHVHTXLSDPHQWRVVmRQHFHVViULRVSDUDFRQHFWDURSURMHFWRUQRVHX3&
DWUDYpVGDUHGH
3&HTXLSDGRFRPDIXQomRGHUHGH
LQVWDODGRXPVRIWZDUHZHEEURZVHU11
&DER/$1&$7RXVXSHULRU
4
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH
&RQÀJXUDomRPDQXDOGDFRQH[mRGDUHGH
2.2.1 Conexão com equipamentos
&RQHFWHRSURMHFWRUH3&FRPXPFDER/$1
$QWHVGHFRQHFWDUXPDUHGHH[LVWHQWHFRQWDFWHRDGPLQVWUDGRUGHUHGH
$VHJXLUYHUL¿TXHDFRQ¿JXUDomRGH3&FRQIRUPHDEDL[R
&RQÀJXUDo}HVGHUHGH
,VWRpXPDH[SOLFDomRGDVFRQ¿JXUDo}HVGHFRQH[mRFRPDUHGHSDUDR:LQGRZV
;3HR,QWHUQHW([SORUHU
5HJLVWHVHQR:LQGRZV;3FRPRDGPLQLVWUDGRU
$EUDR³3DLQHOGH&RQWUROR´GRPHQX³,QLFLDU´
$EUD³/LJDo}HVGHUHGHHGH,QWHUQHW´QR³3DLQHOGH&RQWUROR´)LJD
$GPLQLVWUDGRUpDFRQWDTXHSRGHDFHGHUDWRGDVDVIXQo}HV
)LJD-DQHOD³/LJDo}HVGHUHGHHGH,QWHUQHW´
$EUD³/LJDo}HVGHUHGH´)LJE
)LJE-DQHOD³/LJDo}HVGHUHGH´
5
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH
&RQ¿JXUDomRPDQXDOGDFRQH[mRGDUHGHFRQWLQXDomR
$EUDDMDQHOD³3URSULHGDGHVGH/LJDomRiUHDORFDO´TXHXVDSDUDVHX
GLVSRVLWLYRGHUHGH)LJF
)LJF-DQHOD³3URSULHGDGHVGH/LJDomRGHiUHDORFDO´
'H¿QDSURWRFRORXVDGRFRPR³7&3,3´HDEUDDMDQHOD³3URSULHGDGHVGH7&3
,33URWRFROR,QWHUQHW´
)LJG-DQHOD³3URSULHGDGHVGH7&3,33URWRFROR,QWHUQHW´
'H¿QDRHQGHUHoR,3PiVFDUDGHVXEUHGHHJDWHZD\SDGUmRSDUD3&
6
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH
&RQ¿JXUDomRPDQXDOGDFRQH[mRGDUHGHFRQWLQXDomR
[Sobre o endereço IP]
Ŷ&RQ¿JXUDUPDQXDOPHQWH
$SDUWHGRHQGHUHoRGHUHGHLQFOXLGRQRHQGHUHoR,3GH¿QLGRQRVHX3&GHYH
VHUVLPLODUDGRSURMHFWRU(RHQGHUHoR,3LQWHLURQR3&QmRGHYHVHUVREUHSRVWR
FRPRXWURVHTXLSDPHQWRVGDPHVPDUHGHLQFOXLQGRRSURMHFWRU
3RUH[HPSOR
$VFRQ¿JXUDo}HVLQLFLDLVGRSURMHFWRUVmRFRQIRUPHDVHJXLU
(QGHUHoR,3
0iVFDUDGHVXEUHGH
(QGHUHoRGHUHGHQHVWHFDVR
&RQWXGRHVSHFL¿TXHRHQGHUHoR,3GR3&FRQIRUPHDVHJXLU
(QGHUHoR,3[[[[[[VKRZVGHFLPDOQXPEHU
0iVFDUDGHVXEUHGH
(QGHUHoRGHUHGHQHVWHFDVR
6HOHFFLRQHGHDSDUD³[[[´QmRGXSOLFDUFRPTXDLVTXHURXWURV
equipamentos.
1HVWHFDVRRSURMHFWRUXVDRHQGHUHoR,3³´HHVSHFL¿TXHGHD
H[FHSWRSDUD3&
NOTA ‡³´QmRSRGHVHUGH¿QLGRSDUDRHQGHUHoR,3
‡2HQGHUHoR,3GRSURMHFWRUSRGHVHUDOWHUDGRXVDQGRRXWLOLWiULRGH
FRQ¿JXUDomRDWUDYpVGRQDYHJDGRUGHLQWHUQHW11
‡6HRSURMHFWRUHR3&H[LVWLUHPQDPHVPDUHGHH[HQGHUHoRGHUHGHp
VLPLODURJDWHZD\SDGUmRSRGH¿FDUHPEUDQFR
‡4XDQGRRSURMHFWRUH3&H[LVWLUHPHPUHGHVGLIHUHQWHVDFRQ¿JXUDomR
JDWHZD\SDGUmRpQHFHVViULD&RQWDFWHRDGPLQLVWUDGRUGHUHGHSDUDREWHU
GHWDOKHV
Ŷ&RQ¿JXUDUDXWRPDWLFDPHQWH
4XDQGRRVHUYLGRU'+&3H[LVWLUQDUHGHpSRVVtYHODWULEXLUXPHQGHUHoR,3SDUD
RSURMHFWRUH3&DXWRPDWLFDPHQWH
'+&3pDDEUHYLDomRSDUD³'\QDPLF+RVW&RQ¿JXUDWLRQ3URWRFRO´HWHPD
IXQomRGHIRUQHFHUDFRQ¿JXUDomRSDUDDUHGHFRPRRHQGHUHoR,3GRVHUYLGRU
SDUDRFOLHQWH8PVHUYLGRUTXHWHPDIXQomR'+&3pFKDPDGRGHVHUYLGRU
'+&3
7
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH
&RQ¿JXUDomRPDQXDOGDFRQH[mRGDUHGHFRQWLQXDomR
&RQÀJXUDo}HV´2So}HVGHLQWHUQHWµ
&OLTXHHP³2So}HVGD,QWHUQHW´QDMDQHOD³/LJDo}HVGHUHGHHGH,QWHUQHW´)LJ
DSDUDDEULUDMDQHOD³3URSULHGDGHVGH,QWHUQHW´)LJE
&OLTXH
)LJD-DQHOD³/LJDo}HVGHUHGHHGH,QWHUQHW´
&OLTXH
)LJE-DQHOD³3URSULHGDGHVGH,QWHUQHW´
&OLTXHQRVHSDUDGRU³/LJDo}HV´HGHSRLVFOLTXHQRERWmR>'H¿QLo}HVGH/[email protected]
SDUDDEULUDV³'H¿QLo}HVGHUHGHORFDO´)LJF
8
&RQH[mRGHHTXLSDPHQWRHFRQÀJXUDomRGHUHGH
&RQ¿JXUDomRPDQXDOGDFRQH[mRGDUHGHFRQWLQXDomR
)LJF-DQHOD³'H¿QLo}HVGHUHGHORFDO´
'HVPDUTXHWRGDVDVFDL[DVGDMDQHOD³'H¿QLo}HVGHUHGHORFDO´)LJF
9HULÀTXHDFRQH[mR
9HUL¿TXHVHR3&HRSURMHFWRUHVWmRFRQHFWDGRVFRUUHFWDPHQWHDTXL6HQmRHVWLYHU
FRQHFWDGRYHUL¿TXHVHDVFRQ¿JXUDo}HVHFRQH[}HVGHFDERHVWmRFRUUHFWDV
/DQoHRQDYHJDGRUQR3&HHVSHFL¿TXHDVHJXLQWH85/HGHSRLVFOLTXHQRERWmR³,U
SDUD´
85/KWWS(QGHUHoRGH,3GRSURMHFWRU
3RUH[HPSORVHRHQGHUHoR,3GRSURMHFWRUIRUHVSHFL¿TXH
85/KWWS
6HDSDUHFHUD¿JDSDUHFHDFRQH[mRIRLEHPVXFHGLGD
)LJ³0HQX5HJLVWR´
9
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
(VWHSURMHFWRUpHTXLSDGRFRPDVVHJXLQWHVIXQo}HVGHUHGHXVDQGRXP
SURJUDPDGHQDYHJDGRUGHUHGH
&RQÀJXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHW
3RGHDOWHUDUDVFRQ¿JXUDo}HVRXFRQWURODURSURMHFWRUDWUDYpVGHXPDUHGHDR
XVDUXPQDYHJDGRUYLDZHEGHXP3&TXHHVWiFRQHFWDGRQDPHVPDUHGH
11
Alertas de e-mails
2SURMHFWRUSRGHHQYLDUDXWRPDWLFDPHQWHXPDOHUWDSDUDRVHQGHUHoRVGHHPDLO
HVSHFL¿FDGRTXDQGRIRUQHFHVViULRID]HUDVXDPDQXWHQomRRXRFRUUHUXPHUUR
32
Gestão de projector com o SNMP
(VWHSURMHFWRUpFRPSDWtYHOFRP6103SURWRFRORGHJHVWmRGHUHGHVLPSOHV
SHUPLWLQGRPRQLWRUiORGHXPORFDOUHPRWRFRPXPSURJUDPD6103$OpPGLVVR
RSURMHFWRUSRGHHQYLDUDOHUWDVGHDYLVRHIDOKDSDUDXP3&HVSHFt¿FR
34
3URJUDPDomRGHHYHQWR
3RGHSURJUDPDURSURMHFWRUSDUDH[HFXWDUGLYHUVDVIXQo}HVGHDFRUGRFRPDV
datas e hora.
35
(FUmH6+27WUDQVIHUrQFLDGHLPDJHPSDUDGD
2SURMHFWRUSRGHH[LELULPDJHQVSDUDGDVTXHVmRWUDQVIHULGDVDWUDYpVGDUHGH
38
&RQWURORGHFRPDQGRDWUDYpVGDUHGH
2SURMHFWRUSRGHVHUFRQWURODGRFRPRVFRPDQGRV56&QDLQWHUQHW
40
10
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
&RQÀJXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXP
QDYHJDGRUGHLQWHUQHW
3RGHDMXVWDURXFRQFRQWURODURSURMHFWRUDWUDYpVGHXPDUHGHGHXPQDYHJDGRU
YLDZHEGHXP3&TXHHVWiFRQHFWDGRQDPHVPDUHGH
NOTA ‡8VHR,QWHUQHW([SORUHURXXPDYHUVmRPDLVDYDQoDGD
‡6HR-DYD6FULSWIRUGHVDFWLYDGRQDVXDFRQ¿JXUDomRGHQDYHJDGRUYLDZHE
GHYHDFWLYDUR-DYD6FULSWSDUDXVDUDVSiJLQDVZHEGRSURMHFWRU&RQVXOWH
RV¿FKHLURVGHDMXGDGHVHXQDYHJDGRUYLDZHESDUDREWHUGHWDOKHVGHFRPR
DFWLYDU-DYD6FULSW
‡eSRVVtYHOFRPXQLFDUVHXVDQGR66/6HFXUH6RFNHW/D\HUVHYRFrHVWLYHU
XVDQGR:LQGRZV;36HUYLFH3DFNRXYHUV}HVDQWHULRUHVGR0LFURVRIW
:LQGRZV3RUIDYRUHVSHFL¿TXH³KWWSV´DRGLJLWDURHQGHUHoR,3GRSURMHFWRU
QRZHEEURZVHU1mRpSRVVtYHOFRPXQLFDUHVWHSURMHFWRUXVDQGR66/QR
Windows Vista.
‡5HFRPHQGDVHTXHDVDVDFWXDOL]Do}HVGRVQDYHJDGRUHVYLDLQWHUQHWVHMDP
LQVWDODGDV5HFRPHQGDVHHVSHFLDOPHQWHTXHWRGRVRVXWLOL]DGRUHVTXHXVDP
R,QWHUQHW([SORUHUQDYHUVmRGR0LFURVRIW:LQGRZVDQWHVGR:LQGRZV;3
6HUYLFH3DFNLQVWDOHDDFWXDOL]DomRGHVHJXUDQoD406RXD
LQWHUIDFHGRQDYHJDGRUGHLQWHUQHWQmRSRGHVHUH[LELGDFRUUHFWDPHQWH
(DRXVDUXPDYHUVmRDQWLJDGR,QWHUQHW([SORUHUGXUDQWHDVRSHUDo}HVR
QDYHJDGRUVHUiGHVFRQHFWDGRDSyVVHJXQGRV
11
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
$RFRQ¿JXUDURXFRQWURODURSURMHFWRUDWUDYpVGRQDYHJDGRUYLDZHEpQHFHVViULR
XPD,'RXSDODYUDFKDYH([LVWHPGRLVWLSRVGH,'XPDGHDGPLQVWUDGRUHRXWUD
GHXWLOL]DGRU
2JUi¿FRVHJXLQWHGHVFUHYHDVGLIHUHQoDVHQWUHDV,'GHDGPLQVLWUDGRUH
XWLOL]DGRU
Item
Descrição
$GPLQLVWUDGRU
Utilizador
1HWZRUN,QIRUPDWLRQ
([LEHDVFRQ¿JXUDo}HVDFWXDLV
da rede do projector.
¥
¥
1HWZRUN6HWWLQJV
([LEHHGH¿QHDVFRQ¿JXUDo}HV
de rede.
¥
1$
Port Settings
([LEHHGH¿QHDVFRQ¿JXUDo}HV
da porta de comunicação.
¥
1$
Mail Settings
([LEHHFRQ¿JXUDUDVGH¿QLo}HV
GHHQGHUHoRGHHPDLO
¥
1$
$OHUW6HWWLQJV
0RVWUDHFRQ¿JXUDRVLWHQVGRV
DOHUWDVGHIDOKDVHDYLVRV
¥
1$
6FKHGXOH6HWWLQJV
([LEHHGH¿QHDVFRQ¿JXUDo}HV
de programação.
¥
1$
Date/Time Settings
([LEHHFRQ¿JXUDDVGH¿QLo}HV
de data e hora.
¥
1$
6HFXULW\6HWWLQJV
([LEHHFRQ¿JXUDDVSDODYUDV
FKDYHVHRXWUDVFRQ¿JXUDo}HV
de segurança.
¥
1$
Projector Control
&RQWURODRSURMHFWRU
¥
¥
3URMHFWRU6WDWXV
([LEHHFRQ¿JXUDRHVWDGR
DFWXDOGRSURMHFWRU
¥
¥
1HWZRUN5HVWDUW
5HLQLFLDDFRQH[mRGHUHGHGR
projector.
¥
1$
12
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
5HJLVWDUVH
&RQVXOWHRVHJXLQWHSDUDFRQ¿JXUDURXFRQWURODURSURMHFWRUFRPRQDYHJDGRUGHLQWHUQHW
Exemplo6HRHQGHUHoR,3GRSURMHFWRUIRUGH¿QLGRSDUD192.168.1.10
,QWURGX]LU“http://192.168.1.10/” na barra de
HQGHUHoRGRQDYHJDGRUGHLQWHUQHWHSULPD
DWHFOD³(QWHU´RXFOLTXHQRERWmR³,USDUD´
2HFUmGD¿JVHUiPRVWUDGR
,QWURGX]DVXD,'HSDODYUDFKDYHHFOLTXH
em >/[email protected]
)LJD³0HQXGHUHJLVWR´
$EDL[RGHVFUHYHPRVDVFRQ¿JXUDo}HVSDGU}HVGHIiEULFDSDUDD,'HSDODYUD
FKDYHGHDGPLQLVWUDGRU
Item
ID
Palavra-chave
$GPLQLVWUDGRU
$GPLQLVWUDWRU
<em branco>
8WLOL]DGRU
8VHU
<em branco>
6HRUHJLVWRIRUEHPVXFHGLGRRXRHFUmGD¿JERX¿JFVHUiH[LELGR
0HQXSULQFLSDO
)LJE³5HJLVWDUVHFRPD,'GH
DGPLQLVWUDGRU´
0HQXSULQFLSDO
)LJF³5HJLVWDUVHFRPD,'GH
XWLOL]DGRU´
&OLTXHQDRSHUDomRRXLWHPGHFRQ¿JXUDomRSUHWHQGLGRQRPHQXSULQFLSDO
ORFDOL]DGRjHVTXHUGDGRHFUm
13
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
3.1.2 Network Information (Informações de rede)
7RGRVRVGHVHQKRVGRHFUmQHVWHPDQXDOVmR
PRVWUDGRVTXDQGRUHJLVWDVHFRPD,'GH
administrador.
