baixe o livro de resumos noc
Сomentários
Transcrição
baixe o livro de resumos noc
Ӂ·∙Á CONTENTS Symposia e 3 Oral Presentations e 4 Posters e This document will be updated ¡'!9'9<#1-;$388'$ࣅ329;3-9!&38!z-9!&38!$8'!ࣅ='U9'8=-$'9 ,3;3#@,-¡-6;3<ø'8 97 SYMPOSIA COMING SOON ,3;3#@29'¡13&wø329'$! ORAL PRESENTATIONS ,3;3#@29'¡13&wø329'$! ID t ABSTRACT t ID t Table of Contents beryllina. Principales hospederos fueron Salix bonplandiana, Celtis caudata y Acacia schaffneri. Los principales dispersores, los mosqueros Tyrannus vociferans y Myiozetetes similis. Se encontró divergencia de caracteres de P. calyculatus en simpatría en HVWUXFWXUDVćRUDOHV\IUXWRVDV¯FRPRFDOLGDG\FDQWLGDGGH recompensas. El desplazamiento ecológico fue evidenciado en la diferenciación del ensamble de dispersores y hospederos. Ambos procesos, aunados a barreras post-cigóticas, permiten su coexistencia en simpatría con P. auriculatus. Oral Presentations 3 ABSTRACT t Biología reproductiva y polinización de Psittacanthus calyculatusen en alopatría y en simpatría con P. auriculatus Sergio Diaz Infante1*, Carlos Lara1, Maria del Coro Arizmendi1, Juan Francisco Ornelas2 ǢW2-='89-&!&!$-32!£<;Ö231!&'Ì?-$3TǣW29ধ;<;3&'$3£3+-!TWW r£'1'?-$!-2ǣӑ|+1!-£W$31 ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II Estudiamos biología reproductiva y polinización del muérdago Psittacanthus calyculatus en población alopátrica y simpátrica con P. auriculatus (en México) durante 2013-14. Aunque la biología reproductiva de P. calyculatus ya ha sido estudiada, no se había explorado si los caracteres ligados a polinización y dispersión de semillas divergen cuando co-ocurre en simpatría FRQFRQJ«QHUHV'HVFULELPRVIHQRORJ¯DćRUDOPRUIRORJ¯DGH ćRUHVIUXWRVVLVWHPDUHSURGXFWLYRSDWURQHVGHSURGXFFLµQ reposición de néctar, polinizadores, dispersores y hospederos. /RVUHVXOWDGRVLQGLFDQTXHODćRUDFLµQVHH[WLHQGHSRU meses durante el periodo de lluvias en ambas localidades. /DORQJLWXGGHĆODPHQWRV\SLVWLORVHQćRUHV\ODUJR\DQFKR de frutos, son mayores en la población simpátrica. El sistema de apareamiento predominante fue polinización cruzada. Promedios de cosecha en pie de néctar y concentración de azúcar fueron 9.6, 10.6 y 4.2 µl y de 16, 21 y 16o Brix para P. calyculatus en alopatría, en simpatría y para P. auriculatus, UHVSHFWLYDPHQWH(OSULQFLSDOYLVLWDQWHćRUDOHQDORSDWU¯D fue el colibrí Eugenes fulgens y en simpatría el colibrí Amazilia !+'S8!¡8'9'2;!ࣅ329 7 Using market data to assess the impact of the wild bird trade on bird populations David Wilcove1*, J. Berton Harris1 ǢW8-2$';322-='89-;@ r&>-£$3='|68-2$';32W'&< ORAL PRESENTATION SESSION 3: AVIAN CONSERVATION I The bird trade is increasingly seen as a major threat to bird populations. Within the Neotropics, where thriving domestic and international markets for wild birds persist, many restricted-range species are potentially at risk. However, the impacts of the trade on bird species are poorly known EHFDXVHĆHOGPRQLWRULQJRIZLOGSRSXODWLRQVLVH[SHQVLYH localized, and requires specialized expertise. Moreover, the PXOWLWXGHRIVSHFLHVWKDWDUHWUDGHGPDNHVLWGLIĆFXOWWR determine which species are in greatest need of monitoring. Here we present a new approach to assessing the impacts of the trade on wild bird populations, based on our research in Indonesia, which has a massive bird trade. We show that market data (price and volume trends for traded species) can {փdփTT ID t ABSTRACT t ID t be used to identify those bird species whose populations are likely declining due to the trade. Market data can identify species at risk well before they become globally endangered. 0RUHRYHUPDUNHWPRQLWRULQJLVPXFKOHVVH[SHQVLYHWKDQĆHOG monitoring. We explore how these techniques can be applied to the Neotropics and conclude with a recommendation for a two-step approach to assessing trade impacts: coordinated PDUNHWPRQLWRULQJIROORZHGE\ĆHOGVWXGLHVRIWKRVHVSHFLHV whose market signals indicate declining populations. 9 A multilocus analysis provides evidence for more than one species within Eugenes fulgens (Aves: Trochilidae) Luz E. Zamudio-Beltrán1*, Blanca E. Hernández-Baños1 ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3 rA#£<A'|,3;1!-£W$31 ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS The status of subspecies in systematic zoology is a subject of controversy. Recent studies use DNA sequences to evaluate the status of subspecies within species complexes, and to recognize and delimit species. The monotypic hummingbird genus Eugenes, distributed along the highlands from southwest USA to Central America, represents an interesting example of how the original subspecies descriptions could be underestimating the species taxonomy of a complex. We assessed the phylogenetic relationships, the taxonomic status and the species limits of the proposed subspecies of the taxon Eugenes fulgens (subspecies: fulgens, viridiceps and spectabilis). We performed a phylogenetic analysis using nuclear and mitochondrial markers (mtDNA: ND2, ND4, Control Region; nDNA: BFib, ODC, MUSK), and !+'¢S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents contrasted these data with the geographical distribution and the original morphological descriptions for the subspecies. Also, we assessed the species limits between the different groups using a coalescent approach implemented in the Bayesian Phylogenetics and Phylogeography software (BPP). We found genetic differences between the three groups, suggesting the existence of two cryptic species (E. fulgens and E. viridiceps) and one phenotypically differentiated species (E. spectabilis). Our analyses show that the E. viridiceps and E. fulgens groups are the most closely related of the three. 11 Establishing migratory connections using stable isotope atlassing Keith A. Hobson 2=-8321'2;!2!&! '-;,W3#932|'$W+$W$! ORAL PRESENTATION SESSION 7: MIGRATION AND SEASONAL VARIATION There is an urgent need to establish migratory connections between breeding, stopover and wintering grounds of migrant birds using the Neotropics. Despite recent advances in the use of transmitters and light-sensitive geolocators, this conservation need is severely hampered by logistical DQGĆQDQFLDOFRQVLGHUDWLRQV7KHGHYHORSPHQWRIPXOWL isotope feather ‘isoscapes’ for the Americas provides a new opportunity to provide coarse-scale assignment of birds to moult origins. In particular, the use of both stable-hydrogen and stable carbon isotope surfaces to delineate origins is showing considerable potential, especially for South America. 7KHPRVWFXUUHQWGHYHORSPHQWVLQWKLVĆHOGZLOOEHGHVFULEHG {փdփTT ID t ABSTRACT t ID t and migratory connections depicted for several Neotropical migrants wintering in Central America, the Caribbean and South America. Special focus will be placed on Barn Swallow (Hirundo rustica) for which results of stable isotope and light sensitive geolocator returns will be shown. Precipitationbased isoscapes for South America are less structured than North America and underline the more favorable use of species that grow feathers in North America before migration. However, we generally found good concordance between geolocator and isotope assignments for Barn Swallow that molts on the wintering ground. Preliminary analysis suggest that sulfur isotopes can be used to determine coastal regions. It is proposed that a coordinated isotopic atlassing project be established for the Palearctic-Neotropical migratory system. 12 Thomas A. W. Enright1*, T. Wayne Schwertner1, Heather A. Mathewson1, Jeffrey B. Breeden1, James P. Muir5 ǢW!8£';32;!;'2-='89-;@TǦW'?!9+8--(''9'!8$,!2&?;'29-32'2;'8 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION The white-tipped dove (WTDO; Leptotila verreauxi) is an elusive, resident Columbid that reaches its northernmost distribution in south Texas. Since its designation as a game species in 1984, there has been little effort directed toward monitoring or PDQDJLQJWKHVSHFLHV5HVHDUFKGHĆQLQJ:7'2RFFXSDQF\DQG distribution, critical to effective monitoring program design, has not been undertaken. The objectives of this study were to model WTDO detection probability and multi-scale habitat- !+'S8!¡8'9'2;!ࣅ329 Table of Contents occupancy, and predict species distribution. A time-of-detection protocol, incorporating playback methods, was used to quantify detection probability and occupancy of WTDO at 490 survey locations. Detection probability and habitat-occupancy models, integrating patch and landscape metrics, were developed through UNMARKED. The best generalized multi-mixture model resulted in an estimated detection probability of 0.82 that declined with ambient noise (8804; P=0.0001). Playback FDOOVVLJQLĆFDQWO\LQFUHDVHGGHWHFWLRQSUREDELOLW\W 3.20, P = 0.001). Through model averaging, riparian forest and citrus had the greatest occupancy probability, >0.80, while urban and wetland had the lowest, <0.40. Occupancy declined with distance to the nearest suitable patch, increased with the proportion of riparian forest and had a quadratic relationship with patch area, indicative that species occupancy was contingent upon the proximity of riparian habitat and citrus while negatively impacted by fragmentation. The model and distribution provide a foundation for species abundance assessment, guidance for future land management, and the development of a targeted monitoring program for WTDO. Detection probability, multi-scale occupancy, and distribution of the white-tipped dove in South Texas r;,31!9W'28-+,;|+3W;!8£';32W'&< ABSTRACT t 13 Where to Live in the Matrix: Avian Diversity in a Tropical Landscape Mosaic Diego Santiago-Alarcon1*, Ian MacGregorFors1, Fernando González-García1 ǢW29ধ;<;3&'$3£3+Ð! r&-'+3W9!2ধ!+3|-2'$3£W1? ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY Due to the current complexity of landscapes, considering their anthropogenic components in ecological studies can {փdփTT ID t ABSTRACT t provide a more solid groundwork to better understand their patterns and processes. We assessed bird species richness DQGFRPSRVLWLRQDWĆYHGLIIHUHQWHQYLURQPHQWDOFRQGLWLRQV (well-preserved cloud forest, peri-urban forest, urban forest, shade coffee plantation, cattle ranch) embedded in a landscape whose original vegetation was tropical montane cloud forest. We used 10 point-counts of 25 m radius at each location to census bird communities. Birds respond differently to the VWXGLHGHQYLURQPHQWDOFRQGLWLRQV:HUHFRUGHGVLJQLĆFDQW differences in species richness during the breeding season, but no differences during the wintering season. This results support the idea that during the wintering season, when habitat requirements for birds are less strict, species distribute homogeneously across the landscape, while species tend to be more selective and concentrate in original forests during the breeding season. Our community composition results show that vegetation structural traits play a more important role in determining bird communities than spatial aggregation does. Considering the limitations of our study, our results provide information suggesting that in order to make effective avian conservation in the region, it is crucial to adopt a dynamic scheme, taking into account temporal changes in both human-managed and non-managed systems. !