4XDLVTXHUIXQo}HVTXHHVWmRGLVSRQtYHLVSDUD
o administrador não serão mostradas quando
UHJLVWDUVHFRPD,'GHXWLOL]DGRU&RQVXOWHD
WDEHOD13
([LEHDVFRQ¿JXUDo}HVDFWXDLVGDUHGHGRSURMHFWRU
Item
Descrição
3URMHFWRU1DPH
([LEHDVFRQ¿JXUDo}HVGRQRPHGHSURMHFWRU
DHCP
([LEHDVGH¿QLo}HVGDFRQ¿JXUDomR'+&3
,3$GGUHVV
([LEHRHQGHUHoR,3DFWXDO
6XEQHW0DVN
([LEHDPiVFDUDGHVXEUHGH
'HIDXOW*DWHZD\
([LEHRJDWHZD\SDGUmR
0$&$GGUHVV
([LEHRHQGHUHoRHWKHUQHW0$&
)LUPZDUH'DWH
([LEHDLPSUHVVmRGDKRUDGR¿UPZDUHGDUHGH(VWD
LQIRUPDo}HVpVRPHQWHH[LELGDDRUHJLVWDUVHFRPXPD,'
de administrador.
)LUPZDUH9HUVLRQ
([LEHRQ~PHURGDYHUVmRGH¿UPZDUHGDUHGH(VWD
LQIRUPDo}HVpVRPHQWHH[LELGDDRUHJLVWDUVHFRPXPD,'
de administrador.
14
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
1HWZRUN6HWWLQJV&RQÀJXUDo}HVGHUHGH
([LEHHGH¿QHDVFRQ¿JXUDo}HVGHUHGH
Item
,3&RQ¿JXUDWLRQ
Descrição
&RQ¿JXUHDVGH¿QLo}HVGHUHGH
'+&321
$FWLYDU'+&3
DHCP OFF
'HVDFWLYDU'+&3
,3$GGUHVV
&RQ¿JXUDRHQGHUHoR,3DRGHVDFWLYDU'+&3
6XEQHW0DVN
&RQ¿JXUDDPiVFDUDGHVXEUHGHDRGHVDFWLYDU'+&3
'HIDXOW*DWHZD\
&RQ¿JXUDRJDWHZD\SDGUmRDRGHVDFWLYDU'+&3
3URMHFWRU1DPH
&RQ¿JXUDRQRPHGRSURMHFWRU
2WDPDQKRGRQRPHGRSURMHFWRUSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV6RPHQWHRVVHJXLQWHVDOIDEHWRVQ~PHURVH
VtPERORVSRGHPVHUXVDGRV
!"#>[email protected]^_`a
e espaço
V\V/RFDWLRQ6103
&RQ¿JXUDRORFDODVHUPHQFLRQDGRDRXVDUR6103
2WDPDQKRGRV\VORFDWLRQSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV6RPHQWHRVQ~PHURVµ¶HDOIDEHWRµD]¶
µ$=¶SRGHPVHUXVDGRV
V\V&RQWDFW6103
&RQ¿JXUDDLQIRUPDomRGHFRQWDFWRDVHUPHQFLRQDGDDR
XVDUR6103
2WDPDQKRGRV\V&RQWDFWSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV6RPHQWHRVQ~PHURVµ¶HDOIDEHWRµD]¶
µ$=¶SRGHPVHUXVDGRV
'166HUYHU$GGUHVV
&RQ¿JXUDRHQGHUHoRGHVHUYLGRU'16
&OLTXH>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
15
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
NOTA ‡$VQRYDVFRQ¿JXUDo}HVVmRDFWLYDGDVGHSRLVGHUHLQLFLDUDFRQH[mR
FRPDUHGH$RDOWHUDUDVFRQ¿JXUDo}HVUHLQLFLHDFRQH[mRFRPDUHGH3RGH
UHLQLFLDUDFRQH[mRFRPDUHGHDRFOLFDUHP>[email protected] menu
SULQFLSDO
‡6HFRQHFWDURSURMHFWRUFRPXPDUHGHH[LVWHQWHFRQVXOWHRDGPLQLVWUDGRUGH
UHGHDQWHVGHGH¿QLURVHQGHUHoRVGHVHUYLGRU
16
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
3RUW6HWWLQJV&RQÀJXUDo}HVGHSRUWD
([LEHHGH¿QHDVFRQ¿JXUDo}HVGDSRUWDGHFRPXQLFDomR
Item
1HWZRUN&RQWURO3RUW
(Port:23)
Descrição
&RQ¿JXUDDSRUWDGHFRQWURORGHFRPDQGR3RUWD
Port open
&OLTXH[Enable] para usar a porta 23.
$XWKHQWLFDWLRQ
&OLTXH[Enable] TXDQGRDDXWHQWLFDomRIRUQHFHVViULDSDUD
esta porta.
1HWZRUN&RQWURO3RUW
(Port:9715)
&RQ¿JXDDSRUWDGHFRQWURORGHFRPDQGR3RUWD
Port open
&OLTXH[Enable] para usar a porta 9715.
$XWKHQWLFDWLRQ
&OLTXH[Enable] TXDQGRDDXWHQWLFDomRIRUQHFHVViULDSDUD
esta porta.
Image Transfer Port
(Port:9716)
&RQ¿JXUDDSRUWDSDUDDWUDQVIHUrQFLDGHLPDJHQV
3RUWD
Port open
&OLTXHHP[Enable] QDFDL[DGHYHUL¿FDomRSDUDXVDUDSRUWD
$XWKHQWLFDWLRQ
&OLTXHHP[Enable] QDFDL[DGHYHUL¿FDomRTXDQGRp
QHFHVViULDDXWHQWLFDomRSDUDHVWDSRUWD
61033RUW
&RQ¿JXUDDSRUWD6103
Port open
&OLTXH[Enable] SDUDXVDUR6103
Trap address
&RQ¿JXUDRGHVWLQRGDLQWHUUUXSomR6103QRIRUPDWR,3
SMTP Port
Port open
&RQ¿JXUDDSRUWD6073
&OLTXH[Enable] SDUDXVDUDIXQomRGHHPDLO
&OLTXH>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA • $VQRYDVGH¿QLo}HVGHFRQ¿JXUDomRVHUmRDFWLYDGDVDSyVR
UHVWDEHOHFLPHQWRGDOLJDomRjUHGH4XDQGRDVGH¿QLo}HVGHFRQ¿JXUDomRVmR
PRGL¿FDGDVDOLJDomRjUHGHGHYHVHUUHVWDEHOHFLGD2UHVWDEHOHFLPHQWRGD
OLJDomRjUHGHpHIHFWXDGRDRFOLFDUHP>[email protected]
17
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
0DLO6HWWLQJV&RQÀJXUDo}HVGHPHQVDJHP
([LEHHFRQ¿JXUDUDVGH¿QLo}HVGHHQGHUHoRGHHPDLO
Item
Descrição
Send mail
&OLTXHQDFDL[DGHVHOHFomR[Enable] para usar a função de
HPDLO&RQ¿JXUHDVFRQGLo}HVSDUDHQYLDURHPDLOVRE$OHUW
6HWWLQJV
60736HUYHU,3$GGUHVV
&RQ¿JXUHRHQGHUHoRGHVHUYLGRUGHPHQVDJHPQRIRUPDWR,3
• O endereço não permite somente o endereço IP, mas
WDPEpPRQRPHVHRVHUYLGRU'16YiOLGRSRUFRQ¿JXUDGR
em &RQ¿JXUDo}HVGHUHGH2WDPDQKRPi[LPRGHKRVWRX
QRPHGHGRPtQLRpGHDWpFDUDFWHUHV
Sender E-mail address
&RQ¿JXUDRHQGHUHoRGHHPDLOGRUHPHQWHQWH
2WDPDQKRGRHQGHUHoRGHHPDLOGRUHPHQWHQWHSRGHVHU
GHDWpFDUDFWHUHVDOIDQXPpULFRV
&RQ¿JXUHRHQGHUHoRGHHPDLOGHDWpFLQFRUHFLSLHQWHV
3RGHHVSHFL¿FDUWDPEpP[TO] ou [CC] para cada endereço.
Recipient E-mail address
2WDPDQKRGRHQGHUHoRGHHPDLOGRUHFLSLHQWHSRGHVHUGH
DWpFDUDFWHUHVDOIDQXPpULFRV
&OLTXH>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡3RGHFRQ¿UPDUVHDVFRQ¿JXUDo}HVGHPHQVDJHQIXQFLRQDP
correctamente com [Send Test Mail]$FWLYHDFRQ¿JXUDomR(QYLDUPHQVDJHP
DQWHVGHFOLFDUHP [Send Test Mail].
‡6HFRQHFWDURSURMHFWRUFRPXPDUHGHH[LVWHQWHFRQVXOWHRDGPLQLVWUDGRUGH
UHGHDQWHVGHGH¿QLURVHQGHUHoRVGHVHUYLGRU
18
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
$OHUW6HWWLQJV&RQÀJXUDo}HVGHDOHUWD
0RVWUDHFRQ¿JXUDRVLWHQVGRVDOHUWDVGHIDOKDVHDYLVRV
Item de alerta
Descrição
Cover Error
$WDPSDGDOkPSDGDQmRIRLFRUUHFWDPHQWH¿[DGD
Fan Error
2YHQWLODGRUGHUHVIULDPHQWRQmRHVWiIXQFLRQDQGR
/DPS(UURU
$OkPSDGDQmRDFHQGHHH[LVWHDSRVVtELOLGDGHGHTXHD
SDUWHLQWHUQD¿FRXTXHQWH
Temp Error
([LVWHDSRVVLELOLGDGHGHTXHDSDUWHLQWHUQDHVWHMDTXHQWH
/HQV'RRU(UURU
$SRUWDGDOHQWHQmRHVWiDEHUWDRXIHFKDGDGHYLGDPHQWH
$LU)ORZ(UURU
$WHPSHUDWXUDLQWHUQDHVWiVXELQGR
/DPS7LPH(UURU
7HPSRGDOkPSDGDIRLH[FHGLGR
Cold Error
([LVWHDSRVVLELOLGDGHGHTXHDSDUWHLQWHUQDHVWHMDVXSHU
resfriada.
Filter Error
7HPSRGR¿OWURH[FHGLGR
Other Error
Other error.
6HH[LELUHVWHHUURFRQWDFWHVHXIRUQHFHGRU
6FKHGXOH([HFXWLRQ
Error
6FKHGXOH([HFXWLRQHUURU21
/DPS7LPH$ODUP
&RQ¿JXUDomRGHDODUPHGHWHPSRH[FHGLGRGDOkPSDGD
)LOWHU7LPH$ODUP
&RQ¿JXUDomRGHDODUPHGHWHPSRH[FHGLGRGR¿OWUR
Transition Detector
$ODUP
$ODUPHGHGHWHFWRUGHWUDQVLomR 0HQX23&$2QR
0DQXDOGR8VXiULRGHWDOKDGR*XLDGH8WLOL]DomR
³&+$1*(7+(/$03´LV
³&+$1*(7+(/$03´HVWiYLVXDOL]DGR
GLVSOD\HG
Cold Start
The Power switch is turned on.
2IIĺVWDQGE\PRGH
$XWKHQWLFDWLRQ)DLOXUH
2DFHVVR6103pGHWHFWDGRGDFRPXQLGDGH6103LQYiOLGD
&RQVXOWHR³6ROXomRGHSUREOHPDV´QR0DQXDOGR8VXiULRGHWDOKDGR
*XLDGH8WLOL]DomRSDUDREWHUPDLVGHWDOKHVVREUHIDOKDVHHUURGHH[HFXomRGH
programação.
19
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
2VLWHQVGHDOHUWDVmRPRVWUDGRVDEDL[R
,WHPGHFRQ¿JXUDomR
Descrição
$ODUP7LPH
&RQ¿JXUHDKRUDSDUDDOHUWDU
6RPHQWHWHPSRGHOkPSDGDDODUPHHDODUPHGHWHPSRGH
¿OWUR
61037UDS
&OLTXH[Enable] SDUDDFWLYDUDOHUWDVGHUHWHQomRGH6103
Send Mail
&OLTXH[Enable] SDUDDFWLYDURVDOHUWDVGHPHQVDJHP
([FHSWRInício frio e(UURGHDXWHQWLFDomR
0DLO6XEMHFW
&RQ¿JXUDDOLQKDGHDVVXQWRGDPHQVDJHPDVHUHQYLDGD
2WDPDQKRGRV\V&RQWDFWSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV
([FHSWRInício frio e(UURGHDXWHQWLFDomR
Mail Text
&RQ¿JXUDRWH[WRGDPHQVDJHPDVHUHQYLDGD
2WDPDQKRGRV\V&RQWDFWSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV
([FHSWRInício frio e(UURGHDXWHQWLFDomR
&OLTXH>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡$PHQVDJHPGHHUURGRGLVSDUDGRUGHHUURGH¿OWURGHSHQGHGD
FRQ¿JXUDomRGH0(16*),/752QRLWHP6(59,d2GRPHQX23&$2
TXHGH¿QHRSHUtRGRDWpTXHDPHQVDJHPGH¿OWURVHMDH[LELGDQRHFUmGR
SURMHFMHFWRUVFUHHQ$PHQVDJHPVHUiHQYLDGDTXDQGRRWHPSRUL]DGRUGR
¿OWURH[FHGHURXKRUDVFRPEDVHQD
FRQ¿JXUDomRIHLWD1HQKXPDQRWL¿FDomRVHUiHQYLDGDSRUFRUUHLRHOHFWUyQLFR
VH0(16*),/752HVWLYHUFRQ¿JXUDGDSDUD'(6/,*$50HQX23&$2 no
0DQXDOGR8VXiULRGHWDOKDGR*XLDGH8WLOL]DomR
‡2DODUPHGHWHPSRGDOkPSDGDpGH¿QLGRFRPRXPOLPLWHSDUDDQRWL¿FDomR
GHPHQVDJHPOHPEUHWHWHPSRUL]DGRUGHOkPSDGD4XDQGRDKRUDGD
OkPSDGDH[FHGHUHVWHOLPLWHTXHpFRQ¿JXUDGRDWUDYpVGDSiJLQDGHLQWHUQHWH
DPHQVDJHPVHUiHQYLDGD
‡2DODUPHGHWHPSRGR¿OWURpGH¿QLGRFRPRXPOLPLWHSDUDDQRWL¿FDomR
GHPHQVDJHPOHPEUHWHWHPSRUL]DGRUGHOkPSDGD4XDQGRDKRUDGR¿OWUR
H[FHGHUROLPLWHDPHQVDJHPVHUiHQYLDGD
20
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
6FKHGXOH6HWWLQJV&RQÀJXUDo}HVGHSURJUDPDomR
([LEHHGH¿QHDVFRQ¿JXUDo}HVGHSURJUDPDomR
Item
Descrição
'DLO\
&RQ¿JXUDDSURJUDPDomRGLiULD
6XQGD\
&RQ¿JXUDDSURJUDPDomRGRPLQLFDO
0RQGD\
&RQ¿JXUDDSURJUDPDomRGHVHJXQGDIHLUD
7XHVGD\
&RQ¿JXUDDSURJUDPDomRGHWHUoDIHLUD
:HGQHVGD\
&RQ¿JXUDDSURJUDPDomRGHTXDUWDIHLUD
7KXUVGD\
&RQ¿JXUDDSURJUDPDomRGHTXLQWDIHLUD
)ULGD\
&RQ¿JXUDDSURJUDPDomRGHVH[WDIHLUD
6DWXUGD\
&RQ¿JXUDDSURJUDPDomRGHViEDGR
6SHFL¿FGDWH1R
&RQ¿JXUDSURJUDPDomRGDGDWDHVSHFt¿FDQž
6SHFL¿FGDWH1R
&RQ¿JXUDSURJUDPDomRGDGDWDHVSHFt¿FDQž
6SHFL¿FGDWH1R
&RQ¿JXUDSURJUDPDomRGDGDWDHVSHFt¿FDQž
6SHFL¿FGDWH1R
&RQ¿JXUDSURJUDPDomRGDGDWDHVSHFt¿FDQž
6SHFL¿FGDWH1R
&RQ¿JXUDSURJUDPDomRGDGDWDHVSHFt¿FDQž
21
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
2VLWHQVGHHYHQWRGLiULRHVHPDQDOVmRPRVWUDGRVDEDL[R
Item
Descrição diária e semanal
6FKHGXOH
&OLTXH[Enable] SDUDDFWLYDUDSURJUDPDomR
6FKHGXOH/LVW
([LEHDSURJUDPDomRDFWXDO
2VLWHQVGHHYHQWRGHGDWDHVSHFt¿FDVmRPRVWUDGRVDEDL[R
Item
'HVFULomRHVSHFt¿FDGDGDWD1ž
6FKHGXOH
&OLTXH[Enable] QDFDL[DGHVHOHFomRSDUDDFWLYDUD
SURJUDPDomRGDGDWDHVSHFt¿FD1ž
'DWH0RQWK'D\
&RQ¿JXUHRVPrVHGDWD
6FKHGXOH/LVW
([LEHDSURJUDPDomRGDGDWDHVSHFt¿FDDFWXDO1ž
&OLTXH>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
3DUDDGLFLRQDUDVIXQo}HVHHYHQWRVFOLTXHQRERWmR>[email protected]¿QDRVVHJXLQWHV
itens.
Item
Descrição
Time
&RQ¿JXUDDKRUDSDUDH[HFXWDURVFRPDQGRV
Command
[Parameter]
&RQ¿JXUDRFRPDQGRTXHGHYHVHUH[HFXWDGR
3RZHU
&RQ¿JXUDRVSDUkPHWURVSDUDRFRQWURORGHDOLPHQWDomR
,QSXW6RXUFH
&RQ¿JXUDRVSDUkPHWURVSDUDDOWHUQDUHQWUDGD
'LVSOD\,PDJH
&RQ¿JXUDRVSDUkPHWURVSDUDH[LELURVGDGRVGHLPDJHPGH
WUDQVIHUrQFLD
&OLTXHQRERWmR [Register] SDUDDGLFLRQDUQRYRVFRPDQGRVQD6FKHGXOH/LVW
&OLTXHQRERWmR [Delete]SDUDSDJDURVFRPDQGRVGD6FKHGXOH/LVW
&OLTXH[Reset] SDUDDSDJDURVFRPDQGRVGD6FKHGXOH/LVW
NOTA ‡$SyVRSURMHFWRUVHUPRYLGRYHUL¿TXHDGDWDHDKRUDGH¿QLGDSDUD
RSURMHFWRUDQWHVGHFRQ¿JXUDUDVDJHQGDV8PIRUWHFKRTXHSRGHID]HUFRP
TXHDVFRQ¿JXUDo}HVGHGDWDHKRUD23VDLDPGHVLQWRQLD
22
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
'DWH7LPH6HWWLQJV&RQÀJXUDomRHVGHGDWDKRUD
([LEHHFRQ¿JXUDDVGH¿QLo}HVGHGDWDHKRUD
Item
Descrição
&XUUHQW'DWH
&RQ¿JXUDDGDWDDFWXDOQRdia/mês/ano.
&XUUHQW7LPH
&RQ¿JXUDDKRUDDFWXDOQRIRUPDWRKRUDPLQXWRVHJXQGR.
'D\OLJKW6DYLQJV7LPH
&OLTXH>[email protected]¿QLURVLWHQV
seguintes.
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGDGDWDHKRUD
começa.
Start
Month
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGRPrVFRPHoD
a
:HHN
&RQ¿JXUDDVHPDQDHPTXHRIXVRKRUiULRGRPrVFRPHoD
)LUVW/DVW
'D\
&RQ¿JXUDRGLDGDVHPDQDHPTXHRIXVRKRUiULRFRPHoD
6XQ0RQ7XH:HG7KX)UL6DW
KRXU
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGDKRUDFRPHoD
a
PLQXWH
&RQ¿JXUDRPLQXWRHPTXHRIXVRKRUiULRGDKRUDFRPHoD
a
Time
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGDGDWDHKRUD
começa.
End
Month
&RQ¿JXUDRKRUDHPTXHRIXVRKRUiULRGRPrVFRPHoD
a
:HHN
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGDVHPDQDFRPHoD
)LUVW/DVW
'D\
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGRGLDFRPHoD
6XQ0RQ7XH:HG7KX)UL6DW
KRXU
&RQ¿JXUDDKRUDHPTXHRIXVRKRUiULRGDKRUDWHUPLQD
a
PLQXWH
&RQ¿JXUDRPLQXWRHPTXHRIXVRKRUiULRGDKRUDWHUPLQD
a
Time
23
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
Item
Descrição
Time difference
&RQ¿JXUDDGLIHUrQFLDGHKRUD'H¿QHDPHVPDGLIHUrQFLD
GHKRUDGDTXHODGH¿QLGDQRVHX3&6HWLYHUG~YLGDV
FRQVXOWHRVHXJHUHQWHGH7,
6173
&OLTXHQDFDL[DGHGLiORJR>[email protected] recuperar as
LQIRUPDo}HVGDGDWDHKRUDGRVHUYLGRU6173HGH¿QLURV
itens seguintes.
61736HUYHU,3
$GGUHVV
&RQ¿JXUHVWKH6173VHUYHUDGGUHVVLQ,3IRUPDW
• O endereço permite não somente endereço IP, mas o
QRPHGHGRPtQLRVHRVHUYLGRU'16YiOLGRpFRQ¿JXUDGR
em &RQ¿JXUDo}HVGHUHGH. 2WDPDQKRPi[LPRGHKRVWRX
QRPHGHGRPtQLRpGHDWpFDUDFWHUHV
&\FOH
&RQ¿JXUDRLQWHUYDORHPTXHUHFXSHUDDVLQIRUPDo}HVGH
GDWDHKRUDGRVHUYLGRU6173KRUDVPLQXWRV
&OLTXH>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡$VQRYDVGH¿QLo}HVGHFRQ¿JXUDomRVHUmRDFWLYDGDVDSyVR
UHVWDEHOHFLPHQWRGDOLJDomRjUHGH4XDQGRDVGH¿QLo}HVGHFRQ¿JXUDomRVmR
PRGL¿FDGDVDOLJDomRjUHGHGHYHVHUUHVWDEHOHFLGD2UHVWDEHOHFLPHQWRGD
OLJDomRjUHGHpHIHFWXDGRDRFOLFDUHP>[email protected]
‡6HRSURMHFWRUIRUOLJDGRDXPDUHGHSUHH[LVWHQWHR$GPLQLVWUDGRUGDUHGH
GHYHUiVHUFRQWDFWDGRDQWHVGHGH¿QLURVHQGHUHoRVGRVVHUYLGRUHV
‡3DUDDFWLYDUDIXQomR6173RIXVRKRUiULRGHYHHVWDUGH¿QLGR
‡2SURMHFWRUREWHUiDLQIRUPDomRGDGDWDHKRUDGR7LPHVHUYHUDFWXDOL]DQGR
FRQWLQXDPHQWHDVGH¿QLo}HVGHWHPSRTXDQGRR6173HVWiDFWLYDGR
‡$KRUDGRUHOyJLR,QWHUQRSRGHUiQmR¿FDUFRUUHFWD$XWLOL]DomRGH6173p
recomendada para manter a hora correcta.
24
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
6HFXULW\6HWWLQJV&RQÀJXUDo}HVGHVHJXUDQoD
([LEHHFRQ¿JXUDDVSDODYUDVFKDYHVHRXWUDVFRQ¿JXUDo}HVGHVHJXUDQoD
Item
$GPLQLVWUDWRUDXWKRULW\
Descrição
&RQ¿JXUDD,'HSDODYUDFKDYHGRDGPLQLVWUDGRU
$GPLQLVWUDWRU,'
&RQ¿JXUHVWKH$GPLQLVWUDWRU,'
2WDPDQKRGRWH[WRSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV
$GPLQLVWUDWRU
3DVVZRUG
&RQ¿JXUDDSDODYUDFKDYH
2WDPDQKRGRWH[WRSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV
Re-enter
$GPLQLVWUDWRU
3DVVZRUG
5HLQWURGX]DDSDODYUDFKDYHDFLPDSDUDYHUL¿FDomR
8VHUDXWKRULW\
&RQ¿JXUDRXWLOL]DGRUHSDODYUDFKDYHGR)73
User ID
&RQ¿JXUDD,'GHXWLOL]DGRU
2WDPDQKRGRWH[WRSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV
8VHU3DVVZRUG
&RQ¿JXUDDSDODYUDFKDYH
2WDPDQKRGRWH[WRSRGHWHUDWpFDUDFWHUHV
DOIDQXPpULFRV
Re-enter User
3DVVZRUG
5HLQWURGX]DDSDODYUDFKDYHDFLPDSDUDYHUL¿FDomR
25
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
Item
1HWZRUN&RQWURO
Descrição
&RQ¿JXUDDSDODYUDSDVVHGHDXWHQWLFDomRSDUDRFRQWUROR
de comando.
$XWKHQWLFDWLRQ
3DVVZRUG
&RQ¿JXUDDSDODYUDFKDYHGHDXWHQWLFDomR2WDPDQKRGR
WH[WRSRGHWHUDWpFDUDFWHUHVDOIDQXPpULFRV
Re-enter
$XWKHQWLFDWLRQ
3DVVZRUG
5HLQWURGX]DDSDODYUDFKDYHDFLPDSDUDYHUL¿FDomR
6103
&RPPXQLW\QDPH
&RQ¿XJUDRQRPHGDFRPXQLGDGHVH6103IRUXVDGD
&RQ¿JXUDRQRPHGDFRPXQLFDGH2WDPDQKRGRWH[WRSRGH
WHUDWpFDUDFWHUHVDOIDQXPpULFRV
&OLTXH>$SSO\@SDUDJXDUGDUDVFRQ¿JXUDo}HV
NOTA • $VQRYDVGH¿QLo}HVGHFRQ¿JXUDomRVHUmRDFWLYDGDVDSyVR
UHVWDEHOHFLPHQWRGDOLJDomRjUHGH4XDQGRDVGH¿QLo}HVGHFRQ¿JXUDomRVmR
PRGL¿FDGDVDOLJDomRjUHGHGHYHVHUUHVWDEHOHFLGD2UHVWDEHOHFLPHQWRGD
OLJDomRjUHGHpHIHFWXDGRDRFOLFDUHP>[email protected]
‡$SHQDVRVQ~PHURV³´HRDOIDEHWR³D]´H³$=´SRGHPVHUXVDGRV
26
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
3.1.10 Projector Control (Controlo do projector)
2LWHPPRVWUDGRQDWDEHODDEDL[RSRGHVHU
H[HFXWDGRXVDQGRRPHQX3URMHFWRU&RQWURO
6HOHFFLRQHXPLWHPXVDQGRDVWHFODVGHVHWD
DFLPDHDEDL[RGR3&
$PDLRULDGRVLWHQVWHPXPVXEPHQX&RQVXOWHD
WDEHODDEDL[RSDUDREWHUGHWDOKHV
NOTA ‡2YDORUGHFRQ¿JXUDomRWDOYH]QmRFRUUHVSRQGDFRPRYDORUDFWXDO
VHRXWLOL]DGRUDOWHUDURYDORUPDQXDOPHQWH1HVWHFDVRDFWXDOL]HDSiJLQDDR
FOLFDUQRERWmR[Refresh].