+'£S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t 14 Spatial and seasonal variation of avian malaria infections in sites with different land uses within a neotropical montane forest matrix Table of Contents Carolina Hernández-Lara1*, Diego SantiagoAlarcon1, Fernando González-García1 ǢW29ধ;<;3&'$3£3+Ð!TWW r$!83£-2!,£ӑǦ|+1!-£W$31 ORAL PRESENTATION SESSION 18: AVIAN DISEASES Habitat destruction and seasonality can alter host-parasite interactions. The montane cloud forest of Veracruz State in Mexico has been transformed into agroecosystems and cities. Our aim was to determine how ecological parameters of avian malaria parasites responded to four different land use types (i.e., preserved cloud forest, periurban forest, urban forest, and coffee plantation) and to seasonality. We used microscopy and PCR to determine prevalence, parasitaemia, and aggregation of haemosporidians infecting the widespread chestnut-capped EUXVKĆQFK$UUHPRQEUXQQHLQXFKD:HSHUIRUPHG3&$ and cluster analyses to determine vegetation structure and similarity, and to investigate how vegetation variables are associated with parasitological parameters. Prevalence and parasitaemia of avian malaria were higher during the rainy season, while aggregation presented the opposite pattern. There was higher prevalence during the rainy season at sites with the least disturbance and land management (preserved cloud forest and periurban forest), while sites with urban effects and frequent land management (urban forest and coffee plantation) maintained similar prevalence values throughout the year. Infection by avian malaria was negatively associated with bush cover during the dry season. There was a higher {փdփTT ID t ABSTRACT t ID t likelihood of acquiring an infection and developing higher parasite loads during the rainy season in birds inhabiting the periurban and urban forests. Our results suggest that an increase in land use management reduces seasonal ćXFWXDWLRQVLQSDUDVLWHWUDQVPLVVLRQDQGWKDWLQIHFWLRQVFDQ be more severe for birds inhabiting urban environments. 21 Daniela Gomez1*, Luis Rivera1, Roman Ruggera1, Natalia Politi1 ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!&' </<@TT<T</<@T8+'2ধ2! ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES Los bosques de ribera son ambientes que proveen sitios de alimentación, reproducción, y rutas de paso para distintas especies. En general albergan una rica y abundante fauna en comparación con los ambientes no ribereños circundantes, en donde las aves son uno de los grupos más conspicuos. A la vez, las áreas circundantes son frecuentemente alteradas por actividades productivas. Dadas su importancia y proclividad a ser disturbados, y considerando que los estudios llevados a cabo en bosques de ribera de las Yungas Australes (YA) son escasos, nos proponemos: 1) describir el ensamble de aves de los bosques de ribera en cuanto a diversidad, riqueza y abundancia; y 2) analizar patrones de dichos ensambles en UHODFLµQDDVSHFWRVPLJUDWRULRV\JUHPLRVWUµĆFRVSUHVHQWHV Muestreamos seis bosques de ribera del sector norte de las Yungas del noroeste de Argentina mediante transectas de observación de 150m de largo (N=263) y redes de niebla !+'S8!¡8'9'2;!ࣅ329 Table of Contents (2673.3 h-red) durante la estación seca y húmeda. Detectamos un total de 207 especies de aves. Los ensambles de aves variaron estacionalmente por la presencia de especies migrantes latitudinales y altitudinales (similitud= 0,70%). El gremio de las aves insectívoras fue el más numeroso (49%). Tuvieron dominancia aquellas especies de aves características de bosques maduros de Yungas (50%). Registramos una especie categorizada como Vulnerable y una Casi Amenazada a nivel global y cuatro Amenazadas en Argentina. Nuestros resultados comprueban la importancia que tienen los bosques de ribera para las aves como refugio de invernada y veraneo, todo lo cual evidencia la prioridad de conservación de estos ambientes. Ensambles de aves de los bosques de ribera pedemontanos de las Yungas del noroeste de Argentina r1!&!2-'£!+31'A|+1!-£W$31 ABSTRACT t 28 Depauperate avian assemblages in Amazonian oil palm plantations Alexander C. Lees1*, Nárgila G. Moura1, Arlete S. Almeida1, Ima C. G. Vieira1 ǢW<9'<!8!'29'1У-33'£&r!£'?!2&'8£''9|#;36'2>38£&W$31 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION Amazonia, host to both the world’s largest remaining expanse of tropical forest and its richest avifauna is also subject to some of the planet’s highest absolute rates of forest loss and degradation. Expansion of oil palm plantations elsewhere in the humid tropics has precipitated massive loss of forest habitats and their associated speciose biotas and their expansion into north-east Brazil represents an emergent threat to Amazonian biodiversity. Understanding the direct and indirect impacts and concurrent conservation trade-offs of the expanding Amazonian oil palm plantation acreage, alongside other {փdփTT ID t ABSTRACT t dominant regional land-uses is thus critical for systematic conservation planning. We carried out bird surveys in oil palm plantations of varying ages and in both primary and secondary forests and cattle pastures in the Brazilian state of Pará. We found that oil palm plantations retained impoverished avian communities with a similar species composition to pastures and other non-forest land-uses and did not offer habitat for most forest-associated species, including those of national and international conservation concern. On the other hand, the forest remnants which the oil palm companies are legally obliged to protect, hosted a relatively species-rich community including several globally-threatened bird species, although these forest remnants already represent a shifted baseline. We consider oil palm to be no less detrimental to regional biodiversity than other agricultural land-uses and that political pressure exerted by large landowners to permit its legal substitution for native forest in private landholdings would have dire consequences for regional biodiversity. 31 Relationship between beak morphology and diet of three sympatric species of genus Sporophila “seedeaters” in coastal agroecosystems of Central Peru O.F. Cerron Sosa1*, L. Salinas Sanchez1, C. Arana Bustamante1 ǢW'6!8;1'2;3(82-;,3£[email protected]<9'<13(!;<8!£ -9;[email protected]!ধ32!£2-='89-;@3(!2!8$39 ID t ABSTRACT t Table of Contents related to the morphological characteristics of food. ThirtyĆYHGLJHVWLYHWUDFWVRIHDFKVSHFLHVRIVHHGHDWHUSporophila telasco, S. simplex and S. peruviana were analyzed in this study, obtained from samples collected between 2004-2012, during the dry and wet season in three agroecosystems (two in Ica and one in Lima). The composition of the diets was determined; the proportions of each food item and the weight weighted average of seed consumed for each seedeater were calculated. Furthermore, the relationship between beak morphology and diet of specimens of Sporophila telasco (n=12), S. simplex (n=15) and S. peruviana (n=14) was assessed, using samples from the bird collection of the Natural History Museum of San Marcos (only mature specimens were considered). Measurement of length, width, height and width of beak were taken from each one of the individuals. Pearson correlation analysis IRXQGDVLJQLĆFDQWUHODWLRQVKLS3EHWZHHQWKHZHLJKW weighted average of seeds consumed, and height and width of the beaks evaluated. The three species of genus Sporophila tended to segregate in the consumption of seeds with different weight. S. telasco frequently eats seeds from 0.12 to 0.62 mg, S. simplex usually consumes seeds between 0.40 and 2.22 mg, and S. peruviana most commonly eats seeds between 0.62 and 150 mg. The results indicate a possible mechanism of segregation in the use of resources, through selection by weight of seeds, which ultimately determines the coexistence. r39$i#6|,3;1!-£W$31 ORAL PRESENTATION SESSION 24: ECOMORPHOLOGY II The beak is the trophic apparatus with higher functional VLJQLĆFDQFHDQGLWVGLPHQVLRQDOYDULDWLRQVDUHGLUHFWO\ !+' S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 35 Time goes by: monitoring community diversity and bird longevity at a cloud forest in Colombia ID t ABSTRACT t Table of Contents that reveals that tropical monitoring is feasible and possible. Monitoring, along with biological studies in the tropics must be encouraged and enhanced to continue understanding diversity changes and life history characteristics. Maria Angela Echeverry-Galvis1*, Natalia1, Jorge Ahumada2, Sergio, Michaela Hau ǢW32ধ)$-!2-='89-&!&!='8-!2!TǣW329'8=!ধ322;'82!ধ32!£ r1!W'$,'='[email protected]+|/!='8-!2!W'&<W$3 ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS Monitoring is fundamental for biodiversity conservation; however, the Neotropics remain behindhand in this aspect. 7KHPDLQUHDVRQVDGGXFHGDUHLQVXIĆFLHQWIXQGLQJSRRU LQIUDVWUXFWXUHDQGGLIĆFXOWLHVLQJHWWLQJGDWDSXEOLVKHG:H present data from a bird monitoring initiative developed in a relict of cloud-mountain forest in Colombia. Data were gathered during two periods, 1999-2001 and 2008-2011, using mist netting. Birds were captured and banded to understand the regulation of life history events, and to assess community changes using mark-recapture techniques. A total of 64 species and 1248 individuals were captured. Diglossa albilatera and Cinnycerthia unirufa were, during both periods, the most DEXQGDQWVSHFLHVVSHFLHVFDSWXUHGGXULQJWKHĆUVWSHULRG were not captured during the second one; while other 10 new species were added in the second period. Community structure was analyzed with Whittaker plots (rank abundance) DQGVKRZHGVLJQLĆFDQWFKDQJHVRYHUSHULRGV,QGLYLGXDOV from &KORURVSLQJXVćDYRSHFWXV, Cinnycerthia unirufa, Atlapetes schistaceus, Arremon brunneinucha, Anisognathus igniventris, Diglossa cyanea, and Ochthoeca diadema were recaptured after more than 10 years of initial capture, indicating a high ORQJHYLW\DQGĆUVWOLIHVSDQUHFRUGVIRUPRXQWDLQ1HRWURSLFDO species. Despite multiple obstacles, we present a dataset !+'S8!¡8'9'2;!ࣅ329 39 Testing morphology as a predictor of foraging HFRORJ\DQGPLFURKDELWDWXVHLQD7\UDQWć\FDWFKHU (Tyrannidae) assemblage from northern Colombia Esteban Botero-Delgadillo1,2*, Nicholas Bayly1 ǢWV'9'!8$,(38$329'8=!ধ32-2;,''3;836-$9TǣW2-='89-&!&&',-£' r'#3;'83&|+1!-£W$31 ORAL PRESENTATION SESSION 24: ECOMORPHOLOGY II According to community ecology theory, morphology can be viewed as a correlate of ecological relationships among coexisting bird species. However, evidence for this relation comes from studies on bird communities rather than local assemblages, and mostly focused on temperate latitudes. In order to determine if this relation holds for Neotropical avifauna, we used three multivariate approaches to test the correspondence between morphological and foraging HFRORJ\GDWDLQD7\UDQWć\FDWFKHUDVVHPEODJHVSHFLHV in the Santa Marta Mountains, northern Colombia. (i) In two separate principal components analyses (PCA), we observed similar species ordinations when using morphological (wing length, tail length, beak size and shape, tarsus length) or foraging data (searching and attacking strategies). (ii) When using morphological traits as predictors in discriminant function analyses (DFA), 90% of all measured individuals (n = ZHUHFRUUHFWO\FODVVLĆHGLQSUHYLRXVO\GHĆQHGIRUDJLQJ categories. (iii) In canonical correlation analyses (CCA), we {փdփTT ID t ABSTRACT t ID t REWDLQHGDVLJQLĆFDQWFRUUHODWLRQEHWZHHQPRUSKRORJLFDO data and two independent datasets of search and attack behavior. These results demonstrate that morphology can accurately predict ecological relations in an assemblage of Neotropical tyrannids. It was also evident that the best predictors of foraging strategies and microhabitat use in this assemblage were bill size and shape, wing length, and tarsus length. Further studies should test ecomorphological relations in other Neotropical taxa, in order to identify subsets of phenotypic traits that could be used as a reliable proxy of ecological relationships of syntopic birds. 51 Ana Luiza Camargo Catalano !2!£<-A!$!;!£!23ǧ|+1!-£W$31 We examined in this study vocalizations of individuals of Thamnophilus doliatus from different locations across Latin America. Songs from 157 individuals were analyzed using the following variables: number of notes, patch duration, repetition rate, peak frequency, duration of the terminal note, and peak frequency of the terminal note. Since the occurrence of T. doliatus is widespread in Latin America, we expected that these variables would have a great variation among individuals. The songs were divided into sections to measure variation of repetition rate and frequency. The variables were correlated with geographic factors such as latitude, longitude, and elevation to examine geographic variation in !+'S8!¡8'9'2;!ࣅ329 Table of Contents acoustic patterns based on subspecies groups. The variables were strongly correlated with latitude, with individuals from equatorial locations having faster songs with more notes, a longer duration, and a terminal note that is lower in frequency. Also, an acoustic pattern in the peak frequency was observed ZLWKORQJLWXGH6HYHQVXEVSHFLHVZHUHLGHQWLĆHGEDVHGRQWKHLU geographic location. Among these, the songs of T. d. intermedius and T. d. radiatus ZHUHIRXQGWRGLIIHUVLJQLĆFDQWO\LQWKHQXPEHU of notes, section duration, repetition rate, and peak frequency. The recently elevated species Thamnophilus capistratus was DOVRH[DPLQHG\HWVLJQLĆFDQWYDULDWLRQZDVIRXQGRQO\LQ repetition rate, peak frequency, and in the terminal note. That song characteristics were more similar between different species (T. doliatus and T. capistratus) than among subspecies, it raises the question of whether more than one species is represented within T. doliatus as presently recognized. Variation in the song of Thamnophilus doliatus (Linnaeus, 1764) (Aves: Thamnophilidae) in different regions of Latin America ORAL PRESENTATION SESSION 12: BIOACOUSTICS II ABSTRACT t 53 The use of suboscines as biological indicators of forest fragment functional connectivity L. dos Anjos1*, G. M. Bochio1, B. R. Arakaki1, L. C. Calsavara1, J. D. Torezan1, H. R. Medeiros1, M. C. Ribeiro2, M. R. Lima1 ǢW2-='89-&!&'9;!&<!£&'32&8-2!TǣW2-='89-&!&'9;!&<!£!<£-9;! r££!2/39|9'8$31;'£W$31W#8 ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION We investigated if a particular group of suboscines could be considered an useful biological indicator in a fragmented Atlantic Forest landscape in southern Brazil. We tested if the suboscines group of antbirds-ovenbirds (G1), that comprises primarily of forest understory insectivorous birds, is a better ELRORJLFDOLQGLFDWRUWKDQW\UDQWć\FDWFKHUVWLW\UDV*ZKLFK {փdփTT ID t ABSTRACT t has a larger diet spectrum and occupancy of forest strata. We used point counts in a large block of continuous forest, the Iguassu National Park (INP), and in a fragmented forest landscape in the north of Paraná. We evaluated if species of G1 presented higher occupancy when compared to G2 in a 5 km transect of continuous forest in the INP. Moreover, we investigated variation in species richness of these two bird groups in 10 forest fragments across a forest cover gradient, which was measured using the following: fragment size, connectivity, vegetation quality and forest cover. A total of 29 species of G1 and 34 species of G2 were recorded in the continuous forest. G1 (12 species) presented a higher rate of full occupancy than G2 (6 species; Contingency Table, p = 0.037). G2 species did not respond to any of the measured variables, while G1 species richness increased with forest connectivity. We argue that the G1 is a useful biological indicator because species in this group: (1) tend to have high occupancy in continuous forest (2) tend to be more sensitive to functional connectivity among forest fragments, one of best predictors in fragmented landscapes. !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t 59 Effects of avian malaria on male behavior and female visitation in lekking Blue-crowned Manakins Table of Contents Mariane Bosholn1*, Alan Fecchio2, Patricia Silveira3, Érika (EMB) Braga3, Marina Anciães1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW$!&'[email protected](!;<8!£ $-'2$'93(8'?'£2-='89-;@TǤW2-='89-&!&' '&'8!£&'-2!9'8!-9 r#39,3£2W1|+1!-£W$31 ORAL PRESENTATION SESSION 18: AVIAN DISEASES Infection by blood parasites of the genus Plasmodium can affect survival and reproduction in the host, and may affect the expression of sexual selection traits. Although different studies highlight the association of parasitism with a decrease in reproductive success of hosts, it is still uncertain which ĆWQHVVFRPSRQHQWVDUHDIIHFWHGE\WKHSDUDVLWHV+HQFH few studies have addressed the role of parasites in honest signalling among lekking species. Here, we investigated if infection by Plasmodium spp. compromises rates of vocalization, dance and social interaction of male Blue-crowned Manakins (Lepidothrix coronata), and if it affects female preferences in a Central Amazon population. Behavioral observations coupled with molecular diagnosis to detect haemosporidian parasites revealed that infection by Plasmodium affected male activities, as well as female choice. Furthemore, despite similar visiting frequencies to both infected and uninfected males, they were more frequent to males that vocalized and danced more, which were more frequently not infected. Therefore, we suggest a role of male vocalization and dance rates as honest signals for females, indicating male immunity in the studied population. Thus, male exhibitions would function as an important signal for sexual selection, used by females as cues about the probability {փdփTT ID t ABSTRACT t ID t of a male being infected. Future studies testing the inheritance of female preferences and male behaviour rates will add to the understanding of the role of such behaviors in the evolution of mechanisms of female preferences with honest signals. 60 José Tomás Ibarra1*, Kathy Martin2 ǢW2-='89-;@3(8-ধ9,3£<1#-!{32ধ)$-!2-='89-&!&!;Õ£-$!&' ,-£'TǣW2-='89-;@3(8-ধ9,3£<1#-!{2=-8321'2;!2!&! ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY Conservation practices commonly focus on measures of species diversity that merely include information on species richness (i.e., taxonomic diversity). However, functional diversity (range, distribution and density of trait values of species in a community) should be more informative than taxonomic diversity as it measures those aspects of diversity that affect ecosystem function. Previous work in the northern hemisphere has shown that owls may act as surrogates for taxonomic diversity but little is known on their value as surrogates of functional diversity. We assessed the surrogacy reliability of two sympatric owls, 6WUL[UXĆSHV(habitat-specialist) and Glaucidium nana (habitat-generalist), in Andean temperate forests of southern Chile. During 2011-2013, we conducted 1,145 owl surveys, 505 avian point-transects and 505 vegetation surveys across 101 sites comprising a range of conditions from degraded habitat to structurally complex oldgrowth forest stands. We found that only 6WUL[UXĆSHVwas a !+'S8!¡8'9'2;!ࣅ329 Table of Contents reliable surrogate for both taxonomic and functional diversity measures, including the density of vulnerable avian guilds (e.g., bamboo understory users and large-tree users) and the degree of habitat-specialization of the avian community. We found that forest-stand structural complexity (sites with dense understory and availability of large trees) was the underlying mechanism driving the positive relation between forest-specialist owls and biodiversity. Our results show a tight association between habitat-specialist owls and avian functional traits that may be more informative than species richness to prioritize the conservation of stable, functioning ecosystems. Habitat-specialist owls, but not generalists, are reliable surrogates for taxonomic and functional diversity in Andean temperate forests r/ধ#!88!|<$W$£ ABSTRACT t 64 ¿La organización de la comunidad de colibríes es determinada por la dominancia agresiva? Lopez Segoviano Gabriel1*, Arizmendi MC1 ǢW !$<£;!&&'9;<&-39<6'8-38'9A;!$!£!T2-='89-&!& !$-32!£<;Õ231!&'Ì?-$3 r+£9'+3=-!23|,3;1!