&RQWURODRSURMHFWRU
Item
Main
3RZHU
,QSXW6RXUFH
3LFWXUH0RGH
%ODQN2Q2II
0XWH
Freeze
0DJQLI\
)RFXV
3LFWXUH
Brightness
Contrast
*DPPD
Color Temp
Color
Tint
Sharpness
0\0HPRU\6DYH
0\0HPRU\5HFDOO
Descrição
/LJDGHVOLJDDDOLPHQWDomR
6HOHFFLRQDDIRQWHGHHQWUDGD
6HOHFFLRQDDFRQ¿JXUDomRGHPRGRGHLPDJHP
$FWLYD'HVDFWLYDHPEUDQFR
$FWLYD'HVDFWLYDVHPVRP
$FWLYD'HVDFWLYDFRQJHODU
&RQWURODDFRQ¿JXUDomRGHDXPHQWR
(PDOJXPDVIRQWHVGHVLQDOGHHQWUDGDSRGHLQWHUURPSHU
³$XPHQWDU´PHVPRVHQmRDWLQJLURYDORUGHFRQ¿JXUDomRPi[LPR
$IDL[DYDULiYHO
‡3DUDXPFRPSXWDGRUVLQDO
‡3DUDXPVLQDOGHYtGHRFRPSRQHQWHRXVYtGHR
$MXVWDDIRFDJHP
$MXVWDUDFRQ¿JXUDomRGHEULOKR
$MXVWDUDFRQ¿JXUDomRGHFRQWUDVWH
6HOHFFLRQDDFRQ¿JXUDomRJDPD
6HOHFFLRQDDFRQ¿JXUDomRGHWHPSHUDWXUDGHFRU
$MXVWDUDFRQ¿JXUDomRGHFRU
$MXVWDUDFRQ¿JXUDomRGHPDWL]
$MXVWDUDFRQ¿JXUDomRGHQLWLGH]
*XDUGDRVGDGRVGH0LQKDPHPyULD
5HDFWLYDRVGDGRVGH0LQKDPHPyULD
27
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
Item
Image
$VSHFW
Over Scan
93RVLWLRQ
H Position
H Phase
H Size
$XWR$GMXVW([HFXWH
,QSXW
Progressive
9LGHR15
Color Space
Component
&9LGHR)RUPDW
69LGHR)RUPDW
)UDPH/RFN&RPSXWHU
)UDPH/RFN&RPSXWHU
&RPSXWHULQ
&RPSXWHULQ
6HWXS
D-Zoom
'6KLIW9
D-Shift H
.H\VWRQH9
Whisper
Mirror
9ROXPH
6SHDNHU
$XGLR&RPSXWHU
$XGLR&RPSXWHU
$XGLR&RPSRQHQW
$XGLR69LGHR
$XGLR9LGHR
28
Descrição
6HOHFFLRQDDFRQ¿JXUDomRJDPD
$MXVWDDGH¿QLomRGHRYHUVFDQ
$MXVWDDSRVLomRGHPHQXYHUWLFDO
$MXVWDDSRVLomRGHPHQXKRUL]RQWDO
$MXVWDDSRVLomRGHPHQXKRUL]RQWDO
$MXVWDWDPDQKRGHPHQXKRUL]RQWDO
([HFXWDDMXVWHDXWRPiWLFR
6HOHFFLRQDDFRQ¿JXUDomRSURJUHVVLYD
6HOHFFLRQDDFRQ¿JXUDomRGHUXtGRGHYtGHR
6HOHFFLRQDRHVSDoRGHFRU
6HOHFFLRQHDFRQ¿JXUDomRGRWHUPLQDOGRFRPSRQHQWH
6HOHFFLRQHDFRQ¿JXUDomRGHIRUPDWRGHYtGHR
6HOHFFLRQDDFRQ¿JXUDomRGHIRUPDWRGHVYtGHR
/LJXHHGHVOLJXHDIXQomRGHFRPSXWDGRUGHEORTXHLRGHTXDGUR
/LJXHHGHVOLJXHDIXQomRGHFRPSXWDGRUGHEORTXHLRGHTXDGUR
6HOHFFLRQHRWLSRGHVLQDOGHHQWUDGDGRFRPSXWDGRU
6HOHFFLRQHRWLSRGHVLQDOGHHQWUDGDGRFRPSXWDGRU
$MXVWDR]RRP
$MXVWDDSRVLomRYHUWLFDOGDLPDJHP
$MXVWDDSRVLomRKRUL]RQWDOGDLPDJHP
$MXVWDUDFRQ¿JXUDomRGHGLVWRUomRWUDSH]RLGDOYHUWLFDO
6HOHFFLRQHRPRGRVLOHQFLDU
6HOHFFLRQDRHVWDGRGHHVSHOKR
$MXVWDUDFRQ¿JXUDomRGHYROXPH
$FWLYD'HVDFWLYDRDOWLIDODQWHLQWHUQR
$WULEXLDSRUWDGHHQWUDGD$8',2&20387(5,1
$WULEXLDSRUWDGHHQWUDGD$8',2&20387(5,1
$WULEXLDSRUWDGHHQWUDGD$8',2&20321(17
$WULEXLDSRUWDGHHQWUDGD$8',269,'(2
$WULEXLDSRUWDGHHQWUDGD$8',29,'(2
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
Item
Screen
/DQJXDJH
0HQX3RVLWLRQ9
0HQX3RVLWLRQ+
%ODQN
6WDUWXS
0\6FUHHQ/RFN
Message
Option
$XWR6HDUFK
$XWRRQ
Descrição
6HOHFLRQHRLGLRPDGR26'
$MXVWDDSRVLomRGHPHQXYHUWLFDO
$MXVWDDSRVLomRGHPHQXKRUL]RQWDO
6HOHFFLRQHRPRGRHPEUDQFR
6HOHFFLRQDRPRGRGHHFUmGHLQLFLDU
/LJDGHVOLJDDIXQomRGHEORTXHLRGH0HXHFUm
/LJDGHVOLJDDIXQomRGHPHQVDJHP
/LJDGHVOLJDDIXQomRGHSURFXUDGHVLQDODXWRPiWLFR
/LJDGHVOLJDDIXQomRDXWRPiWLFD
&RQ¿JXUDRWHPSRUL]DGRUSDUDIHFKDPHQWRGRSURMHFWRU
$XWRRII
TXDQGRQmRGHWHFWDURVLQDO
$WULEXLDVIXQo}HVSDUDRVERW}HV0<%87721QRFRQWUROR
0\%XWWRQ
UHPRWRLQFOXLGR
$WULEXLDVIXQo}HVSDUDRVERW}HV0<%87721QRFRQWUROR
0\%XWWRQ
UHPRWRLQFOXLGR
)RFXV/RFN
/LJDGHVOLJDDIXQomRGHEORTXHLRGDIRFDJHP
Remote Receiv. Front $FWLYD'HVDFWLYDUHFHEUHPRWRIURQWDO
Remote Receiv. Top
$FWLYD'HVDFWLYDUHFHEUHPRWRVXSHULRU
5HPRWH)UHT1RUPDO $FWLYD'HVDFWLYDDIUHTXrQFLDGRVLQDOGRFRQWURORUHPRWRQRUPDO
Remote Freq. High
$FWLYD'HVDFWLYDDIUHTXrQFLDGRVLQDOGRFRQWURORUHPRWRDOWD
Closed Caption
'LVSOD\
6HOHFFLRQHDFRQ¿JXUDomR(;,%,5GHOHJHQGD
Mode
6HOHFFLRQHDFRQ¿JXUDomR02'2GHOHJHQGD
Channel
6HOHFFLRQHDFRQ¿JXUDomR&$1$/GHOHJHQGD
29
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
3.1.11 Projector Status (Estado de projector)
([LEHHFRQ¿JXUDRHVWDGRDFWXDOGRSURMHFWRU
Item
Descrição
(UURU6WDWXV
([LEHRHVWDGRGHHUURDFWXDO
/DPS7LPH
([LEHRWHPSRGHXVRGDOkPSDGDDFWXDO
Filter Time
([LEHRWHPSRGHXVRGR¿OWURDFWXDO
3RZHU6WDWXV
([LEHRHVWDGRGHDOLPHQWDomRDFWXDO
,QSXW6WDWXV
([LEHDIRQWHGHVLQDOGHHQWUDGDDFWXDO
%ODQN2Q2II
([LEHRHVWDGRGHHPEUDQFRDFWLYDGRGHVDFWLYDGRDFWXDO
0XWH
([LEHRHVWDGRGHVHPVRPDFWLYDGRGHVDFWLYDGRDFWXDO
Freeze
([LEHRHVWDGRGHFRQJHODPHQWRDFWXDO
30
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.1 &RQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGHXPQDYHJDGRUGHLQWHUQHWFRQWLQXDomR
3.1.12 Network Restart (Reiniciar rede)
5HLQLFLDDFRQH[mRGHUHGHGRSURMHFWRU
Item
Restart
Descrição
5HLQLFLDDFRQH[mRGHUHGHGRSURMHFWRUSDUDDFWLYDUDV
QRYDVFRQ¿JXUDo}HV
NOTA ‡5HLQLFLDUH[LJHUHJLVWDUVHQRYDPHQWHSDUDPDLVFRQWURORHFRQ¿JXUDU
RSURMHFWRUDWUDYpVGDLQWHUQHW$JXDUGHPLQXWRRXPDLVGHSRLVGHID]HU
FOLTXHQRERWmR[Restart]SDUDHQWUDUQRYDPHQWH
‡2PHQXGHUHJLVWR13pH[LELGRGHSRLVGHUHLQLFLDUDFRQH[mRGHUHGHGR
SURMHFWRUVHGH¿QLU'+&3SDUD/,*$5
/RJRII6DLU
‡$RFOLFDUQRERWmR>/[email protected][LELGR13
31
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.2 Alertas de e-mails
2SURMHFWRUSRGHHQYLDUDXWRPDWLFDPHQWHXPDPHQVDJHPGHDYLVRSDUDRV
HQGHUHoRVGHFRUUHLRHOHFWUyQLFRHVSHFL¿FDGRVTXDQGRRSURMHFWRUGHWHFWDXPD
FHUWDFRQGLomRTXHHVWiDUHTXHUHUPDQXWHQomRRXGHWHFWRXXPHUUR
NOTA ‡$WpFLQFRPHQVDJHQVSRGHPVHUHVSHFL¿FDGDV
‡2SURMHFWRUQmRpFDSD]GHHQYLDUXPDPHQVDJHPVHIRUGHVOLJDGR
subitamente.
&RQÀJXUDo}HVGHHPDLO18)
3DUDXVDUDIXQomRGHDOHUWDGHPHQVDJHPGRSURMHFWRUFRQ¿JXUHRVLWHQV
DWUDYpVGRQDYHJDGRUGHLQWHUQHW
([HPSOR6HRHQGHUHoR,3GRSURMHFWRUIRUGH¿QLGRSDUD
,QWURGX]LU“http://192.168.1.10/”QDEDUUDGHHQGHUHoRGRQDYHJDGRUGH
internet.
,QWURGX]DVXD,'HSDODYUDFKDYHGHDGPLQLVWUDGRUHFOLTXHHP>/[email protected]
&OLTXHQR[Port Settings]QRPHQXSULQFLSDO
&OLTXH[Enable]SDUDDEULUDSRUWD6073
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡eQHFHVViULRUHVWDEHOHFHUDOLJDomRjUHGHDSyVDDOWHUDomRGDV
FRQ¿JXUDo}HVGDSMTP Port&OLTXHHP>[email protected]¿JXUHRV
VHJXLQWHVLWHQV
&OLTXHHP[Mail Settings] HFRQ¿JXUHFDGDLWHP&RQVXOWHo item 3.1.5 Mail
6HWWLQJV&RQ¿JXUDo}HVGHPHQVDJHP18SDUDREWHUPDLVLQIRUPDo}HV
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡&OLTXHQRERWmR[Send Test Mail] em [Mail Settings]SDUDFRQ¿UPDU
VHDVFRQ¿JXUDo}HVGHPHQVDJHPHVWmRFRUUHFWDV$PHQVDJHPVHJXLQWHVHUi
HQWUHJXHDRVHQGHUHoRVHVSHFL¿FDGRV
/LQKDGHDVVXQWR 7HVW0DLO
7H[WR
6HQG7HVW0DLO
Date
Time
,3$GGUHVV
0$&$GGUHVV
32
1RPHGRSURMHFWRU!
<Data e teste>
<Data de teste>
(QGHUHoR,3GR3URMHFWRU!
(QGHUHoR0$&GRSURMHFWRU!
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
$OHUWDGHHPDLOFRQWLQXDomR
&OLTXHQR>[email protected]¿JXUDUDVGH¿QLo}HVGH
DOHUWDVGHHPDLOV
6HOHFFLRQHHFRQ¿JXUHFDGDLWHPGHDOHUWD&RQVXOWHRLWHP$OHUW6HWWLQJV
&RQ¿JXUDo}HVGHDOHUWD19SDUDREWHUPDLVLQIRUPDo}HV
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
0HQVDJHQVGHHUURDYLVRVmRIRUPDWDGRVFRQIRUPHDVHJXLU
/LQKDGHDVVXQWR
7H[WR
0DLOWLWOH!
0DLOWH[W!
'DWH
7LPH
,3$GGUHVV
0$&$GGUHVV
1RPHGHSURMHFWRU!
'DWDGRHUURDYLVR!
+RUDGRHUURDYLVR!
(QGHUHoR,3GRSURMHFWRU!
(QGHUHoR0$&GRSURMHFWRU!
33
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3.3 Gestão de projector com o SNMP
261036LPSOH1HWZRUN0DQDJHPHQW3URWRFROIDFLOLWDDJHVWmRGDLQIRUPDomR
GRSURMHFWRUTXHpXPHVWDGRGHHUURRXDYLVRGRFRPSXWDGRUQDUHGH2
SURJUDPDGHJHVWmR6103VHUiQHFHVViULRQRFRPSXWDGRUSDUDXVDUHVWD
função.
NOTA ‡5HFRPHQGDVHTXHDVIXQo}HV6103VHMDPIHLWDVFRPXP
administrador de rede.
‡3URJUDPDGHJHVWmR6103GHYHVHULQVWDODGRQRFRPSXWDGRUSDUDRPRQLWRU
GRSURMHFWRUDWUDYpVGH6103
&RQÀJXUDo}HV610317)
&RQ¿JXUHRVVHJXLQWHVLWHQVDWUDYpVGRQDYHJDGRUGHLQWHUQHWSDUDXVDU6103
([HPSOR6HRHQGHUHoR,3GRSURMHFWRUIRUGH¿QLGRSDUD
,QWURGX]LU“http://192.168.1.10/”QDEDUUDGHHQGHUHoRGRQDYHJDGRUGH
internet.
,QWURGX]DVXD,'HSDODYUDFKDYHGHDGPLQLVWUDGRUHFOLTXHHP>/[email protected]
&OLTXHQR[Port Settings] QRPHQXSULQFLSDO
&OLTXHQRQDFDL[DGHVHOHFomR[Enable] para abrir 3RUWD6103'H¿QDR
HQGHUHoR,3SDUDHQYLDUXPUHWHQomR6103TXDQGRRFRUUHUHUURDYLVR
NOTA ‡eQHFHVViULRUHVWDEHOHFHUDOLJDomRjUHGHDSyVDDOWHUDomRGDV
FRQ¿JXUDo}HVGDDUPDGLOKD61033RUW&OLTXHHP>[email protected] e
FRQ¿JXUHRVVHJXLQWHVLWHQV
&OLTXHHP>6HFXULW\[email protected]
&OLTXHHP>[email protected]¿QDRQRPHGDFRPXQLGDGHQRHFUmH[LELGR
NOTA ‡eQHFHVViULRUHVWDEHOHFHUDOLJDomRjUHGHDSyVDDOWHUDomRGR
&RPPXQLW\1DPH&OLTXHHP>[email protected]¿JXUHRVVHJXLQWHV
LWHQV
&RQ¿JXUHDVGH¿QLo}HVSDUDDWUDQVPLVVmRGHUHWHQomRGHIDOKDVDYLVRV
&OLTXH>[email protected]
VHUFRQ¿JXUDGR
&OLTXHQDFDL[DGHVHOHFomR[Enable]SDUDHQYLDUUHWHQomR6103SDUD
IDOKDVDYLVRV&OHDUQDFDL[DGHVHOHFomR[Enable] quando a transmissão de
UHWHQomR6103QmRIRUQHFHVViULD
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
34
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3URJUDPDomRGHHYHQWR
$IXQomRGHSURJUDPDomRIDFLOLWDDFRQ¿JXUDomRGHHYHQWRVSURJUDPDGRV
LQFOXLQGROLJDUGHVOLJDU3HUPLWHD³DXWRJHVWmR´GRSURMHFWRU
NOTA ‡3RGHSURJUDPDURVHYHQWRVGHFRQWURORVHJXLQWHV3RZHU212))
,QSXW6RXUFHH7UDQVIHUUHG,PDJH'LVSOD\
‡2YHQWROLJDGRGHVOLJDGRWHPSULRULGDGHPDLVEDL[DHQWUHWRGRVRVHYHQWRV
TXHVmRGH¿QLGRVDRPHVPRWHPSR
• ([LVWHPWLSRVGHSURJUDPDomRGDLO\ZHHNO\VSHFL¿FGDWH.21
‡$SULRULGDGHSDUDHYHQWRVSURJUDPDGRVpFRQIRUPHDVHJXLUVSHFL¿FGDWH
ZHHNO\GDLO\
‡$WpFLQFRGDWDVHVSHFt¿FDVHVWmRGLVSRQtYHLVSDUDRVHYHQWRVSURJUDPDGRV
$SULRULGDGHpGDGDSDUDHVWHVFRPQ~PHURVEDL[RVTXDQGRXPRXPDLV
HYHQWRIRLSURJUDPDGRSDUDDVPHVPDVGDWDVHKRUDH[µ6SHFL¿FGD\1R¶
WHPSULRULGDGHVREUHµ6SHFL¿FGD\1R¶HDVVLPSRUGLDQWH
• 9HUL¿TXHVHGH¿QHDGDWDHKRUDDQWHVGHDFWLYDURVHYHQWRVSURJUDPDGRV23
35
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3URJUDPDomRGHHYHQWRFRQWLQXDomR
&RQÀJXUDo}HVGHSURJUDPDomR21)
$VGH¿QLo}HVGHSURJUDPDomRSRGHPVHUFRQ¿JXUDGDVGRQDYHJDGRUGHLQWHUQHW
([HPSOR6HRHQGHUHoR,3GRSURMHFWRUIRUGH¿QLGRSDUD
Introduzir “http://192.168.1.10/”QDEDUUDGHHQGHUHoRGRQDYHJDGRUGHLQWHUQHW
,QWURGX]DVXD,'HSDODYUDFKDYHGHDGPLQLVWUDGRUHFOLTXHHP>/[email protected]
&OLTXHQR>[email protected]
SURJUDPDomRQHFHVViULR3RUH[HPSORVHSUHWHQGHUH[HFXWDURFRPDQGRD
FDGD'RPLQJRVHOHFFLRQH>6XQGD\@.