-£W$31 ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES Para los colibríes, la competencia por alimento es uno de los principales factores que determinan la organización de la comunidad. En este estudio, establecemos los mecanismos que determinan la organización de la comunidad de colibríes dentro de un corredor migratorio en el noroeste de México. Primero, establecemos el estatus de dominancia y su relación con el WDPD³RFRUSRUDOLGHQWLĆFDPRVVLODFRPXQLGDGGHFROLEU¯HVVH RUJDQL]µGHDFXHUGRDORVSDUFKHVćRUDOHVGRQGHVHDOLPHQWDQ y por último evaluamos si la energía disponible en cada parche podría determinar qué especies de colibríes tienen encuentros agresivos en ellos. Observamos el comportamiento de {փdփTT ID t ABSTRACT t ID t DOLPHQWDFLµQHQSDUFKHVćRUDOHVHQXQERVTXHWHPSODGR (QFDGDSDUFKHćRUDOUHJLVWUDPRVODVHVSHFLHVGHFROLEU¯HV el número de interacciones y el tiempo de alimentación. $GHP£VUHJLVWUDPRVODVHVSHFLHVGHSODQWDQ¼PHURGHćRUHV presentes y calculamos las calorías totales producidos en cada SDUFKHćRUDO1XHVWURVUHVXOWDGRVPRVWUDURQTXHODMHUDUTX¯D de dominancia en trece especies de colibríes (migratorias y residentes) se relacionó con su tamaño corporal. La distribución espacial de las especies de colibríes depende de la distribución de especies de las plantas de las que se alimentan y de la FDQWLGDGGHHQHUJ¯DSURGXFLGDSRUFDGDSDUFKHćRUDO$V¯ORV diferentes tipos de recursos y la dominación agresiva de las especies de colibríes establecen la distribución equitativa de las especies y reducen traslape en la explotación de recursos. 65 Alejandro Alarcón1*, Sam Shanee2 ǢW93$-!$-Õ2'3;836-$!£8-1!;'329'8=!ধ32'8ÚT ǣW'3;836-$!£8-1!;'329'8=!ধ32 ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR La Lechucita Bigotona (Xenoglaux loweryi) es un estrígido endémico del Perú y en peligro de extinción. Habita en los bosques montanos húmedos de la Cordillera Oriental de los Andes, entre la región Amazonas y San Martín. La información sobre su ecología e historia natural es limitada, siendo el motivo de esta investigación conocer su abundancia poblacional, vocalización por medio de sonogramas y dieta a través de heces. El monitoreo se realizó entre febrero !+'S8!¡8'9'2;!ࣅ329 Table of Contents y agosto de 2014, en La Jalca y El Toro (Yambrasbamba, Amazonas). La abundancia poblacional se estimó por el método de conteo de puntos, apoyado de la provocación auditiva; las respuestas fueron grabadas y analizadas con el programa Avisoft-SASLab Pro 5.2.09; y se colectó heces. La DEXQGDQFLDUHODWLYDIXHs\sLQGNPSDUD El Toro y La Jalca respectivamente, cantidad considerada teniendo en cuenta que es rara. Se describieron dos tipos de vocalizaciones emitidos por un individuo en respuesta a vocalizaciones pregrabadas, el canto conocido (territorial) y un nuevo canto (probablemente de inspección), los análisis demuestran que las frases recurrentes de ambos cantos GLĆHUHQHQVXFRPSRVLFLµQUHJLVWURTXHDPSO¯DHOUHSHUWRULR YRFDOFRQRFLGR(QHODQ£OLVLVGHKHFHVVHLGHQWLĆFDURQUHVWRV de insectos del orden Coleoptera, Orthoptera e Hymenoptera; tipo de dieta que se observa en otros pequeños estrígidos como Micrathene whitneyi, Megascops barbarus y Megascops choliba. Futuras investigaciones en las estaciones biológicas de la ONG Neotropical Primate Conservation, servirán como herramientas en la toma de decisiones para su conservación. Estudios preliminares sobre la ecologia de la lechucita bigotona Xenoglaux loweryi r!£'/!2&83!£!8$326!8&3|+1!-£W$31 ABSTRACT t 67 Evolution of climatic niches in newworld warblers (Parulidae) Camila Gomez1*, Elkin Tenorio1, Daniel Cadena1 ǢW!#38!;38-3&'-3£3+-!=3£<ধ=!&''8;'#8!&39T2-='89-&!&&'392&'9 r$W+31'AǢǤ|<2-!2&'9W'&<W$3 ORAL PRESENTATION SESSION 23: AVIAN DISTRIBUTIONS AND GLOBAL CHANGE Differences in life-history attributes between tropical and temperate lineages are often attributed to differences in their {փdփTT ID t ABSTRACT t climatic niche dynamics. For example, the more frequent appearance of migratory behaviour in species breeding in the temperate zone than in species originally breeding in the tropics is believed to have resulted partly from tropical climatic stability and niche conservatism constraining tropical species from shifting their ranges. However, little is known about the patterns and processes underlying climatic niche evolution in migratory and resident animals. We evaluated the evolution of overlap in climatic niches between seasons and its relation to migratory behaviour in the Parulidae. We used ordination methods to measure seasonal niche overlap of 55 resident and 48 migratory species and phylogenetic comparative methods to assess patterns and modes of climatic niche evolution. We found that despite travelling up to thousands of kilometers, migrants track climatic conditions across the year to a greater extent than tropical residents, which results in different modes of niche evolution in migrants and residents. This pattern contradicts the hypothesis of greater niche conservatism constraining tropical species from range-shifting and suggests that other factors are likely involved in shaping the evolution of migration in tropical and temperate lineages. The long-held notion that tropical species are more sensititive to climatic change than their temperate-zone counterparts due to more constrained niches may not apply to cases in which temperate-breeding species escape climatic extremes via migratory behaviour. !+'¢S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t 71 Biologia reprodutiva de Rhopias gularis (Passeriformes:Thamnophilidae) no Sudeste do Brasil Table of Contents Daniel F. Perrella1*, Carlos H. Biagolini-Jr.1, Lais RibeiroSilva1, Paulo V. Q. Zima1, Mercival R. Francisco1 ǢW !8f2-='89-&!&' '&'8!£&'È3!8£39 r&(6'88'££!|+1!-£W$31 ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I Poucos estudos com parâmetros de história de vida têm sido realizados com aves da Mata Atlântica. Neste estudo, são apresentadas as primeiras informações sobre a reprodução de Rhopias gularis, espécie endêmica da Mata Atlântica brasileira. O trabalho foi conduzido no Parque Estadual Carlos Botelho, um remanescente que abrange 37.644 ha de Mata Atlântica no estado de São Paulo. Ao longo de dois períodos reprodutivos HIRUDPHQFRQWUDGRVQLQKRVDWLYRV que foram monitorados periodicamente. Como resultado, os SHU¯RGRVGHLQFXED©¥RHSHUPDQ¬QFLDGRVĆOKRWHVQRQLQKR duraram 16,8 ± 0,6 e 11,0 ± 0,86 dias, respectivamente. Atividades de atendimento ao ninho, tais como incubação, retirada do saco fecal, alimentação e aquecimento dos ninhegos foram divididas igualmente entre os sexos, sendo que nenhum investe mais tempo do que o outro em nenhuma atividade. Há indícios de que a escassez de chuvas durante a primeira WHPSRUDGDSRGHWHULQćXHQFLDGRWDQWRRVXFHVVRTXDQWRR início das atividades reprodutivas. Embora o tamanho das ninhadas de R. gularis (n = 2) esteja de acordo com o padrão comum para aves tropicais, o alto sucesso reprodutivo estimado SHODSUREDELOLGDGHGHVREUHYLY¬QFLDGHQLQKRVGH0D\ĆHOG (56,6%) não corrobora com a hipótese de que haveriam taxas de predação de ninhos mais altas nos trópicos, a qual {փdփTT ID t ABSTRACT t ID t favoreceria ninhadas menores, indicando que esse paradigma ainda permanece mal esclarecido. Dessa forma, estudos com mais espécies da região, em áreas preservadas, poderiam contribuir para o entendimento de adaptações reprodutivas e de história de vida dos Passeriformes da Mata Atlântica. 73 ABSTRACT t Table of Contents diversidade (P<0.001) em todas as áreas, sem diferenças entre elas. Amostramos um total de 143 espécies de aves consumidoras de artrópodes, porém as diferenças de IPA HQWUHDV£UHDVQ¥RLQćXHQFLRXRUHVXOWDGRGRH[SHULPHQWR Dessa forma, a ausência das aves afetou diretamente as SRSXOD©·HVGHDUWUµSRGHVRTXHSRGHULDLQćXHQFLDURVQ¯YHLV de herbivoria e a produtividade vegetal. Ao mesmo tempo, a similaridade das áreas pode indicar que áreas perturbadas (sede) próximas de áreas conservadas (estágio avançado de sucessão), mesmo perdendo espécies insetívoras especialistas, podem manter esse serviço, uma vez que aves generalistas e insetívoras eventuais garantiriam esse papel funcional. Efeitos da avifauna insetívora na abundância e diversidade de artrópodes Bruna L. Gagetti1,2*, Suelen B.M. Rodrigues1, Augusto J. Piratelli1 ǢW2-='89-&!&' '&'8!£&'È3!8£39ǣW <2&!%È3!87<' 33£Õ+-$3&'È3!<£3 r#8<2!W+!+'ষ|+1!-£W$31 ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET As aves contribuem para diversos tipos de serviços ambientais como o controle de populações de artrópodes, tendo um importante papel na regulação de processos ecológicos. Avaliamos o papel das aves na abundância e diversidade de artrópodes em diferentes ambientes em uma área de Mata Atlântica. O estudo foi realizado entre outubro de 2013 e outubro de 2014 em três áreas do Parque Estadual Carlos Botelho (SP), Brasil (sede e estágios inicial e avançado de sucessão). Restringimos o acesso das aves em ramos vegetais utilizando redes de exclusão em 48 indivíduos de Melastomatacea durante quatro meses, com duas réplicas (estações chuvosa e seca). Os artrópodes foram coletados pelo método branch clipping nos ramos com redes e controle. Paralelamente, foi feita a amostragem PHQVDOGDDYLIDXQDSRUPHLRGHSRQWRVĆ[RV2VGDGRV foram analisados por regressão múltipla. A presença das UHGHVGHH[FOXV¥RUHVXOWRXHPXPDXPHQWRVLJQLĆFDWLYR tanto da quantidade de artrópodes (P=0,01) quanto da !+'S8!¡8'9'2;!ࣅ329 78 Conducta exploratoria y migración en Zonotrichia capensis Yanina Y.P. Poblete1*, Victor V.G. Gutierrez1, Valezca V.C. Cid1, Cristobal C.V. Venegas1, Pablo P.S. Sabat1, Rodrigo Vasquez1 ǢW29ধ;<;3&'$3£3+Ð[email protected]&-='89-&!&T'6!8;!1'2;3&'-'2$-!9 $3£Õ+-$!9T !$<£;!&&'-'2$-!9T2-='89-&!&&',-£'T!2ধ!+3T,-£' [email protected]!2-2!63#£';'7|+1!-£W$31 ORAL PRESENTATION SESSION 7: MIGRATION AND SEASONAL VARIATION Cuando las especies presentan amplios rangos de distribución, es probable observar grupos de individuos que se encuentran sometidos a diferentes presiones de selección, las cuales pueden conducir a la evolución de diferentes estrategias adaptativas en base a las condiciones ambientales locales. $OJXQDVGHHVWDVGLIHUHQFLDVSXHGHQUHćHMDUVHHQDVSHFWRV morfométricos y conductuales o incluso generar que aquellos grupos que se encuentran en ambientes extremos, migren. Considerando estos antecedentes, se caracterizaron rasgos {փdփTT ID t ABSTRACT t morfométricos y conductuales de dos poblaciones de la especie Z. capensis, una de alta altitud (Farellones 2400 m s.n.m) y otra de baja altitud (Rinconada 600 m s.n.m.). Además, VHUHDOL]DURQFHQVRVHQ)DUHOORQHVFRQHOĆQGHHYLGHQFLDU la posible migración en esta población, propiciada por las condiciones ambientales extremas propias del sector. Se UHDOL]DURQDQ£OLVLVLVRWµSLFRVFRQHOĆQGHUHVSDOGDUHVWH registro. Los resultados muestran que existen diferencias PRUIRP«WULFDV\FRQGXFWXDOHVVLJQLĆFDWLYDVHQWUHDPERV grupos, siendo los individuos de Farellones de mayor tamaño corporal y más exploradores en relación a los de Rinconada. Junto con ello, hemos observado una disminución sostenida de individuos en Farellones, sin avistamientos durante el invierno. Los análisis isotópicos muestran que probablemente este grupo se desplaza a sectores de menor altitud después de la reproducción. En base a nuestros resultados podemos concluir que individuos de la misma especie pueden presentar diferencias morfológicas y conductuales LQćXHQFLDGDVSRUGLIHUHQWHVSUHVLRQHVDPELHQWDOHVJHQHUDQGR LQFOXVRSURFHVRVGHPLJUDFLµQDQLYHOVXEHVSHF¯ĆFR 79 Seleção Sexual e os riscos de extinção em paisagens fragmentadas Cristina M Silva1*, Érica Hasui1, Luis A Beijo1 ǢW2-='89-&!&' '&'8!£&'£('2!9 rধ2!W1!+!£,!'9W9-£=!|+1!-£W$31 ID t ABSTRACT t Table of Contents em conectar a paisagem para elas, visto seu maior risco de predação. Realizamos coletas de presença, através da técnica de focal, em 79 árvores em pastos de 8 paisagens. As espécies encontradas foram: Colaptes campestris, Cyanocorax chrysops, Fluvicola nengeta, Furnarius rufus, Thraupis sayaca, 6LFDOLVćDYHROD6\QDOOD[LVVSL[L=RQRWULFKLDFDSHQVLV7XUGXV leucomelas, Megarynchus pitanguá, Pitangus sulphuratus, Turdus UXĆYHQWULV7DQJDUDFD\DQD(ODHQLDPHVROHXFD6DOWDWRUVLPLOLV Cyclarhis gujanensis, Chiroxiphia caudata, Saltator fuliginosus, $QWLORSKLDJDOHDWD0LRQHFWHVUXĆYHQWULV3HQHORSHREVFXUD Pyroderus scutatus, Schiffornis virescens, Tachyphonus coronatus, Trogon surrucura, Platyrinchus mystaceus. Os melhores modelos (dAIC<2; weight=0,6704) mostram que dicromatismo (p<0,001) inibe a presença dessas espécies, porque elas são mais conspícuas aos predadores, especialmente em áreas com pouca cobertura vegetal. Além disso, a altura da árvore (p<0,001) aumenta sua presença, pois também aumenta a visibilidade da paisagem. A porcentagem de mata na paisagem é favorável a presença delas, pois aumenta a permeabilidade da matriz (i.e aumenta cobertura vegetal). Predadores e a distância das árvores ao fragmento diminuem a presença delas. Concluímos que essas espécies podem sofrer com maiores efeitos de isolamento, como DDXV¬QFLDGHPHWDSRSXOD©·HVYLVWRTXHDHĆFL¬QFLDGH conectores de paisagem para elas é reduzida. Portanto, elas tem maiores riscos de sucumbir a vórtices de extinção. ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION Traços sexuais podem diminuir a sobrevivência da espécie, pois existe uma relação antagônica entre seleção sexual e QDWXUDO$VVLPVWHSSLQJVWRQHVSRGHULDPVHUPHQRVHĆFLHQWHV !+'£S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 95 Frugivoría por aves en Byrsonima crassifolia(Malpighiaceae): comparación en sus formas cultivada y silvestre ID t r-&!8!Ǩ|,3;1!-£W$31 ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET El consumo de frutos por las aves involucra, en la mayoría de los casos, una relación mutualista planta-frugívoro; diversos factores intervienen en esta relación y en el proceso de selección, tales como: el tamaño, color y morfología del fruto, su calidad nutricional, abundancia y disposición. Poco se conoce sobre cómo las aves frugívoras interaccionan con las especies vegetales en áreas de cultivo que tienen representantes en elmedio silvestre. El objetivo de este trabajo fue determinar las diferencias y similitudes en la frugivoría de aves entre las formas silvestres y cultivadas del nanche (Byrsonima crassifolia). Se llevaron a cabo observaciones focales sobre árboles silvestres y cultivados, con un total de 216 horas de registro. Se estimó XQ¯QGLFHGHGLYHUVLGDGGH6KDQQRQVLJQLĆFDWLYDPHQWHPD\RU en el sistema silvestre que en el cultivado (p<0.05). En ambos sistemas, la especie Turdus grayi registró la mayor abundancia. 6HUHJLVWUµXQWLHPSRSURPHGLRVLJQLĆFDWLYDPHQWHPD\RUHQ el consumo individual de frutos en el sistema cultivado (85.9 ± 47.46 min vs. 45.7 ± 21.18 min, respectivamente; p<0.01). El WDPD³RSURPHGLRGHORVIUXWRVIXHVLJQLĆFDWLYDPHQWHGLIHUHQWH !+'S8!¡8'9'2;!ࣅ329 Table of Contents (p<0.001), aunque no se registraron diferencias respecto al promedio de frutos consumidos en ambos sistemas. El análisis químico mostró que los frutos silvestres ofrecen un mayor contenido proteico y de grasas que los frutos cultivados. Con base en el tamaño y en el número de frutos enteros consumidos, se registró una mayor efectividad de dispersión de las semillas de los frutos silvestres que de los cultivados. Rosa Idania Arteaga-Acosta1*, Jorge E. MoralesMávil2, Mauro Galleti3, Laura T. Hernández-Salazar2, Víctor Rico Gray2, Armando Martínez-Chacón2 ǢW39+8!&3'2'<83';3£3+Ð!T2-='89-&!&'8!$8<A!2!T ǣW!#W-3£3+Ð!&'£31638;!1-'2;3T29ধ;<;3&''<83';3£3+Ð!T 2-='89-&!&'8!$8<A!2!TǤW!#38!;38-3-3£3+Ð!&!329'8=!%È3T '6!8;!1'2;3&'$3£3+-!T2-='89-&!&'9;!&<!£!<£-9;! ABSTRACT t 98 Noise and social environment affects males reproductive calls in Zonotrichia capensis: ,QWUDVSHFLĆFYDULDELOLW\RUSODVWLFLW\" Mauricio Soto-Gamboa1*, Andrés SIlva-Escobar1, Yesenia Uribe1, Rodrigo Alvar1 ǢW29ধ;<;3&'-'2$-!91#-'2;!£'[email protected]=3£<ধ=!9T !$<;£!& &'-'2$-!9T2-='89-&!&<9;8!£&',-£' r1893;3|<!$,W$£ ORAL PRESENTATION SESSION 8: BIOACOUSTICS I Recent studies recognize environmental noise as one of several important factors affecting avian acoustic communication. In urban areas low-frequency anthropogenic noise is likely to mask sound transmission. Birds respond in three different ways to environmental noise: by increasing the song amplitude (the Lombard effect), by raising the frequency of the sound above that of background noise, and by reducing interference by singing during the quiet periods of day. In oscine birds, VRFLDOLQćXHQFHRQVRQJLVFORVHO\DVVRFLDWHGZLWKDOHDUQLQJ SURFHVVDQGUHODWHGWRWKHLQćXHQFHRIWXWRUV\HWKLJKO\ stereotyped adult songs are assumed. In this work we analyzed note shape and spectral cues of male reproductive songs in Zonotrichia capensis. We evaluated repertoire size {փdփTT ID t ABSTRACT t and individual variability of song structure as it relates to environmental noise and abundance. We recorded 5 min of VSRQWDQHRXVVRQJIURPLQGLYLGXDOPDOHVDQGTXDQWLĆHG environmental noise and abundance in the city of Valdivia, Chile. We also captured, marked, and released 10 individuals, each of which were recorded six different times following the same protocol. We analyzed these songs using Multiple Lineal Regression and Quantile Regression. Results suggest that environmental noise affects both maximum frequency and song modulation, and a homogenization of song cues in high abundances. Finally we found high variation among individuals in repertoire size and songs cues. These results suggest a high capacity by male Z. capensis to respond to variation to environmental factors through both plasticity and interindividual variation in response to environmental challenges. 104 Assessing Atlantic Forest patches in fragmented agricultural landscapes through a local birdbased index of biotic integrity Eduardo R. Alexandrino1*, Evan R. Buechley2, James R. Karr3, Cagan H. Sekercioglu2, Katia M.P.M.B. Ferraz1, Hilton T.Z. Couto1 ǢW9$3£!<6'8-38&'+8-$<£;<8![<-A&'<'-83A\T2-='89-&!&'&'È3 !<£3fcTǣW2-='89-;@3(;!,TǤW2-='89-;@3(!9,-2+;32 ID t ABSTRACT t Table of Contents managers in the forest habitats assessment through bird community data. So, we developed and tested a bird-based Index of Biotic Integrity (IBI) to assess forest habitat quality of 8 patches (3-115ha) located on HML in Southeast Brazil and compared it against classical approach (general species richness and abundance, Shannon´s Diversity Index). After 1-year VDPSOLQJVSHFLHVZHUHLGHQWLĆHGIURPZKLFKFRPSRVHG candidate metrics. The IBI approach uses existing relationships between candidate metrics and habitat quality rank (HQR) to determine the best indicators and then assign an index for each studies site. Our HQR integrated history of forest degradation and landscape features. Seven metrics clearly associated with HQR were included in our IBI (richness of: threatened species and forest-non-forest species; abundance of: endemic species, small understory-midstory insectivorous, forest species, non-forest species and midstory foragers). They described the general conditions of the forest patch, the lower strata quality and patch suitability for ecosystems services. The IBI ranged of 1.28 in the worst forest sites up to 7.39 in the best, and showed high linear relationship with HQR while classical approaches did not. Although use of bird-based IBI in Atlantic Forest has been limited, our results suggest that it is a promising approach to pinpoint sites for conservation in HML. r'&<!8&3!£'?!2&8-23|,3;1!-£W$31 ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION Much of the Atlantic Forest has been converted to humanPRGLĆHGODQGVFDSHV+0/\LHOGLQJVPDOODQGLVRODWHGIRUHVW patches surrounded by agricultural matrices. A variety of DQWKURSRJHQLFLQćXHQFHVRQWKH+0/PDNHWKHVHSDWFKHV heterogeneous and with altered natural dynamics, hindering !+' S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 108 Expansion or extinction: the role of competition in population trend of Chilean Woodstar (E. yarrellii) and the Peruvian Sheartail (T. cora) ID t ABSTRACT t Table of Contents 114 0 DUJLQDOYHJHWDWLRQGLIIHUHQWO\LQćXHQFHVIDFHWVRI functional diversity in waterbird assemblages Bia A Almeida1*, Luiz dos Anjos2 Ilenia Lazzoni Traversaro1*, Wouter F.D. van Dongen2, Cristián F. Estades1 ǢW2-='89-&!&'9;!&<!£&'!8-2+ÆTǣW2-='89-&!&'9;!&<!£&'32&8-2! ǢW2-='89-&!&&',-£'U='9,-£'lmTǣW29ধ;<;'(38<9;!-2!#-£-;@ !2&223=!ধ32T3££'+'3(2+-2''8-2+!2&$-'2$'T-$;38-!2-='89-;@ r#-!£1'-&!Ǣӑǣ|,3;1!-£W$31 r-£'2-!£!AA32-|+1!