&OLTXHQR[Enable]SDUDDFWLYDUDSURJUDPDomR
,QWURGX]DDGDWHPRQWKGD\SDUDDSURJUDPDomRGHGDWDHVSHFt¿FD
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
&OLTXHQRERWmR>[email protected]'HSRLVGHFRQ¿JXUDUDKRUD
FRPDQGRHSDUkPHWURVFOLTXHHP[Register]SDUDDGLFLRQDUXPQRYRHYHQWR
3DUDUHWRUQDUSDUDDSiJLQDDQWHULRUFOLTXHQRERWmR[Cancel].
&OLTXHQR[Delete] quando apagar uma programação
([LVWHPWUrVWLSRVGHSURJUDPDomR
'DLO\([HFXWDDRSHUDomRHVSHFt¿FDQXPDKRUDHVSHFt¿FDDFDGDGLD
6XQGD\a6DWXUGD\([HFXWDXPDRSHUDomRHVSHFt¿FDQDKRUDHVSHFL¿FDGD
HPXPGLDHVSHFL¿FDGRGDVHPDQD
6SHFL¿F'DWH([HFXWDXPDRSHUDomRHVSHFL¿FDGDQDGDWDHKRUD
HVSHFL¿FDGD
NOTA ‡1RPRGR(PHVSHUDRLQGLFDGRUGHDOLPHQWDomRFLQWLODUiHPYHUGH
SRUDSUR[VHJXQGRVTXDQGRSHORPHQRVSURJUDPDomR³3RZHU21´IRU
VDOYD
‡$RXVDUDIXQomRGHSURJUDPDomRRFDERGHDOLPHQWDomRGHYHVHUFRQHFWDGR
FRPRSURMHFWRUHD¿FKDHRQLQWHUUXSWRUGHDOLPHQWDomRGHYHVHUOLJDRG>[email protected]
$IXQomRGHSURJUDPDomRQmRIXQFLRQDTXDQGRRLQWHUUXSWRUGHDOLPHQWDomR
HVWiGHVOLJDGR>[email protected]
DOLPHQWDomRDFHQGHUiXPDOX]ODUDQMDRXYHUGHTXDQGRRSURMHFWRUHVWLYHU
OLJDGR
36
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
3URJUDPDomRGHHYHQWRFRQWLQXDomR
'HÀQLomRGHGDWDKRUD23)
$FRQ¿JXUDomRGHGDWDKRUDSRGHVHUDMXVWDGDDWUDYpVGDLQWHUQHW
([HPSOR6HRHQGHUHoR,3GRSURMHFWRUIRUGH¿QLGRSDUD
,QWURGX]LU“http://192.168.1.10/” QDEDUUDGHHQGHUHoRGRQDYHJDGRUGH
LQWHUQHW,QWURGX]DD,'HSDODYUDFKDYHGRDGPLQLVWUDGRUHFOLTXHHP>/[email protected]
&OLTXHQR[Date/Time Settings]GRPHQXSULQFLSDOHFRQ¿JXUHFDGDLWHP
&RQVXOWHRLWHP'DWH7LPH6HWWLQJV&RQ¿JXUDomRHVGHGDWDKRUDSDUD
obter mais informações.
&OLTXHQR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡eQHFHVViULRUHVWDEHOHFHUDOLJDomRjUHGHDSyVDDOWHUDomRGDV
FRQ¿JXUDo}HVGH'D\OLJKW6DYLQJV7LPH de energia ou de 6173.
‡$EDWHULDGRUHOyJLRLQWHUQRSRGHSDUDUVHRUHOyJLRSDUDUGHEDWHUPHVPR
TXDQGRDGDWDHKRUDIRUHPGH¿QLGDVFRUUHFWDPHQWH6XEVWLWXDDEDWHULD
conforme as instruções para substituir a bateria.
%DWHULDLQWHUQDGRUHOyJLRQR0DQXDOGR8VXiULRUHVXPLGR
‡$KRUDGRUHOyJLRLQWHUQRWDOYH]QmRVHMDDFXUDGD5HFRPHQGDVHXVDU6173
para manter o tempo acurado.
37
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
(FUmH6+27WUDQVIHUrQFLDGHLPDJHPSDUDGD
2SURMHFWRUSRGHH[LELULPDJHQVSDUDGDVTXHVmRWUDQVIHULGDVDWUDYpVGDUHGH
7UDQVIHULU¿FKHLUR
de imagem
0RVWUDUDUTXLYRGHLPDJHP 1 4 )LJ7UDQIHUrQFLDGHLPDJHPSDUDGD
$WUDQVPLVVmRH6+27H[LJHXPDDSOLFDomRH[FOXVLYDSDUDVHX3&,QVWDOHR
DSDUWLUGRVtWLRZHEGD+LWDFKLKWWSKLWDFKLXVGLJLWDOPHGLDRXKWWSZZZ
KLWDFKLGLJLWDOPHGLDFRP&RQVXOWHRPDQXDOGDDSOLFDomRSDUDREWHULQVWUXo}HV
3DUDH[LELUDLPDJHPWUDQVIHULGDVHOHFFLRQHRLWHPH6+27QRPHQX5('(3DUD
REWHUPDLVLQIRUPDo}HVFRQVXOWHDGHVFULomRGRLWHPH6+27GRPHQX5('(
0HQX5('(QR0DQXDOGR8VXiULRGHWDOKDGR*XLDGH8WLOL]DomR
NOTA ‡eSRVVtYHODORFDUR¿FKHLURGHLPDJHPDWpQRPi[LPR
‡2¿FKHLURGHLPDJHPSRGHVHUH[LELGRDRXVDUDIXQomRGHSURJUDPDomRGR
QDYHJDGRUGHLQWHUQHW&RQVXOWHRRLWHP3URJUDPDomRGHHYHQWR35
SDUDREWHUGHWDOKH
38
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
(FUmH6+27WUDQVIHUrQFLDGHLPDJHPSDUDGDFRQWLQXDomR
&RQ¿JXUHRVLWHQVVHJXLQWHVFRPXPZHEEURZVHUTXDQGRXWLOL]DUDH6+27
([HPSOR6HRHQGHUHoRGR,3SDUDRSURMHFWRUIRUGH¿QLGRFRPR
,QWURGX]D"http://192.168.1.10/" na barra de endereços do web browser.
,QWURGX]DD,'HSDODYUDFKDYHGH$GPLQLVWUDGRU
HFOLTXHHP>/[email protected]
&OLTXHHP[Port Settings]PHQXSULQFLSDO
&OLTXHHP[Enable]QDFDL[DGHYHUL¿FDomR
para abrir a Image Transfer Port (Port: 9716).
&OLTXHHP[Enable]QDFDL[DGHYHUL¿FDomRSDUD
HIHFWXDUDFRQ¿JXUDomRGH>[email protected]
TXDQGRDDXWHQWLFDomRpQHFHVViULDFDVR
FRQWUiULRIHFKHDFDL[DGHYHUL¿FDomR
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVVHOHFo}HVHIHFWXDGDV
4XDQGRDFRQ¿JXUDomRGHDXWHQWLFDomRHVWiDFWLYDGDDVVHJXLQWHVGH¿QLo}HV
GHYHPVHUHIHFWXDGDV
&OLTXHHP>6HFXULW\[email protected]
6HOHFFLRQH>1HWZRUN&[email protected]]DD3DODYUD&KDYHGH$XWHQWLFDomR
requerida.
&OLTXHHP>$SSO\@SDUDVDOYDUDVVHOHFo}HVHIHFWXDGDV
NOTA ‡$3DODYUD&KDYHGH$XWHQWLFDomRDXVDUVHUiDPHVPDTXHHP
1HWZRUN&RQWURO3RUW3RUW,1HWZRUN&RQWURO3RUW3RUW, em
Image Transfer Port (Port: 9716).
‡$VQRYDVGH¿QLo}HVGHFRQ¿JXUDomRVHUmRDFWLYDGDVDSyVRUHVWDEHOHFLPHQWR
GDOLJDomRjUHGH4XDQGRDVGH¿QLo}HVGHFRQ¿JXUDomRVmRPRGL¿FDGDVD
OLJDomRjUHGHGHYHVHUUHVWDEHOHFLGD2UHVWDEHOHFLPHQWRGDOLJDomRjUHGHp
HIHFWXDGRDRFOLFDUHP>[email protected]
39
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
&RQWURORGHFRPDQGRDWUDYpVGDUHGH
3RGHFRQ¿JXUDUHFRQWURODURSURMHFWRUDWUDYpVGDUHGHFRPRVFRPDQGRV56
&
Porta de comunicação
$VGXDVSRUWDVVHJXLQWHVVmRDWULEXtGDVSDUDRFRQWURORGHFRPDQGR
7&3
7&3
NOTA ‡2VFRPDQGRVGHFRQWURORQmRHVWmRGLVSRQtYHLVQDSRUWDGH
FRPXQLFDomR7&317TXHpXVDGDSDUDDIXQomRGHWUDQVPLVVmR
GHH6+27
&RQÀJXUDo}HVGHFRQWURORGHFRPDQGR17)
&RQ¿JXUHRVVHJXLQWHVLWHQVGXPQDYHJDGRUGHLQWHUQHWDRXVDURFRQWURORGH
comando.
([HPSOR6HRHQGHUHoR,3GRSURMHFWRUIRUGH¿QLGRSDUD
,QWURGX]LU “http://192.168.1.10/”QDEDUUDGHHQGHUHoRGRQDYHJDGRUGH
internet.
,QWURGX]DVXD,'HSDODYUDFKDYHGHDGPLQLVWUDGRUHFOLTXHHP>/[email protected]
&OLTXHQR[Port Settings]QRPHQXSULQFLSDO
&OLTXHQR[Enable] para abrir 1HWZRUN&RQWURO3RUW3RUWpara usar
7&3&OLTXHQDFDL[DGHYHUL¿FDomR[Enable]SDUDDFRQ¿JXUDomR
>[email protected]L[D
GHVHOHFomR
&OLTXH[Enable] para abrir 1HWZRUN&RQWURO3RUW3RUW para usar
7&3&OLTXHQDFDL[DGHYHUL¿FDomR[Enable] SDUDDFRQ¿JXUDomR
>[email protected]L[D
GHVHOHFomR
&OLTXHQRERWmR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
40
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
&RQWURORGHFRPDQGRDWUDYpVGDUHGHFRQWLQXDomR
4XDQGRDFRQ¿JXUDomRGHDXWHQWLFDomRpDFWLYDGDDVFRQ¿JXUDo}HVVHJXLQWHV
VmRQHFHVViULDV25
&OLTXHQR>6HFXULW\[email protected]"
&OLTXHQR>1HWZRUN&[email protected]]DDSDODYUDFKDYHGHDXWHQWLFDomR
pretendida.
&RQVXOWH127$
&OLTXHQR>$SSO\@SDUDVDOYDUDVFRQ¿JXUDo}HV
NOTA ‡$3DODYUD&KDYHGH$XWHQWLFDomRDXVDUVHUiDPHVPDTXHHP
1HWZRUN&RQWURO3RUW3RUW, 1HWZRUN&RQWURO3RUW3RUW, em
Image Transfer Port (Port: 9716).
‡$VQRYDVGH¿QLo}HVGHFRQ¿JXUDomRVHUmRDFWLYDGDVDSyVRUHVWDEHOHFLPHQWR
GDOLJDomRjUHGH4XDQGRDVGH¿QLo}HVGHFRQ¿JXUDomRVmRPRGL¿FDGDVD
OLJDomRjUHGHGHYHVHUUHVWDEHOHFLGD2UHVWDEHOHFLPHQWRGDOLJDomRjUHGHp
HIHFWXDGRDRFOLFDUHP>[email protected]
41
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
&RQWURORGHFRPDQGRDWUDYpVGDUHGHFRQWLQXDomR
Formato de comando
Os formatos de comando diferem entre as portas de comunicação.
Ɣ7&3
3RGHXVDURVFRPDQGRV56&VHPTXDLVTXHUDOWHUDo}HV2IRUPDWR
GRVGDGRVGHUHVSRVWDVmRRVPHVPRVGRVFRPDQGRV56&&RQWXGR
DVHJXLQWHUHVSRVWDVHUiHQYLDGDGHYROWDFDVRRFRUUDHUURGHDXWHQWLFDomR
TXDQGRDFWLYDHVWDIXQomR
5HVSRQGHFDVRRFRUUDXPHYHQWRGHDXWHQWLFDomR!
Resposta
[)
Código de erro
[
[
Ɣ7&3
Enviar formato de dados
2IRUPDWRVHJXLQWHpDGLFLRQDGRDRFDEHoDOKR[WDPDQKRGHGDGRV
['YHUL¿FDomRGDVRPDE\WHH,'GHFRQH[mRE\WHGRVFRPDQGRV
56&
Cabeçalho
Tamanho
de dados
ComandoRS-232
Soma de
YHUL¿FDomR
ID de
conexão
[
['
E\WHV
E\WH
E\WH
&DEHoDOKR
ĺ [)L[R
7DPDQKRGHGDGRV ĺ 56&WDPDQKRGHE\WHGHFRPDQGRV['¿[R
&RPDQGRV56& ĺ 56&RVFRPDQGRVFRPHoDPFRP[%([()
E\WHV
6RPDGHYHUL¿FDomR ĺ (VWHpRYDORUSDUDID]HU]HURQDDGLomRGRVELWV
LQIHULRUHVGRFDEHoDOKRSDUDDVRPDGHYHUL¿FDomR
,'GHFRQH[mR
ĺ 9DORUDOHDWyULRGHDHVWHYDORUpLQWURGX]LGR
QRVGDGRVGHUHVSRVWD
42
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
&RQWURORGHFRPDQGRDWUDYpVGDUHGHFRQWLQXDomR
Formato de dados de resposta
$,'GHFRQH[mRRVGDGRVVmRRVPHVPRVGRVGDGRVGH,'GHFRQH[mRDR
HQYLDUIRUPDWRGHGDGRVpDQH[DGRDRVGDGRVGHUHVSRVWDGRVFRPDQGRV56
&
5HVSRVWD$&.!
Resposta
ID de
conexão
[
E\WH
5HVSRVWD1$.!
Resposta
ID de
conexão
[
E\WH
<Erro de resposta>
Resposta
Código de erro
ID de
conexão
[&
E\WHV
E\WH
Resposta
Dados
ID de
conexão
['
E\WHV
E\WH
5HVSRVWDGHGDGRV!
5HVSRVWDGHRFXSDGRGHSURMHFWRU!
Resposta
Código de estado
ID de
conexão
[)
E\WHV
E\WH
5HVSRVWDGHHUURGHDXWHQWLFDomR!