-£W$31 Waterbirds depend upon wetlands and provide many ecological services, contributing to the maintenance of environmental functioning. Comprehending how HQYLURQPHQWDOFKDUDFWHULVWLFVLQćXHQFHZDWHUELUGIXQFWLRQDO diversity is essential for conservation measures, such as restoration of degraded systems. Here, we seek to understand KRZYHJHWDWLRQLQćXHQFHVGLIIHUHQWIDFHWVRIZDWHUELUG functional diversity and taxonomic richness. We sampled birds along transects around 22 lagoons at the high Paraná 5LYHUćRRGSODLQ0DUJLQFRYHUDJHSHUFHQWDJHRIWHUUHVWULDO and aquatic vegetation types was measured. Taxonomic richness; and functional richness, evenness and divergence were calculated for each lagoon. We analyzed data through regression trees. For richness measures, shrubs were the key determinants for the assemblies. For lower shrub percentages, in both cases, the absence of aquatic vegetation determined richness, and, for highest shrub values, shrub percentage was again a key descriptor. For functional evenness, percentage of emergent macrophytes was the key determinant. For higher HPHUJHQWPDFURSK\WHSHUFHQWDJHVćRDWLQJPDFURSK\WHV were the best descriptor. At last, for functional divergence, the absence of aquatic vegetation was the best descriptor. For higher absence values, tree percentage was also a key determinant. Thus, taxonomic and functional richness are ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS The Chilean Woodstar (Eulidia yarrellii) and the Peruvian Sheartail (Thaumastura cora) are two hummingbird species that have coexisted in the valleys of northern Chile since the arrival of the sheartails in the 1970s. During this time the abundance of sheartails have increased, while woodstars have dramatically declined and have been declared endangered by the IUCN since 2011. It has been suggested that the Peruvian Sheartail’s population increase may have had a negative effect on the abundance of Chilean Woodstars. 8VLQJERWKEHKDYLRXUDOREVHUYDWLRQVDQGĆHOGH[SHULPHQWV the aim of this study was therefore to test this hypothesis by quantifying the aggressiveness and territorial competitive interactions between the two species, and testing whether sheartails have a greater reproductive output. Overall, the results suggest that the Peruvian Sheartail may contribute to the decline in the population of Chilean Woodstar, not via a greater competitive ability, but probably via a higher UHSURGXFWLYHFDSDFLW\DQGHIĆFLHQF\RILWVWHUULWRULDOGHIHQVH strategy. Understanding the dynamics of the interactions between the two species will form a crucial component for conservation management plans for the threatened woodstars. !+'S8!¡8'9'2;!ࣅ329 ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY {փdփTT ID t ABSTRACT t described by the same vegetation types. However, vegetation W\SHVGLIIHUHQWO\LQćXHQFHIXQFWLRQDOGLYHUVLW\IDFHWV7KLV shows that different facets of diversity are driven by different variables, which must be considered for the maintenance not only of waterbird assemblies, but also of ecosystem functioning. 117 Is call repertoire structure correlated to social strategies in the New World jays? A review on functional allocation of calls ID t ABSTRACT t Table of Contents WKDWIRUPODUJHUćRFNVGXULQJWKHEUHHGLQJVHDVRQDOVRKDYH more calls dedicated to functional classes of Courtship + Social Integration. The opposite pattern was found regarding calls GHGLFDWHGWR&RQćLFW5HVROXWLRQVXJJHVWLQJWKHH[LVWHQFH RIDWUDGHRIIEHWZHHQFRQćLFWDQGDIĆOLDWLRQYRFDOEHKDYLRU regardless of overall repertoire size. Given this we emphasize the importance of achieving detailed data on the poorly known life history, social systems and call repertoires of the New World jays to advance on the comprehension of how social behavior and call repertoires evolved and mutually adapted. Gabriel L. M. Rosa1*, Jesse Ellis2, Luiz dos Anjos1 ǢW2-='89-&!&'9;!&<!£&'32&8-2!TǣW3'3££'+' r+W839!W#-3|+1!-£W$31 ORAL PRESENTATION SESSION 8: BIOACOUSTICS I Signal repertoires can differ even between closely related VSHFLHVDQGPDQ\IDFWRUVPD\LQćXHQFHLWVVL]HDQGFRPSOH[LW\ in animal societies, but of these, social and mating systems have been considered of great importance. We propose a review and standardization on the terminology based on currently available call repertoire descriptions of 12 species of New World Jays. By literature review we summarized 19 different call functions and termed it as “functional types”. We DOVRFDWHJRUL]HGFDOOVLQWRĆYHIXQFWLRQDOFODVVHVZKLFKZH considered a conservative approach for consistently compare signal repertoires across species. The functional classes are: 6RFLDO,QWHJUDWLRQ&RQćLFW5HVROXWLRQ3UHGDWRUUHODWHG Courtship and Pair & Parental-related. Trough GLM selection we tested for correlation between social traits obtained IURPWKHOLWHUDWXUHDQGWKHĆUVWWZRSULQFLSDOFRPSRQHQWV based on the proportion of calls each species dedicates to the functional classes we established. We found that species !+'S8!¡8'9'2;!ࣅ329 119 The response of Setophaga ceruleato different forest treatments: Preliminary results from a long-term study Kamal Islam1*, Claire Nemes1 ǢW!££;!;'2-='89-;@ r0-9£!1|#9<W'&< ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III Monitoring responses of migratory songbirds to different forest treatments is needed to establish informed management decisions. This information is especially important for species with precipitous declines in populations, such as the Cerulean Warbler (Setophaga cerulea), a long-distance Neotropic-Nearctic PLJUDQWVRQJELUG)RUWKHSDVWĆYHGHFDGHVSRSXODWLRQVRIS. cerulea have declined by 70% based on annual Breeding Bird Surveys. It is listed as ‘Vulnerable’ by the International Union for the Conservation of Nature. Setophaga cerulea breeds in mature deciduous forests in northeastern and midwestern United States, and southern Ontario, Canada, and winters along the eastern slopes of the Andes in northern South America. Since 2007, we have monitored populations of S. cerulea at nine study {փdփTT ID t ABSTRACT t sites in southern Indiana, USA. Three sites received unevenDJHGWUHDWPHQWVVLQJOHDQGSDWFKJURXSFXWVVLWHVUHFHLYHG even-aged treatments (shelterwood and clear-cuts), and 3 sites served as control (no harvests). Initially, S. cerulea populations responded positively to even-aged treatments and negatively to uneven-aged treatments, two years post-harvest. Recently, populations of S. cerulea have levelled off at the treatment and control sites. Reproductive success was higher at control sites than at the 2 treatments sites. However, larger sample sizes are needed from control sites to fully assess the effects of forest treatments on reproduction. Our results stress the importance of studying the long-term effects of forest treatments in songbird populations to account for inter-year variation in relative abundance estimates and reproductive output. 121 Nest-predator identity as a key factor to understand the differences in nest predation between urban and peri-urban sites in La Paz Metropolitan area Andrea Salazar1*, Alvaro Garitano-Zavala1 ID t ABSTRACT t Table of Contents related to the corresponding differences in predation rate in WKH0HWURSROLWDQDUHDRI/D3D]FLW\$UWLĆFLDOQHVWVZLWKTXDLO eggs (Coturnix coturnix japonicaPRQLWRUHGZLWKĆOPLQJFDPHUDV were installed in three urban sites and three peri-urban sites; the relative abundances for all the bird species were obtained for each site also. Only the Chiguanco Thrush (Turdus chiguanco) (CT) and the Mountain Caracara (Phalcoboenus megalopterus) 0&ZHUHLGHQWLĆHGDVQHVWSUHGDWRUVEXWWKHODWHUZDV found only once and has not been included in the analysis. The House Wren (Troglodytes aedon+:ZDVLGHQWLĆHGDV nest-destructor. The nest-predation and the nest-destruction UDWHVZHUHQRWVLJQLĆFDQWO\GLIIHUHQWEHWZHHQXUEDQDQG peri-urban sites and the relative abundance of the CT was not correlated with the total number of predated nests nor predated eggs per sites. Also, the HW relative abundance was not correlated with the nest-destruction. The results suggest that in La Paz Metropolitan area, the absence of nest predation difference between urban and peri-urban areas is due to the fact that the relative abundance of the main predator species is not increased inside the urban matrix. ǢW29ধ;<;3&'$3£3+Ð!T2-='89-&!&[email protected]&'!22&8Ì9 r9!£!A!8W6!113|+1!-£W$31 ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II 8UEDQL]DWLRQFDXVHVLPSRYHULVKPHQWDQGVLPSOLĆFDWLRQRI bird communities. The supposed increment of nest predation inside the cities was proposed as responsible of that, but the relationship is not clear because in other cities was reported a decrease of nest predation. It is possible that the differences between cities are related to the identity of nest predators. In this study we evaluated if the relative abundance of nestpredator species between urban and peri-urban areas is !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 126 Dieta y disponibilidad de recursos alimenticios para el loro corona azul norteño Amazona guatemalae en un paisaje fragmentado de México Miguel Ángel De Labra-Hernández1*, Katherine Renton2 ǢW39+8!&3'2-'2$-!9-3£Õ+-$!9T2-='89-&!&!$-32!£ <;Õ231!&'Ì?-$3TǣW9;!$-Õ2&'-3£3+Ð!,!1'£!T29ধ;<;3 &'-3£3+Ð!T2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3 r1W&'£!#8!,|+1!-£W$31 ID t ABSTRACT t Table of Contents durante la época reproductiva, utilizando varios alimentos con relativa frecuencia, lo que podría permitir una mayor SODVWLFLGDGHQODGLHWDSRUODćXFWXDFLµQGHODGLVSRQLELOLGDG de recursos alimenticios. El bosque ribereño puede ser un hábitat cave para el loro ya que este tipo de vegetación presentó mayor abundancia de recursos alimenticios, y podría ser utilizado como corredor que conecte parches de YHJHWDFLµQHQHOSDLVDMHPRGLĆFDGRGH/RV&KLPDODSDV ORAL PRESENTATION SESSION 13: PARROT ECOLOGY El loro corona azul norteño (Amazona guatemalae) es el loro de mayor tamaño en Centro América, y es considerado dependiente de la selva alta perennifolia, hábitat que experimenta altas tasas de deforestación y fragmentación. Poco se sabe de los requerimientos alimenticios del loro corona azul norteño, o si la fragmentación del hábitat puede afectar la disponibilidad de los recursos alimenticios del loro. Determinamos la dieta del loro corona azul norteño mediante observaciones de forrajeo en la selva alta de Los Chimalapas, México. Establecimos 30 transectos de fenología (200 X 6 m) para determinar la disponibilidad de recursos alimenticios en tres tipos de vegetación de bosque ribereño, selva alta y vegetación secundaria durante la temporada reproductiva (marzo) y no reproductiva (septiembre) del loro. Determinamos variación espacio-temporal en la producción GHIUXWRVHQFRQWUDPRVVLJQLĆFDWLYDPHQWHPD\RUSURGXFFLµQ GHIUXWRVHQODWHPSRUDGDUHSURGXFWLYD\VLJQLĆFDWLYDPHQWH menor producción en la vegetación secundaria. Los loros consumen principalmente semillas, particularmente de las especies Dialium guianense y Sloanea sp. Sin embargo, el loro corona azul presentó un nicho alimenticio moderado !+'S8!¡8'9'2;!