Resposta
[)
Código de erro de
DXWHQWLFDomR
[
[
ID de
conexão
E\WH
43
*HVWmRFRPRSURJUDPDGHQDYHJDGRUGHLQWHUQHW
&RQWURORGHFRPDQGRDWUDYpVGDUHGHFRQWLQXDomR
Interrupção de conexão automática
$FRQH[mR7&3VHUiDXWRPDWLFDPHQWHGHVFRQHFWDGDVHQmRRFRUUHUFRPXQLFDomR
SRUVHJXQGRVGHSRLVGHVHUHVWDEHOHFLGD
$XWHQWLFDomR
2SURMHFWRUQmRDFHLWDRVFRPDQGRVVHPDXWHQWLFDUFRPVXFHVVRTXDQGRDFWLYDU
a função de autenticação. O projector usa uma autenticação de tipo de resposta
GHVD¿DGRUDFRPXPDOJRUtWPR0'UHVXPRVGHPHQVDJHP
4XDQGRRSURMHFWRUXVDUXPD/$1ELWHVDOHDWyULRVVHUiGHYROYLGRVVHDFWLYDU
DXWHQWLFDomR/LJXHHVWHVELWHVUHFHELGRVHDSDODYUDFKDYHGHDXWHQWLFDomRH
RIDoDXPUHVXPRGHVWHVGDGRVFRPRDOJRUtWPR0'HDGLFLRQHRQDIUHQWHGRV
FRPDQGRVSDUDHQYLDU
$VHJXLUDSUHVHQWDPRVXPH[HPSORVHDSDODYUDFKDYHGHDXWHQWLFDomRp
GH¿QLGDSDUD³SDVVZRUG´HRVELWHVDOHDWyULRVVmR³DIF´
6HOHFFLRQHRSURMHFWRU
5HFHEDRVELWHVDOHDWyULRV³DIF´GRSURMHFWRU
/LJDELWHVDOHDWyULRV³DIF´HSDODYUDFKDYHGHDXWHQWLFDomR³SDVVZRUG´
HWRUQDVH³DIFSDVVZRUG´
)DoDXPUHVXPRGHVWDOLJDomR³DIFSDVVZRUG´FRPRDOJRUtWPR0'
6HUi³HGDGIIDEFHIGEGH´
$GLFLRQHHVWH³HGDGIIDEFHIGEGH´QDIUHQWHGHFRPDQGRV
HHQYLHRVGDGRV
(QYLH³HGDGIIDEFHIGEGH´FRPDQGR
4XDQGRHQYLDURVGDGRVHVWLYHUFRUUHFWRRFRPDQGRVHUiH[HFXWDGRUH
GDGRVGHUHVSRVWDVHUmRGHYROYLGRV&DVRFRQWUiULRXPHUURGHDXWHQWLFDomR
VHUiGHYROYLGR
NOTA • Quanto a transmissão do segundo comando e dos comandos
subsequentes, os dados de autenticação podem ser omitidos quando a mesma
FRQH[mR
44
Projector
ED-A100/ED-A110/CP-A100W
User's Manual (detailed)
Technical
Example of PC signal
Resolution (H x V) H. frequency (kHz) V. frequency (Hz)
720 x 400
640 x 480
640 x 480
640 x 480
640 x 480
800 x 600
800 x 600
800 x 600
800 x 600
800 x 600
832 x 624
1024 x 768
1024 x 768
1024 x 768
1024 x 768
1152 x 864
1280 x 960
1280 x 1024
1280 x 1024
1280 x 1024
1600 x 1200
1280 x 768
1400 x 1050
37.9
31.5
37.9
37.5
43.3
35.2
37.9
48.1
46.9
53.7
49.7
48.4
56.5
60.0
68.7
67.5
60.0
64.0
80.0
91.1
75.0
47.7
65.2
85.0
59.9
72.8
75.0
85.0
56.3
60.3
72.2
75.0
85.1
74.5
60.0
70.1
75.0
85.0
75.0
60.0
60.0
75.0
85.0
60.0
60.0
60.0
Rating
Signal mode
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
TEXT
VGA (60Hz)
VGA (72Hz)
VGA (75Hz)
VGA (85Hz)
SVGA (56Hz)
SVGA (60Hz)
SVGA (72Hz)
SVGA (75Hz)
SVGA (85Hz)
Mac 16” mode
XGA (60Hz)
XGA (70Hz)
XGA (75Hz)
XGA (85Hz)
1152 x 864 (75Hz)
1280 x 960 (60Hz)
SXGA (60Hz)
SXGA (75Hz)
SXGA (85Hz)
UXGA (60Hz)
W-XGA (60Hz)
SXGA+ (60Hz)
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
VESA
NOTE • Be sure to check jack type, signal level, timing and resolution before
connecting this projector to a PC.
• Some PCs may have multiple display screen modes. Use of some of these
modes will not be possible with this projector.
• Depending on the input signal, full-size display may not be possible in some
cases. Refer to the number of display pixels above.
• Although the projector can display signals with resolution up to UXGA
(1600x1200), the signal will be converted to the projector’s panel resolution before
being displayed. The best display performance will be achieved if the resolutions
of the input signal and projector panel are identical.
• Automatic adjustment may not function correctly with some input signals.
• The image may not be displayed correctly when the input sync signal is a
composite sync or a sync on G.
1
Initial set signals
Initial set signals
The following signals are used for the initial settings. The signal timing of some
PC models may be different. In such case, adjust the items V POSITION and H
POSITION in IMAGE Menu.
Back porch (B)
Front porch (D)
Active video (C)
Data
H. Sync.
Sync (A)
+RUL]RQWDOVLJQDOWLPLQJȝV
computer
Signal
(A)
(B)
(C)
(D)
TEXT
2.0
3.0 20.3 1.0
VGA (60Hz)
3.8
1.9 25.4 0.6
VGA (72Hz)
1.3
4.1 20.3 0.8
VGA (75Hz)
2.0
3.8 20.3 0.5
VGA (85Hz)
1.6
2.2 17.8 1.6
SVGA (56Hz) 2.0
3.6 22.2 0.7
SVGA (60Hz) 3.2
2.2 20.0 1.0
SVGA (72Hz) 2.4
1.3 16.0 1.1
SVGA (75Hz) 1.6
3.2 16.2 0.3
SVGA (85Hz) 1.1
2.7 14.2 0.6
Mac 16" mode 1.1
3.9 14.5 0.6
XGA (60Hz)
2.1
2.5 15.8 0.4
XGA (70Hz)
1.8
1.9 13.7 0.3
XGA (75Hz)
1.2
2.2 13.0 0.2
XGA (85Hz)
1.0
2.2 10.8 0.5
1152 x 864
1.2
2.4 10.7 0.6
(75Hz)
1280 x 960
1.0
2.9
11.9
0.9
(60Hz)
SXGA (60Hz) 1.0
2.3
11.9
0.4
SXGA (75Hz) 1.1
1.8
9.5
0.1
SXGA (85Hz) 1.0
1.4
8.1
0.4
UXGA (60Hz) 1.2
1.9
9.9
0.4
W-XGA (60Hz) 1.7
2.5 16.0 0.8
SXGA+ (60Hz) 1.2
2.0
11.4
0.7
2
Back porch (b)
Front porch (d)
Active video (c)
Data
V. Sync.
Sync (a)
Vertical signal timing (lines)
computer
Signal
(a)
(b)
(c)
(d)
TEXT
3
42
400
1
VGA (60Hz)
2
33
480
10
VGA (72Hz)
3
28
480
9
VGA (75Hz)
3
16
480
1
VGA (85Hz)
3
25
480
1
SVGA (56Hz)
2
22
600
1
SVGA (60Hz)
4
23
600
1
SVGA (72Hz)
6
23
600
37
SVGA (75Hz)
3
21
600
1
SVGA (85Hz)
3
27
600
1
Mac 16" mode
3
39
624
1
XGA (60Hz)
6
29
768
3
XGA (70Hz)
6
29
768
3
XGA (75Hz)
3
28
768
1
XGA (85Hz)
3
36
768
1
1152 x 864
3
32
864
1
(75Hz)
1280 x 960
3
36
960
1
(60Hz)
SXGA(60Hz)
3
38 1024
1
SXGA (75Hz)
3
38 1024
1
SXGA (85Hz)
3
44 1024
1
UXGA (60Hz)
3
46 1200
1
W-XGA (60Hz)
3
23
768
1
SXGA+ (60Hz)
3
33 1050
1
Connection to the ports
Connection to the ports
C
B
A
MONITOR OUT
COMPUTER IN2
COMPUTER IN1
D
LAN
1
CONTROL
USB
AUDIO
OUT
S-VIDEO
Y
2
AUDIO IN
CB/PB CR/PR
VIDEO
L
R
AUDIO IN3
A COMPUTER IN1, B COMPUTER IN2, C MONITOR OUT
D-sub 15pin mini shrink jack
‡9LGHRVLJQDO5*%VHSDUDWH$QDORJ9SSȍ
terminated (positive)
• H/V. sync. signal: TTL level (positive/negative)
• Composite sync. signal: TTL level
Pin
Signal
1
2
3
4
5
6
7
8
9
Pin
Video Red
Video Green
Video Blue
(No connection)
Ground
Ground Red
Ground Green
Ground Blue
(No connection)
10
11
12
13
14
15
-
Signal
Ground
(No connection)
A : SDA (DDC data)
B , C : (No connection)
H. sync / Composite sync.
V. sync.
A : SCL (DDC clock)
B , C : (No connection)
-
D LAN
RJ-45 jack
1
2
3
4
5
6
7
8
Pin
Signal
Pin
Signal
Pin
Signal
1 TX +
4 -
7 -
2 TX -
5 -
8 -
3 RX +
6 RX -
-
-
3
Connection to the ports (continued)
E
MONITOR OUT
F
COMPUTER
IN2G
COMPUTER
H IN1
LAN
1
USB
CONTROL
AUDIO
OUT
S-VIDEO
I
Y
VIDEO
CB/PB CR/PR
L
2
AUDIO IN
R
AUDIO IN3
E Y, F CB/PB, G CR/PR (component video)
RCA jack x3
• System: 525i(480i), 525p(480p), 625i(576i), 750p(720p),1125i(1080i)
Port
Y
Signal
&RPSRQHQWYLGHR<“9SSȍWHUPLQDWRUZLWKFRPSRVLWHV\QF
CB/PB Component video CB/PB“9SSȍWHUPLQDWRU
CR/PR Component video CR/PR“9SSȍWHUPLQDWRU
H S-VIDEO
Mini DIN 4pin jack
Pin
1
3
2
4
Signal
1
&RORUVLJQDO9SS176&EXUVWȍWHUPLQDWRU
&RORUVLJQDO9SS3$/6(&$0EXUVWȍWHUPLQDWRU
2
%ULJKWQHVVVLJQDO9SSȍWHUPLQDWRU
3
Ground
4
Ground
I VIDEO
RCA jack
• System: NTSC, PAL, SECAM, PAL-M, PAL-N, NTSC4.43
‡“9SSȍWHUPLQDWRU
4
Connection to the ports (continued)
COMPUTERJ
IN1
COMPUTER IN2
MONITOR OUT
N
LAN
1
CONTROL
USB
S-VIDEO
Y
L
VIDEO
CB/PB CR/PR
L
M
AUDIO
OUT
2
AUDIO INK
R
AUDIO IN3
J AUDIO IN1, K AUDIO IN2
Ø3.5 stereo mini jack
‡P9UPVNŸWHUPLQDWRU
AUDIO IN3 L L, M R
RCA jack x2
‡P9UPVNŸWHUPLQDWRU
N AUDIO
OUT
Ø3.5 stereo mini jack
‡P9UPVNŸRXWSXWLPSHGDQFH
To input SCART RGB signal;
ex.:
SCART connector
(jack)
㪩
㪙
㪞
㪭㫀㪻㪼㫆
㪘㫌㪻㫀㫆㩷㪣
SCART cable
(plug)
㪘㫌㪻㫀㫆㩷㪩
AUDIO IN3
RCA plugs
To input SCART RGB signal to the projector, use a SCART to RCA cable.
Connect the plugs refer to above ex.. For more reference, please consult your dealer.
5
Connection to the ports (continued)
P
O
COMPUTER IN1
COMPUTER IN2
MONITOR OUT
LAN
1
USB
CONTROL
AUDIO
OUT
S-VIDEO
Y
VIDEO
CB/PB CR/PR
L
2
AUDIO IN
R
AUDIO IN3
O USB
USB B type jack
Pin
4
3
1
2
Signal
1 +5V
2 - Data
3 + Data
4 Ground
P CONTROL
D-sub 9pin plug
• About the details of RS-232C communication,
please refer to the following page.
Pin
Signal
Pin
Signal
9 8 7 6
5 4 3 2 1
Pin
Signal
1
(No connection)
4
(No connection)
7
RTS
2
RD
5
Ground
8
CTS
3
TD
6
(No connection)
9
(No connection)
6
RS-232C Communication
RS-232C Communication
6
4
3
2
1
5
7
8
CONTROL port
of the projector
RS-232C cable (cross)
- (1)
RD (2)
TD (3)
- (4)
GND (5)
- (6)
RTS (7)
CTS (8)
- (9)
6
4
3
2
1
5
9
7
8
9
RS-232C port
of the computer
(1) CD
(2) RD
(3) TD
(4) DTR
(5) GND
(6) DSR
(7) RTS
(8) DTS
(9) RI
Connecting the cable
1. Turn off the projector and the computer.
the CONTROL port of the projector with a RS-232C port of
2. Connect
WKHFRPSXWHUE\D56&FDEOHFURVV8VHWKHFDEOHWKDWIXO¿OOVWKH
VSHFL¿FDWLRQVKRZQLQWKHSUHYLRXVSDJH
Turn the computer on, and after the computer has started up turn the
projector on.
3.
Communications setting
19200bps, 8N1
1. Protocol
Consist of header (7 bytes) + command data (6 bytes)
2. Header
BE + EF + 03 + 06 + 00 + CRC_low + CRC_high
&5&BORZ/RZHUE\WHRI&5&ÀDJIRUFRPPDQGGDWD
&5&BKLJK8SSHUE\WHRI&5&ÀDJIRUFRPPDQGGDWD
3. Command data
Command data chart
byte_0
byte_1
byte_2
byte_3
byte_4
byte_5
Action
Type
Setting code
low
high
low
high
low
high
Action (byte_0 - 1)
Action
&ODVVL¿FDWLRQ
Content
1
Set
Change setting to desired value.
2
Get
Read projector internal setup value.
4
Increment
Increment setup value by 1.
5
Decrement
Decrement setup value by 1.
6
Execute
Run a command.
7
RS-232C Communication (continued)
Requesting projector status (Get command)
(1) Send the following request code from the PC to the projector.
Header + Command data (‘02H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
(2) The projector returns the response code ‘1DH’ + data (2 bytes) to the PC.
Changing the projector settings (Set command)
(1) Send the following setting code from the PC to the projector.
Header + Command data (‘01H’ + ‘00H’ + type (2 bytes) + setting code (2 bytes))
(2) The projector changes the setting based on the above setting code.
(3) The projector returns the response code ‘06H’ to the PC.
Using the projector default settings (Reset Command)
(1) The PC sends the following default setting code to the projector.
Header + Command data (‘06H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
7KHSURMHFWRUFKDQJHVWKHVSHFL¿HGVHWWLQJWRWKHGHIDXOWYDOXH
(3) The projector returns the response code ‘06H’ to the PC.
Increasing the projector setting value (Increment command)
(1) The PC sends the following increment code to the projector.
Header + Command data (‘04H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
(2) The projector increases the setting value on the above setting code.
(3) The projector returns the response code ‘06H’ to the PC.
Decreasing the projector setting value (Decrement command)
(1) The PC sends the following decrement code to the projector.
Header + Command data (‘05H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
(2) The projector decreases the setting value on the above setting code.
(3) The projector returns the response code ‘06H’ to the PC.
When the projector cannot understand the received command
When the projector cannot understand the received command, the error code ‘15H’
is sent back to the PC.
Sometimes the projector cannot properly receive the command. In such a case,
the command is not executed and the error code ‘15H’ is sent back to the PC. If
this error code is returned, send the same command again.