ࣅ329 129 Efecto de las características de las áreas verdes urbanas sobre la depredación de nidos DUWLĆFLDOHVHQOD&LXGDGGH0«[LFR Karla Maryan Rodríguez Hernández1*, María del Coro Arizmendi Arriaga1, Ian MacGregor Fors2, Adolfo Gerardo Navarro Sigüenza1 ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3T !$<£;!&&'9;<&-39<6'8-38'9 A;!$!£!TǣW29ধ;<;3&'$3£3+Ð!TWWT'&&'1#-'2;'<9;'2;!#-£-&!& [email protected][email protected]!1iǣǣ|,3;1!-£W$31 ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II La depredación es la principal causa del fracaso de los nidos GHODVDYHVVHKDQXWLOL]DGRQLGRVDUWLĆFLDOHVSDUDPHGLU ODVYDULDEOHVTXHVHFUHHLQćX\HQHQXQJUDGLHQWHXUEDQR El objetivo de este estudio fue evaluar la relación de la depredación y las características del área verde. Usamos senderos peatonales verdes y parques, elaboramos los nidos utilizando como modelo a una de las especies más comunes en la Ciudad de México. Examinamos los patrones de depredación considerando las características de la ubicación del nido, el área verde y la periferia. Realizamos una regresión logística P¼OWLSOH\£UEROHVGHUHJUHVLµQSDUDLGHQWLĆFDUODVYDULDEOHV P£VVLJQLĆFDWLYDV1XHVWURVUHVXOWDGRVVXJLHUHQTXHKD\ {փdփTT ID t ABSTRACT t mayor depredación dentro de los parques y está determinada por la cobertura vegetal del interior seguida por la cobertura de la periferia, así como del diámetro a la altura del pecho de los arboles donde fueron ubicados los nidos. Esta variable es sumamente importante en los senderos urbanos pues en valores mayores a 43.7 centímetros la depredación fue total. El diámetro a la altura del pecho de los arboles juega un papel determinante con respecto al tipo y tamaño de los depredadores, que fueron predominantemente mamíferos pequeños. Las diferencias en la cobertura vegetal del paisaje y dentro de las áreas verdes podrían determinar la presencia y dinámica de depredadores actuando como atractores por las especies de aves que sustentan. El área urbana actúa como barrera permitiendo el paso solo a explotadores urbanos que VHYHQEHQHĆFLDGRVGHORVVXSOHPHQWRVDQWURSRJ«QLFRV 130 Determinación de áreas de alimentación y rutas migratorias de ardenna creatopus a través de transmisores, evaluando riesgos de pesca incidental Verónica López1*, Peter Hodum1, Ryan Carle1, Josh Adams2, Valentina Colodro1, Jonathan Felis2 Ǣ[email protected];'123>£'&+'TǣWWW'3£3+-$!£ <8='@T'9;'82$3£3+-$!£'9'!8$,'2;'8 r='832-$!|3-03239W38+ ID t ABSTRACT t Table of Contents GHORVGHFOLYHVSREODFLRQDOHV6XVFRORQLDVGHQLGLĆFDFLµQ se encuentran sólo en Chile, en el Archipiélago de Juan Fernández (AJF) (30% de población mundial) e Isla Mocha (70% de la población mundial). Utilizando transmisores GPS y satelitales, se determinaron zonas de alimentación durante la época reproductiva y rutas migratorias de individuos en AJF e Isla Mocha en 6 años, entre 2002-2015. Durante la época reproductiva, las zonas de alimentación están asociadas a la plataforma continental de Chile entre los 31.5 y 40.0 latitud Sur, área donde se concentra la mayor zona pesquera del País. El 100% del tiempo, las aves se alimentaron en aguas territoriales. La superposición de áreas de alimentación y pesquerías, representa una amenazada importante de captura incidental en redes de enmalle y de cerco. Durante la migración, se determinaron distancias de vuelo de hasta 8.616 km. Algunos individuos viajaron hasta Canadá. Se determinaron dos zonas principales de invernada, una en las costas de Perú SULQFLSDO]RQDSHVTXHUDGHOSDF¯ĆFR6XU\ODRWUDHQODFRVWD de México y zona del sur de California, EEUU. Obteniéndose que durante la migración, están un 82% del tiempo en aguas WHUULWRULDOHVGHGLIHUHQWHVSD¯VHVGHODFRVWDSDF¯ĆFD6H considera de suma importancia trabajar con instituciones de los diferentes países donde migra esta ave, para trabajar en conjunto riesgos y posibles soluciones para su conservación. ORAL PRESENTATION SESSION 7: MIGRATION AND SEASONAL VARIATION Ardenna creatopus, es un ave marina migratoria declarada en peligro de extinción en Chile, con una población global aproximada de 60.000 individuos. Se considera que la captura incidental por pesquerías puede ser una causa importante !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 131 Redistribution of Yellow-billed Pintails (Anas georgica) between a wetland and its surrounding landscape María Paz Acuña1*, Cristián Estades1 ǢW2-='89-;@3(,-£'T'31!ধ$9!2&!2&9$!6'$3£[email protected] !#38!;[email protected]!2&-£&£-('$3£[email protected]!#38!;[email protected] ID t ABSTRACT t Table of Contents LQGLYLGXDOVVHHNUHIXJHLQWKHVXUURXQGLQJĆHOGVZKHUH temporary ponds become available due to increased rainfall. Considering wetlands as functionally integrated into the landscape through the movement of birds represents a more realistic framework for waterfowl conservation planning. r16!$<2!|<W<$,-£'W$£ ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION Waterfowl populations are normally studied within the limits of wetlands and their immediate coast, and changes in the abundance of a given species are usually interpreted as the result of mortality, recruitment or the movement of individuals between wetlands. However, to some extent, most waterfowl species can use non-wetland habitats (e.g. SUDLULHVDJULFXOWXUDOĆHOGVHWFDQGVRPHPD\HYHQGHSHQG strongly on these for feeding or nesting. These birds go often XQGHWHFWHGLQDJULFXOWXUDOĆHOGVGXULQJUHJXODUFHQVXVHV:H conducted a study aimed at understanding the relationship between the agricultural matrix and the abundance of Yellowbilled Pintails (Anas georgica) at the estuary of the Itata river, central Chile. During 2013 and 2014, we conducted 10 surveys per year to census this species in the estuary and, in parallel, we estimated its population density outside this wetland with 20 point count stations distributed in the agricultural PDWUL[:HXVHGDVFRYDULDWHVWKHSURSRUWLRQRIćRRGHG areas in the landscape (derived from Landsat ETM), rivers discharge, and climatic data. The best model explaining the YDULDWLRQLQFHQVXVQXPEHUVLQFOXGHGDVLJQLĆFDQWQHJDWLYH effect of average monthly discharge and the density of Pintails in the matrix (P < 0.001). Our results suggest that, in periods of high discharge, bank habitat is reduced, and !+'¢S8!¡8'9'2;!ࣅ329 132 Efectos de la pérdida y fragmentación de hábitat en rapaces nocturnas (Strigiformes) de la Reserva de la Biosfera Los Tuxtlas, Veracruz M.Isabel Herrera-Juárez1*, Patricia Escalante-Pliego1 ǢW29ধ;<;3&'-3£3+Ð!&'£!2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3lm r#-3£W-9!#'£,'88'8!|+1!-£W$31 ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION Gran parte de la literatura enfocada a la conservación tropical está dirigida a especies diurnas. Sin embargo, las rapaces nocturnas (Strigiformes) constituyen uno de los grupos más amenazados del Neotrópico. En este estudio, se evaluó el HIHFWRGHODS«UGLGDGHFREHUWXUDYHJHWDO\ODFRQĆJXUDFLµQ estructural del paisaje en la riqueza, abundancia y uso de hábitat de especies de rapaces nocturnas de la Reserva de la Biosfera Los Tuxtlas; el último remanente de bosque húmedo tropical más al norte del hemisferio occidental. Estimamos su abundancia relativa a lo largo de un gradiente de pérdida de cobertura vegetal mediante la detección auditiva y el uso de vocalizaciones pregrabadas (playbacks). Se registraron seis de las 10 especies reportadas para la región. La mayor diversidad se encontró en niveles medios de cobertura e incluso algunas especies solo estuvieron presentes en áreas con una cobertura mayor a 60%. La abundancia relativa mostró una correlación positiva con la proporción de cobertura vegetal, {փdփTT ID t ABSTRACT t siendo esta, la principal característica del paisaje que explicó el uso de hábitat de estas especies. Los resultados indican que la comunidad se encuentra ya muy depauperada. Las especies registradas se distinguen por ser tolerantes a la deforestación y capaces de habitar en sitios de borde y áreas VHPLDELHUWDV(VWRUHćHMDXQDWHQGHQFLDJHQHUDOHQODULTXH]D y abundancia de especies, evidenciando la urgente necesidad de implementar y fortalecer esfuerzos de conservación. 134 Procesos participativos encaminados hacia la conservación del hábitat en la reserva agroforestal del Quininí.Educación ambiental como estrategia clave Jeancarlo E. A. Sánchez Dominguez1*, Jairo Andrés Peña Torres1, Jennipher Katherine Bernal Villafañe1 ID t ABSTRACT t Table of Contents de la problemática en cuanto a los hábitos que deterioran la reserva, reconocimiento del territorio y educación ambiental con los campesinos y turistas durante las visitas periódicas realizadas a lo largo del proyecto. El trabajo propone acciones encaminadas a la protección de la reserva y la solvencia económica de las familias campesinas mediante alternativas ecoturísticas basadas en las actividades de observación de la avifauna de la región; las cuales se articulan con procesos de participación y organización existentes en la comunidad (APRENAT: Asociación de Protectores de los Recursos Naturales de Tibacuy), contribuyendo al mejoramiento de la calidad de vida de sus habitantes. El desarrollo del proyecto es un punto de partida para la investigación básica y la articulación de procesos participativos en comunidades campesinas asociadas a sistemas agroforestales andinos. ǢW2-='89-&!&!$-32!£&'3£31#-! r/''9!2$,'A&3|<2!£W'&<W$3 ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV La Reserva Agroforestal Del Cerro del Quininí ubicada en el municipio de Tibacuy, Cundinamarca, Colombia, es un ecosistema estratégico regional que funciona como corredor biológico y fuente de abastecimiento hídrico; además cuenta con un gran potencial aviturístico. Actualmente este territorio enfrenta algunas situaciones que amenazan su conservación, como fragmentación del bosque nativo, que rodea algunas propiedades campesinas, mal manejo de actividades agrícolas y falta de conciencia ambiental de los visitantes. En respuesta a estos impactos, se han realizado jornadas de divulgación de la información ecológica relevante para la protección de la dinámica ambiental, socialización !+'S8!¡8'9'2;!