When the projector cannot execute the received command.
When the projector cannot execute the received command, the error code ‘1CH’ +
‘xxxxH’ is sent back to the PC.
When the data length is greater than indicated by the data length code, the
projector ignore the excess data code. Conversely when the data length is shorter
than indicated by the data length code, an error code will be returned to the PC.
NOTE‡2SHUDWLRQFDQQRWEHJXDUDQWHHGZKHQWKHSURMHFWRUUHFHLYHVDQXQGH¿QHG
command or data.
• Provide an interval of at least 40ms between the response code and any other code.
• The projector outputs test data when the power supply is switched ON, and when the
lamp is lit. Ignore this data.
• Commands are not accepted during warm-up.
8
Command Control via the Network
Command Control via the Network
Communication Port
The following two ports are assigned for the command control.
TCP #23
TCP #9715
Command Control Settings
&RQ¿JXUHWKHIROORZLQJLWHPVIRUPDZHEEURZVHUZKHQFRPPDQGFRQWUROLVXVHG
Port Settings
Port open
Click the [Enable] check box to open [Network
Control Port1 (Port: 23)] to use TCP #23.
Default setting is “Enable”.
Authentication
Click the [Enable] check box for the
[Authentication] setting when authentication
is required.
Default setting is “Disable”.
Port open
Click the [Enable] check box to open [Network
Control Port2 (Port: 9715)] to use TCP
#9715.
Default setting is “Enable”.
Authentication
Click the [Enable] check box for the
[Authentication] setting when authentication
is required.
Default setting is “Enable”.
Netowrk Control
Port1 (Port: 23)
Network Control
Port2 (Port: 9715)
When the authentication setting is enabled, the following settings are required.
Security Settings
Authentication
Password
Network Control
Re-enter
Authentication
Password
Enter the desired authentication password.
This setting will be the same for [Network
Control Port1 (Port: 23)] and [Network
Control Port2 (Port: 9715)].
Default setting is blank.
9
Command Control via the Network (continued)
Command Format
[TCP #23]
1. Protocol
Consist of header (7 bytes) + command data (6 bytes)
2. Header
BE + EF + 03 + 06 + 00 + CRC_low + CRC_high
&5&BORZ/RZHUE\WHRI&5&ÀDJIRUFRPPDQGGDWD
&5&BKLJK8SSHUE\WHRI&5&ÀDJIRUFRPPDQGGDWD
3. Command data
Command data chart
byte_0
byte_1
byte_2
byte_3
byte_4
byte_5
Action
Type
Setting code
low
high
low
high
low
high
Action (byte_0 - 1)
Action
&ODVVL¿FDWLRQ
Content
1
Set
Change setting to desired value.
2
Get
Read projector internal setup value.
4
Increment
Increment setup value by 1.
5
Decrement
Decrement setup value by 1.
6
Execute
Run a command.
Requesting projector status (Get command)
(1) Send the following request code from the PC to the projector.
Header + Command data (‘02H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
(2) The projector returns the response code ‘1DH’ + data (2 bytes) to the PC.
Changing the projector settings (Set command)
(1) Send the following setting code from the PC to the projector.
Header + Command data (‘01H’ + ‘00H’ + type (2 bytes) + setting code (2 bytes))
(2) The projector changes the setting based on the above setting code.
(3) The projector returns the response code ‘06H’ to the PC.
Using the projector default settings (Reset Command)
(1) The PC sends the following default setting code to the projector.
Header + Command data (‘06H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
7KHSURMHFWRUFKDQJHVWKHVSHFL¿HGVHWWLQJWRWKHGHIDXOWYDOXH
(3) The projector returns the response code ‘06H’ to the PC.
Increasing the projector setting value (Increment command)
(1) The PC sends the following increment code to the projector.
Header + Command data (‘04H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
(2) The projector increases the setting value on the above setting code.
(3) The projector returns the response code ‘06H’ to the PC.
10
Command Control via the Network (continued)
Decreasing the projector setting value (Decrement command)
(1) The PC sends the following decrement code to the projector.
Header + Command data (‘05H’ + ‘00H’ + type (2 bytes) + ‘00H’ + ‘00H’)
(2) The projector decreases the setting value on the above setting code.
(3) The projector returns the response code ‘06H’ to the PC.
When the projector cannot understand the received command
When the projector cannot understand the received command, the error code ‘15H’
is sent back to the PC.
Sometimes the projector cannot properly receive the command. In such a case,
the command is not executed and the error code ‘15H’ is sent back to the PC. If
this error code is returned, send the same command again.
When the projector cannot execute the received command.
When the projector cannot execute the received command, the error code ‘1CH’ +
‘xxxxH’ is sent back to the PC.
When the data length is greater than indicated by the data length code, the
projector ignore the excess data code. Conversely when the data length is shorter
than indicated by the data length code, an error code will be returned to the PC.
When authentication error occurred.
When authentication errorr occurred, the error code the ‘1FH’ + ‘0400H’ is sent
back to the PC.
NOTE‡2SHUDWLRQFDQQRWEHJXDUDQWHHGZKHQWKHSURMHFWRUUHFHLYHVDQXQGH¿QHG
command or data.
• Provide an interval of at least 40ms between the response code and any other code.
• Commands are not accepted during warm-up.
[TCP #9715]
1. Protocol
Consist of header (1 byte) + data length (1 byte) + command data (13 bytes) +
check sum (1 bytes) + connection ID (1 byte).
2. Header
02, Fixed
3. Data Length
Network control commands byte length (0D, Fixed)
4. Command data
Network control commands that start with BE EF (13bytes).
5. Check Sum
This is the value to make zero on the addition of the lower 8 bits from the header
to the check sum.
6. Connection ID
Random value from 0 to 255 (This value is attached to the reply data).
11
Command Control via the Network (continued)
7. Reply Data
The connection ID (the data is same as the connection ID data on the sending
data format) is attached to the Network control commands reply data.
ACK reply: ‘06H’ + ‘xxH’
NAK reply: ‘15H’ + ‘xxH’
Error reply: ‘1CH’ + ‘xxxxH’ + ‘xxH’
Data reply: ‘1DH’ + ‘xxxxH’ + ‘xxH’
Projector busy reply: ‘1FH’ + ‘xxxxH’ + ‘xxH’
Authentication error reply: ‘1FH’ + ‘0400H’ + ‘xxH’
(‘xxH’ : connection ID)
Automatic Connection Break
The TCP connection will be automatically disconnected after there is no
communication for 30 seconds after being established.
Authentication
The projector does not accept commands without authentication success
when authentication is enabled. The projector uses a challenge response type
authentication with an MD5 (Message Digest 5) algorithm. When the projector is
using a LAN, a random 8 bytes will be returned if authentication is enabled. Bind
this received 8 bytes and the authentication password and digest this data with
the MD5 algorithm and add this in front of the commands to send.
Following is a sample if the authentication password is set to “password” and the
random 8 bytes are “a572f60c”.
1) Select the projector.
2) Receive the random 8 bytes “a572f60c” from the projector.
3) Bind the random 8 bytes “a572f60c” and the authentication password
“password” and it becomes “a572f60cpassword”.
4) Digest this bind “a572f60cpassword” with MD5 algorithm.
It will be “e3d97429adffa11bce1f7275813d4bde”.
5) Add this “e3d97429adffa11bce1f7275813d4bde” in front of the commands and
send the data.
Send “e3d97429adffa11bce1f7275813d4bde”+command.
6) When the sending data is correct, the command will be performed and the
reply data will be returned. Otherwise, an authentication error will be returned.
NOTE • As for the transmission of the second or subsequent commands, the
authentication data can be omitted when the same connection.
12
RS-232C communication / Network command table
RS-232C communication / Network command table
Names
Power
Operation Type
Set
Turn off
Turn on
Get
Command Data
Header
BE EF
BE EF
BE EF
03
03
03
06 00
06 00
06 00
[Example return]
00 00
[Off]
Input Source
Set
Error Status
COMPUTER1
COMPUTER2
COMPONENT
S-VIDEO
VIDEO
Get
Get
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
BRIGHTNESS Reset
CONTRAST
CONTRAST Reset
PICTURE MODE
Set
03
03
03
03
03
03
03
Set
Type
Setting Code
2A D3
BA D2
19 D3
01 00
01 00
02 00
00 60
00 60
00 60
00 00
01 00
00 00
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
20
00
04
05
02
01
00
00
02 00
[Cool down]
FE
3E
AE
9E
6E
CD
D9
D2
D0
D1
D3
D3
D2
D8
01 00
[Cover error]
05 00
>$LUÀ[email protected]
0C 0000
( F[Lens door error]ilter
01
01
01
01
01
02
02
00
00
00
00
00
00
00
02 00
[Fan error]
06 00
>/[email protected]
20
20
20
20
20
20
60
00
00
00
00
00
00
00
03 00
[Lamp error]
07 00
>&[email protected]
Get
Increment
Decrement
Execute
BE
BE
BE
BE
EF
EF
EF
EF
03
03
03
03
06
06
06
06
00
00
00
00
89
EF
3E
58
D2
D2
D3
D3
02
04
05
06
00
00
00
00
03
03
03
00
20
20
20
70
00 00
00 00
00 00
00 00
Get
Increment
Decrement
Execute
BE
BE
BE
BE
EF
EF
EF
EF
03
03
03
03
06
06
06
06
00
00
00
00
FD
9B
4A
A4
D3
D3
D2
D2
02
04
05
06
00
00
00
00
04
04
04
01
20
20
20
70
00
00
00
00
00
00
00
00
NORMAL
CINEMA
DYNAMIC
BOARD(BLACK)
BOARD(GREEN)
WHITEBOARD
DAYTIME
Get
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
23
B3
E3
E3
73
83
E3
10
F6
F7
F4
EF
EE
EE
C7
F6
01
01
01
01
01
01
01
02
00
00
00
00
00
00
00
00
BA
BA
BA
BA
BA
BA
BA
BA
30
30
30
30
30
30
30
30
00
01
04
20
21
22
40
00
00
00
00
00
00
00
00
00
20
10
21
11
22
12
23
13
24
14
25
15
00
00
00
00
00
00
00
00
00
00
00
00
00
00
[Example return]
00 00
[NORMAL]
20 00
[BOARD(BLACK) ]
GAMMA
Action
01 00
[On]
[Example return]
00 00
[Normal]
04 00
>[email protected]
08 00
[Filter error]
BRIGHTNESS
CRC
#1 DEFAULT
#1 CUSTOM
#2 DEFAULT
#2 CUSTOM
#3 DEFAULT
#3 CUSTOM
#4 DEFAULT
#4 CUSTOM
#5 DEFAULT
#5 CUSTOM
#6 DEFAULT
#6 CUSTOM
Get
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
01 00
[CINEMA]
21 00
[BOARD(GREEN)]
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
04 00
[DYNAMIC]
22 00
[WHITEBOARD]
07 E9
07 FD
97 E8
97 FC
67 E8
67 FC
F7 E9
F7 FD
C7 EB
C7 FF
57 EA
57 FE
F4 F0
01
01
01
01
01
01
01
01
01
01
01
01
02
00
00
00
00
00
00
00
00
00
00
00
00
00
10 00
[CUSTOM]
40 00
[DAY TIME]
A1
A1
A1
A1
A1
A1
A1
A1
A1
A1
A1
A1
A1
30
30
30
30
30
30
30
30
30
30
30
30
30
(continued on next page)
13
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
User Gamma Pattern
Operation Type
Set
User Gamma Point 1
User Gamma Point 2
User Gamma Point 3
User Gamma Point 4
User Gamma Point 5
User Gamma Point 6
User Gamma Point 7
User Gamma Point 8
COLOR TEMP
COLOR TEMP GAIN R
COLOR TEMP GAIN G
Set
Off
9 steps gray scale
15 steps gray scale
Ramp
Get
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
HIGH
CUSTOM-1 (HIGH)
MID
CUSTOM-2 (MID)
LOW
CUSTOM-3 (LOW)
Hi-BRIGHT-1
CUSTOM-4 (Hi-BRIGHT-1)
Hi-BRIGHT-2
CUSTOM-5 (Hi-BRIGHT-2)
Hi-BRIGHT-3
CUSTOM-6 (Hi-BRIGHT-3)
Get
Get
Increment
Decrement
Get
Increment
Decrement
14 (continued on next page)
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
CRC
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
FB FA
6B FB
9B FB
0B FA
C8 FA
08 FE
6E FE
BF FF
F4 FF
92 FF
43 FE
B0 FF
D6 FF
07 FE
4C FE
2A FE
FB FF
38 FF
5E FF
8F FE
C4 FE
A2 FE
73 FF
80 FE
E6 FE
37 FF
7C FF
1A FF
CB FE
0B F5
CB F8
9B F4
5B F9
6B F4
AB F9
3B F2
FB FF
AB F3
6B FE
5B F3
9B FE
C8 F5
34 F4
52 F4
83 F5
70 F4
16 F4
C7 F5
Action
01
01
01
01
02
02
04
05
02
04
05
02
04
05
02
04
05
02
04
05
02
04
05
02
04
05
02
04
05
01
01
01
01
01
01
01
01
01
01
01
01
02
02
04
05
02
04
05
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
Command Data
Type
Setting Code
80
80
80
80
80
90
90
90
91
91
91
92
92
92
93
93
93
94
94
94
95
95
95
96
96
96
97
97
97
B0
B0
B0
B0
B0
B0
B0
B0
B0
B0
B0
B0
B0
B1
B1
B1
B2
B2
B2
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
00
01
02
03
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
03
13
02
12
01
11
08
18
09
19
0A
1A
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
Operation Type
COLOR TEMP GAIN B
COLOR TEMP
OFFSET R
COLOR TEMP
OFFSET G
COLOR TEMP
OFFSET B
COLOR
COLOR Reset
TINT
TINT Reset
SHARPNESS
SHARPNESS Reset
MY MEMORY Load
Set
MY MEMORY Save
Set
PROGRESSIVE
Set
VIDEO NR
Set
ASPECT
Set
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
1
2
3
4
1
2
3
4
TURN OFF
TV
FILM
Get
LOW
MID
HIGH
Get
4:3
16:9
14:9
NORMAL
Get
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
CRC
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
8C F5
EA F5
3B F4
04 F5
62 F5
B3 F4
40 F5
26 F5
F7 F4
BC F4
DA F4
0B F5
B5 72
D3 72
02 73
80 D0
49 73
2F 73
FE 72
7C D1
F1 72
97 72
46 73
C4 D0
0E D7
9E D6
6E D6
FE D7
F2 D6
62 D7
92 D7
02 D6
4A 72
DA 73
2A 73
79 72
26 72
D6 72
46 73
85 73
9E D0
0E D1
CE D6
5E DD
AD D0
Action
02
04
05
02
04
05
02
04
05
02
04
05
02
04
05
06
02
04
05
06
02
04
05
06
01
01
01
01
01
01
01
01
01
01
01
02
01
01
01
02
01
01
01
01
02
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
Command Data
Type
Setting Code
B3
B3
B3
B5
B5
B5
B6
B6
B6
B7
B7
B7
02
02
02
0A
03
03
03
0B
01
01
01
09
14
14
14
14
15
15
15
15
07
07
07
07
06
06
06
06
08
08
08
08
08
30
30
30
30
30
30
30
30
30
30
30
30
22
22
22
70
22
22
22
70
22
22
22
70
20
20
20
20
20
20
20
20
22
22
22
22
22
22
22
22
20
20
20
20
20
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
01
02
03
00
01
02
03
00
01
02
00
01
02
03
00
00
01
09
10
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
(continued on next page)
15
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
Operation Type
OVER SCAN
OVER SCAN Reset
V POSITION
V POSITION Reset
H POSITION
H POSITION Reset
H PHASE
H SIZE
H SIZE Reset
AUTO ADJUST
COLOR SPACE
Set
COMPONENT
Set
C-VIDEO FORMAT
Set
S-VIDEO FORMAT
Set
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Get
Increment
Decrement
Execute
Execute
AUTO
RGB
SMPTE240
REC709
REC601
Get
COMPONENT
SCART RGB
Get
AUTO
NTSC
PAL
SECAM
NTSC4.43
M-PAL
N-PAL
Get
AUTO
NTSC
PAL
SECAM
NTSC4.43
M-PAL
N-PAL
Get
(continued on next page)
16
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
CRC
Action
91 70
F7 70
26 71
EC D9
0D 83
6B 83
BA 82
E0 D2
F1 82
97 82
46 83
1C D3
49 83
2F 83
FE 82
B5 82
D3 82
02 83
68 D2
91 D0
0E 72
9E 73
6E 73
FE 72
CE 70
3D 72
4A D7
DA D6
79 D7
A2 70
C2 74
52 75
52 70
62 77
C2 71
32 74
31 76
E6 70
86 74
16 75
16 70
26 77
86 71
76 74
75 76
02 00
04 00
05 00
06 00
02 00
04 00
05 00
06 00
02 00
04 00
05 00
06 00
02 00
04 00
05 00
02 00
04 00
05 00
06 00
06 00
01 00
01 00
01 00
01 00
01 00
02 00
01 00
01 00
02 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
02 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
02 00
Command Data
Type
Setting Code
09 22
09 22
09 22
27 70
00 21
00 21
00 21
02 70
01 21
01 21
01 21
03 70
03 21
03 21
03 21
02 21
02 21
02 21
04 70
0A 20
04 22
04 22
04 22
04 22
04 22
04 22
17 20
17 20
17 20
11 22
11 22
11 22
11 22
11 22
11 22
11 22
11 22
12 22
12 22
12 22
12 22
12 22
12 22
12 22
12 22
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
01
02
03
04
00
00
01
00
0A
04
05
09
02
08
07
00
0A
04
05
09
02
08
07
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
Operation Type
FRAME LOCK –
COMPUTER1
Set
FRAME LOCK –
COMPUTER2
Set
COMPUTER IN1
Set
COMPUTER IN2
Set
D-ZOOM
D-ZOOM Reset
D-SHIFT V
D-SHIFT V Reset
D-SHIFT H
D-SHIFT H Reset
KEYSTONE V
KEYSTONE V Reset
WHISPER
Set
MIRROR
Set
VOLUMECOMPUTER1
VOLUMECOMPUTER2
VOLUMECOMPONENT
VOLUME-S-VIDEO
TURN OFF
TURN ON
Get
TURN OFF
TURN ON
Get
SYNC ON G ON
SYNC ON G OFF
Get
SYNC ON G ON
SYNC ON G OFF
Get
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
BRIGHT
NORMAL
Get
NORMAL
H:INVERT
V:INVERT
H&V:INVERT
Get
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
Get
Increment
Decrement
(continued on next page)
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
CRC
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
3B C2
AB C3
08 C2
0B C3
9B C2
38 C3
CE D6
5E D7
0D D6
32 D7
A2 D6
F1 D7
D0 D0
B6 D0
67 D1
98 C9
2C D1
4A D1
9B D0
A8 C8
58 D0
3E D0
EF D1
54 C9
B9 D3
DF D3
0E D2
08 D0
3B 23
AB 22
08 23
C7 D2
57 D3
A7 D3
37 D2
F4 D2
CD CC
AB CC
7A CD
FD CD
9B CD
4A CC
01 CC
67 CC
B6 CD
75 CD
13 CD
C2 CC
Action
01
01
02
01
01
02
01
01
02
01
01
02
02
04
05
06
02
04
05
06
02
04
05
06
02
04
05
06
01
01
02
01
01
01
01
02
02
04
05
02
04
05
02
04
05
02
04
05
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
Command Data
Type
Setting Code
50
50
50
54
54
54
10
10
10
11
11
11
0A
0A
0A
70
0B
0B
0B
74
0C
0C
0C
75
07
07
07
0C
00
00
00
01
01
01
01
01
60
60
60
64
64
64
65
65
65
62
62
62
30
30
30
30
30
30
20
20
20
20
20
20
30
30
30
70
30
30
30
70
30
30
30
70
20
20
20
70
33
33
33
30
30
30
30
30
20
20
20
20
20
20
20
20
20
20
20
20
00
01
00
00
01
00
03
02
00
03
02
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
01
00
00
01
02
03
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
17
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
Operation Type
VOLUME-VIDEO
MUTE
Set
SPEAKER
Set
AUDIO-COMPUTER1
Set
AUDIO-COMPUTER2
Set
AUDIO-COMPONENT Set
AUDIO-S-VIDEO
Set
AUDIO-VIDEO
Set
REMOTE RECEIVE.
FRONT
Set
REMOTE RECEIVE.
TOP
Set
REMOTE FREQ.
NORMAL
Set
REMOTE FREQ.
HIGH
Set
Get
Increment
Decrement
TURN OFF
TURN ON
Get
TURN ON
TURN OFF
Get
AUDIO1
AUDIO2
AUDIO3
Turn off
Get
AUDIO1
AUDIO2
AUDIO3
Turn off
Get
AUDIO1
AUDIO2
AUDIO3
Turn off
Get
AUDIO1
AUDIO2
AUDIO3
Turn off
Get
AUDIO1
AUDIO2
AUDIO3
Turn off
Get
Off
On
Get
Off
On
Get
Off
On
Get
Off
On
Get
(continued on next page)
18
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
CRC
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
31 CD
57 CD
86 CC
46 D3
D6 D2
75 D3
FE D4
6E D5
5D D5
6E DC
9E DC
0E DD
FE DD
CD DD
5E DD
AE DD
3E DC
CE DC
FD DC
A2 DC
52 DC
C2 DD
32 DD
01 DD
D6 DD
26 DD
B6 DC
46 DC
75 DC
92 DD
62 DD
F2 DC
02 DC
31 DC
FF 32
6F 33
CC 32
47 33
D7 32
74 33
FF 3D
6F 3C
CC 3D
03 3C
93 3D
30 3C
Action
02
04
05
01
01
02
01
01
02
01
01
01
01
02
01
01
01
01
02
01
01
01
01
02
01
01
01
01
02
01
01
01
01
02
01
01
02
01
01
02
01
01
02
01
01
02
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
Command Data
Type
Setting Code
61
61
61
02
02
02
1C
1C
1C
30
30
30
30
30
34
34
34
34
34
35
35
35
35
35
32
32
32
32
32
31
31
31
31
31
00
00
00
02
02
02
30
30
30
31
31
31
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
20
26
26
26
26
26
26
26
26
26
26
26
26
00
00
00
00
01
00
01
00
00
01
02
03
00
00
01
02
03
00
00
01
02
03
00
00
01
02
03
00
00
01
02
03
00
00
00
01
00
00
01
00
00
01
00
00
01
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
LANGUAGE
Operation Type
Set
MENU POSITION H
MENU POSITION H Reset
MENU POSITION V
MENU POSITION V Reset
BLANK
Set
BLANK On/Off
Set
START UP
Set
ENGLISH
FRANÇAIS
DEUTSCH
ESPAÑOL
ITALIANO
NORSK
NEDERLANDS
PORTUGUÊS
SVENSKA
3ɍ&&.ɂɃ
SUOMI
POLSKI
TÜRKÇE
Get
Get
Increment
Decrement
Execute
Get
Increment
Decrement
Execute
MyScreen
ORIGINAL
BLUE
WHITE
BLACK
Get
TURN OFF
TURN ON
Get
MyScreen
ORIGINAL
TURN OFF
Get
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
CRC
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
F7 D3
67 D2
97 D2
07 D3
37 D1
A7 D0
57 D0
C7 D1
37 D4
A7 D5
37 DE
57 D5
C7 D4
F7 D6
67 D7
97 D7
07 D6
C4 D3
04 D7
62 D7
B3 D6
DC C6
40 D7
26 D7
F7 D6
A8 C7
FB CA
FB E2
CB D3
6B D0
9B D0
08 D3
FB D8
6B D9
C8 D8
CB CB
0B D2
9B D3
38 D2
Action
01
01
01
01
01
01
01
01
01
01
01
01
01
01
01
01
01
02
02
04
05
06
02
04
05
06
01
01
01
01
01
02
01
01
02
01
01
01
02
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
Command Data
Type
Setting Code
05
05
05
05
05
05
05
05
05
05
05
05
05
05
05
05
05
05
15
15
15
43
16
16
16
44
00
00
00
00
00
00
20
20
20
04
04
04
04
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
30
70
30
30
30
70
30
30
30
30
30
30
30
30
30
30
30
30
30
00
01
02
03
04
05
06
07
08
09
10
0A
0B
0C
0D
0E
0F
00
00
00
00
00
00
00
00
00
20
40
03
05
06
00
00
01
00
20
00
01
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
(continued on next page)
19
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
MyScreen LOCK
MESSAGE
AUTO SEARCH
AUTO ON
AUTO OFF
LAMP TIME
LAMP TIME Reset
FILTER TIME
FILER TIME Reset
MY BUTTON-1
Operation Type
Set
TURN OFF
TURN ON
Get
Set
TURN OFF
TURN ON
Get
Set
TURN OFF
TURN ON
Get
Set
TURN OFF
TURN ON
Get
Get
Increment
Decrement
Get
Execute
Get
Execute
COMPUTER1
COMPUTER2
COMPONENT
S-VIDEO
VIDEO
INFORMATION
MY MEMORY
PICTURE MODE
FILTER RESET
e-SHOT
VOLUME +
VOLUME AV MUTE
Get
(continued on next page)
20
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
CRC
Action
3B EF
AB EE
08 EF
8F D6
1F D7
BC D6
B6 D6
26 D7
85 D6
3B 89
AB 88
08 89
08 86
6E 86
BF 87
C2 FF
58 DC
C2 F0
98 C6
3A 33
FA 31
6A 30
5A 32
AA 32
FA 3E
9A 3F
0A 3E
3A 3C
5A 3D
CA 3C
3A 39
AA 38
09 33
01 00
01 00
02 00
01 00
01 00
02 00
01 00
01 00
02 00
01 00
01 00
02 00
02 00
04 00
05 00
02 00
06 00
02 00
06 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
01 00
02 00
Command Data
Type
Setting Code
C0 30
C0 30
C0 30
17 30
17 30
17 30
16 20
16 20
16 20
20 31
20 31
20 31
10 31
10 31
10 31
90 10
30 70
A0 10
40 70
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 36
00 00
01 00
00 00
00 00
01 00
00 00
00 00
01 00
00 00
00 00
01 00
00 00
00 00
00 00
00 00
00 00
00 00
00 00
00 00
00 00
04 00
05 00
02 00
01 00
10 00
12 00
13 00
14 00
16 00
17 00
18 00
19 00
00 00
RS-232C communication / Network command table (continued)
RS-232C communication / Network command table (continued)
Names
Operation Type
MY BUTTON-2
COMPUTER1
COMPUTER2
COMPONENT
S-VIDEO
VIDEO
INFORMATION
MY MEMORY
PICTURE MODE
FILTER RESET
e-SHOT
VOLUME +
VOLUME AV MUTE
Get
Get
Increment
Decrement
NORMAL
FREEZE
Get
OFF
IMAGE1
IMAGE2
IMAGE3
IMAGE4
Get
Execute
Execute
Execute
Execute
TURN OFF
TURN ON
AUTO
Get
CAPTIONS
TEXT
Get
1
2
3
4
Get
MAGNIFY
FREEZE
Set
e-SHOT
Set
e-SHOT IMAGE1 Delete
e-SHOT IMAGE2 Delete
e-SHOT IMAGE3 Delete
e-SHOT IMAGE4 Delete
CLOSED CAPTION Set
DISPLAY
CLOSED CAPTION
MODE
Set
CLOSED CAPTION
CHANNEL
Set
Header
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
BE
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
EF
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
03
CRC
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
06
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
C6
06
96
A6
56
06
66
F6
C6
A6
36
C6
56
F5
7C
1A
CB
83
13
B0
3A
AA
5A
CA
FA
09
71
35
C9
BD
FA
6A
9A
C9
06
96
35
D2
22
B2
82
71
32
30
31
33
33
3F
3E
3F
3D
3C
3D
38
39
32
D2
D2
D3
D2
D3
D2
C3
C2
C2
C3
C1
C3
C3
C3
C2
C3
62
63
63
62
63
62
63
62
62
63
61
63
Action
01
01
01
01
01
01
01
01
01
01
01
01
01
02
02
04
05
01
01
02
01
01
01
01
01
02
06
06
06
06
01
01
01
02
01
01
02
01
01
01
01
02
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
Command Data
Type
Setting Code
01
01
01
01
01
01
01
01
01
01
01
01
01
01
07
07
07
02
02
02
00
00
00
00
00
00
01
02
03
04
00
00
00
00
01
01
01
02
02
02
02
02
36
36
36
36
36
36
36
36
36
36
36
36
36
36
30
30
30
30
30
30
35
35
35
35
35
35
35
35
35
35
37
37
37
37
37
37
37
37
37
37
37
37
00
04
05
02
01
10
12
13
14
16
17
18
19
00
00
00
00
00
01
00
00
01
02
03
04
00
00
00
00
00
00
01
02
00
00
01
00
01
02
03
04
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
00
21
Hitachi, Ltd.
Consumer Business Group
Shin-Otemachi Bldg 5f, 2-1, Otemachi 2-Chome,
Chiyoda-Ku, Tokyo 100-0004 Japan
HITACHI EUROPE S.A.
364, Kifissias Ave. & 1, Delfon Str.
152 33 Chalandri
Athens
GREECE
Tel: 1-6837200
Fax: 1-6835694
Email: [email protected]
HITACHI EUROPE LTD.
Consumer Affairs Department
PO Box 3007
Maidenhead
Berkshire SL6 8ZE
UNITED KINGDOM
Tel: 0870 405 4405
Email: [email protected]
HITACHI EUROPE GmbH
Munich Office
Dornacher Strasse 3
D-85622 Feldkirchen bei München
GERMANY
Tel: 089-991 80-0
Fax: 089 - 991 80 -224
Hotline: 0180 - 551 25 51 (12ct/min.)
Email: [email protected]
HITACHI EUROPE S.r.l.
Via T. Gulli n.39
20147 MILAN
ITALY
Tel: 02 487861
Fax: 02 48786381
Servizio Clienti
Tel. 02 38073415
Email: [email protected]
HITACHI EUROPE S.A.S
Lyon Office
B.P. 45, 69671 Bron Cedex
FRANCE
Tel: 04 72 14 29 70
Fax: 04 72 14 29 99
Email: [email protected]
HITACHI EUROPE S.A.
Gran Via Carles III, 86 Planta 5ª
Edificios Trade - Torre Este
08028 Barcelona
SPAIN
Tel: 93 409 2550
Fax: 93 491 3513
Email: [email protected]
HITACHI EUROPE AB
Box 77
S-164 94 KISTA
SWEDEN
Tel: 08 562 711 00
Fax: 08 562 711 11
Email: [email protected]
HITACHI EUROPE LTD.
Norwegian Branch Office
Strandveien 18
1366 Dysaker
NORWAY
Tel: 02205 9060
Fax: 02205 9061
Email [email protected]
HITACHI EUROPE LTD.
Benelux Branche Office
Bergensesteenweg 421
1600 Sint-Pieters-Leeuw
BELGIUM
TEL : 0032/2 363 99 01
FAX: 0032/2 363 99 00
Email : [email protected]
www.hitachidigitalmedia.com

Documentos relacionados