ࣅ329 141 Utilización de tres métodos en la determinación de la dieta del cucarachero común (Troglodytes aedon), en La Molina – Lima, Perú Flor Hernández ù'82!2&'A|$38#-&-W38+ ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET Los estudios sobre las dietas de aves se basan en el uso de metodologías diversas, dependiendo de lo que se tiene como objetivo, además, de velar por el bienestar de la especie a evaluar. Sin embargo, muchas de las evaluaciones suelen dar UHVXOWDGRVDPELJXRV\DTXHHVGLI¯FLOGHĆQLUODVHVWUDWHJLDV de forrajeo debido a la amplitud de recursos que el ambiente ofrece a los depredadores, y mucho más, cuando se trata {փdփTT ID t ABSTRACT t ID t de aves insectívoras, a lo cual se le suma la tediosidad de la LGHQWLĆFDFLµQGHDUWUµSRGRV6HFRPSDUDURQWUHVP«WRGRV (comportamiento de forrajeo, oferta alimenticia y el contenido estomacal) con el objetivo de determinar si coinciden sobre la dieta de un ave insectívora (Troglodytes aedon). Dicha evaluación, se llevo a cabo en el campus de la Universidad Nacional Agraria La Molina, durante los meses considerados dentro de la época reproductiva el ave (Diciembre 2011 hasta Mayo 2012). Se evaluaron en total 9 grupos de esta especie, pero se colectaron 16 individuos pertenecientes a 7 grupos. Con la metodología de “comportamiento de IRUUDMHRëVHYHULĆFµTXHHVWDDYHSUHVHQWDFRPRHVWUDWHJLD de forrajeo el territorialismo, además, que el comportamiento más común para capturar sus presas era el “hurgamiento”. Por otro lado, los resultados registrados por las metodologías “oferta alimenticia” y “análisis de contenido estomacal”, UHćHMDURQODSUHGRPLQDQFLDGHORUGHQ&ROHRSWHUDH Hymenoptera. Finalmente al hacer los análisis de similitud (cuantitativo y cualitativo) de los órdenes registrados con los tres métodos, se obtuvo que las metodologías de RIHUWDDOLPHQWLFLD\FRQWHQLGRHVWRPDFDOUHćHMDQFDVLOD misma tendencia tanto en abundancia como riqueza. 147 Criterios para evaluar la recuperación de la !+'£S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents riqueza y abundancia de la avifauna en áreas desboscadas en selvas tropicales Oscar Cuya1*, Nadia Sanchez1, Flor Hernández2 ǢWTǣW r3$<@!|>!£9,6W$31W6' ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III Después de una perturbación en el ecosistema, ya sea por causas naturales o actividad humana, surge la necesidad de saber si el ecosistema volverá a recuperarse, y en respuesta a ello, se utiliza el criterio de la comparación de muestras tomadas en las áreas intervenidas con el área control (bosque primario aledaño), lo cual parece lógico, sin embargo, aceptar esto es dejar de lado los conocimientos sobre la dinámica de la sucesión ecológica de los bosques secundarios. Así, este trabajo propone que las comparaciones deben realizarse con otros bosques secundarios de la misma edad. Se consideraron dos criterios, el primero, emplea el principio “antes-despuéscontrol-impacto” y compara los resultados de los inventarios y censos realizados en el área control. El segundo, plantea que la recuperación debe medirse con respecto a la dinámica de bosques secundarios, para lo cual se utiliza la literatura FLHQW¯ĆFD/RVGDWRVUHFDXGDGRVHQHO\ en el área del proyecto ubicado en Loreto, distritos de Andoas, Urarinas y Trompeteros, fueron analizados mediante estimadores de similaridad, así como su funcionalidad en HOHFRVLVWHPDDJUXS£QGRORVHQJUHPLRVWUµĆFRV6HREWXYR GLIHUHQFLDVVLJQLĆFDWLYDVHQODFRPSRVLFLµQGHODFRPXQLGDG de aves entre áreas intervenidas y áreas control del bosque aledaño, adicionalmente se registró una baja similaridad entre {փdփTT ID t ABSTRACT t ambas comunidades (7.14% indice de Jaccard y 13.3% indice se Sorensen-Dice). Sin embargo, al comparar dicha comunidad con bosques de sus edad, se encontró que se viene desarrollando de acuerdo a lo esperado, y paulatinamente seguirá alcanzando sus características naturales correspondientes a los diferentes estadios sucesionales que alcance. 148 5 HJLVWURVQRWDEOHVHQHOUHDGHLQćXHQFLDGHO3UR\HFWR Central Hidroeléctrica Cerro del Águila, Huancavelica-Perú Nadia Sanchez1*, Margot Cuyos1, Miriam Torres1, Flor Hernández26RĆD=DPEUDQR1 ǢWTǣW *[email protected] ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES Se realizaron 4 evaluaciones de la avifauna en el área de LQćXHQFLDGHO3UR\HFWR&HQWUDO+LGURHO«FWULFD&HUURGHO Águila entre 2012 y 2014 como parte de la ejecución de su Estudio de Impacto Ambiental (EIA) y del Programa de Monitoreo Biológico (MB) implementado. En cada ingreso a campo fueron evaluadas 10 estaciones de monitoreo, ubicadas entre los 1000 y 3 500 m s.n.m. Para el registro de especies se aplicó el método de censo por puntos de conteo y capturas con redes de neblina. Fueron registradas un total de 92 especies de aves entre las que destacan las endémicas Cranioleuca albicapilla y Atlapetes melanopsis, las amenazadas Nothoprocta taczanowskii, Vultur gryphus, Buteogallus solitarius, Andigena hypoglauca y Atlapetes melanopsis, y las especies migratorias Falco femoralis, Empidonax alnorum y Vireo olivaceus. Además se reporta la ampliaciones de rango para las especies Nystalus chacuru, Hemitriccus margaritaceiventer !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents y Coryphospingus cucullatus. Esta zona del valle del Mantaro permanece relativamente conservada y la inaccesibilidad a HVWHVLWLRGXUDQWHPXFKRVD³RVGHFRQćLFWRVRFLDOKDIDFLOLWDGR esta situación de encontrar nuevos registros. Se recomienda seguir con los monitoreos a nivel altitudinal en las mismas estaciones de muestreo y generar una lista más completa de la avifauna presente en esta área. Adicionalmente, se exhorta a continuar estudios a lo largo del valle del Mantaro e inventariar las especies que frecuentan con el objetivo de actualizar el rango de distribución de muchas de ellas. 156 Bird species richness, functional diversity and seasonality LQDQDUWLĆFLDOćRRGSODLQLQWKH3LUDFLFDEDULYHU%UD]LO Vivian Robinson1*, Marco Aurélio Pizo1 ǢW2-='89-&!&'9;!&<!£!<£-9;!T29ধ;<;3&'-3$-Í2$-!9T$!16<9&'-3£!83 r=-i8#9|,3;1!-£W$31 ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY IQWKHUHJLRQNQRZQDV7DQTX¥ćRRGSODLQVZHUHIRUPHG in Piracicaba River (state of São Paulo, Brazil) after the construction of Barra Bonita dam in 1963. This area became a hotspot for a variety of water-associated birds, including VHYHUDOPLJUDWRU\HQGDQJHUHGDQGKDUGWRĆQGVSHFLHV7KLV area is endangered by the planned expansion of the PiracicabaTietê hydroway. Based on our own survey and literature search, we found 119 species in 29 families using the area for reproduction or foraging, 97 of which are wetland-depend species. There are also 12 species endangered in the state of São Paulo, and 15 migratory birds. With monthly censuses conducted from October 2014 to March 2015 in seven point count stations we recorded 80 species, almost evenly {փdփTT ID t ABSTRACT t distributed into eight foraging and eight nesting functional groups. We found signs of reproduction for 14 species. The river depth varied monthly from 5.3 m to 9.1 m, leading the abundance index to range from 38.3 to 344.4 and richness from 45 to 59. Birds that forage on the surface, such as ducks, are the most affected by the river depth, which is responsible for 68% of the variation in their abundance. We predict that any change in Piracicaba River hydrology can seriously affect the structure and function of this bird assemblage. 157 Abiotic and biotic factors underlying changes in bird communities along Andean elevation gradients Scott Robinson1*, Gustavo Londono2, Jill Jankowski3, Mark Chappell4 ǢW2-='89-;@3( £38-&!TǣW2-='89-;@TǤW2-='89-;@3( 8-ধ9,3£<1#-!TǥW2-='89-;@3(!£-(382-!f-='89-&' ID t ABSTRACT t Table of Contents rates and the communities of nest predators, however, varied strongly with elevation. Bird community turnover and changes in nest predation rates were correlated, which suggests that nest predation may contribute to species turnover, especially at the lower end of the gradient. At the higher end of the gradient, the combination of cold temperatures and relatively KLJKQHVWSUHGDWLRQUDWHVPD\DFWDVDĆOWHUIDYRULQJVSHFLHV with a slow pace of life (small clutches and low egg mass, long GHYHORSPHQWDOWLPHV(YLGHQFHRILQWHUVSHFLĆFDJJUHVVLRQ among closely related species that replace each other along gradients was found for just a few genera. Instead, most showed evidence of niche partitioning or even had gaps in their distributions, a possible indication of selection to minimize transfer of pathogens. Collectively, our data suggest that biotic interactions dominate patterns of community turnover, but that abiotic factors also contribute, especially in harsh environments. r983#-2932|*12,W<*W'&< ORAL PRESENTATION SESSION 23: AVIAN DISTRIBUTIONS AND GLOBAL CHANGE We studied the relative importance of abiotic (temperature) and biotic (competition) factors underlying the turnover in bird communities on elevation gradients (300-3700m) in the Peruvian and Colombian Andes. We measured thermal WROHUDQFHVXVLQJĆHOGUHVSLURPHWU\RILQGLYLGXDOVRI 350+ species and monitored the success of more than 3000 nests of 500 species. Adults of most species showed little evidence of thermal stress, even well outside their normal thermal range; basal metabolic rates scaled with body mass, but varied little with elevation. Energy expenditure models suggested that adults of few species are energetically constrained to particular elevation zones. Nest predation !+' S8!¡8'9'2;!ࣅ329 159 Análise da efetividade de manejo em uma Unidade de Conservação: O caso do Parque Estadual da Serra do Tabuleiro, Santa Catarina, Brasil Fabrício Almeida1*, Marinez Scherer1 ǢW2-='89-&!&' '&'8!£&'!2;!!;!8-2! r(!#8-$-3W#!9-£-3!£1'-&!|+1!-£W$31 ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV Este trabalho teve como objetivo analisar o grau da efetividade de manejo da IBA - Parque Estadual da Serra do Tabuleiro (IBA - PAEST), uma unidade de conservação que se destaca SRUDEULJDUXPGRVPDLRUHVEORFRVFRQW¯QXRVGHćRUHVWD atlântica de Santa Catarina, abrangendo cinco das seis {փdփTT ID t ABSTRACT t ID t formações vegetais do bioma encontradas no Estado. Apesar da sua importância para a conservação da biodiversidade QRVXOGR%UDVLORSDUTXHSRVVXLDLQGDGHĆFL¬QFLDGH informações para muitos táxons que ocorrem no local, principalmente com relação as espécies de aves ameaçadas de extinção. A efetividade de manejo foi avaliada por meio da Estrutura Global de Monitoramento em IBAs, idealizada pela BirdLife International em 2006. Este método envolve a designação de notas para indicadores pré-selecionados nos itens de pressão, estado e resposta. O sistema foi aplicado com ênfase em dezessete espécies de aves ameaçadas de H[WLQ©¥RTXHSRVVXHPK£ELWRVćRUHVWDLVHPDULQKRVQD UC. Os resultados mostraram que a IBA-PAEST encontrase com uma efetividade de manejo baixa. Os indicadores UHODFLRQDGRVDRLWHPDPHD©DLGHQWLĆFDUDPTXHDJULFXOWXUD FD©DGHVćRUHVWDPHQWRH[SDQV¥RXUEDQDHSROXL©¥RSRU UHV¯GXRVVµOLGRVV¥RRVLPSDFWRVPDLVVLJQLĆFDWLYRVQRORFDO Os resultados para o item estado mostraram uma perda GHKHFWDUHVGHFREHUWXUDćRUHVWDOGHQWURGHVHXV limites. Em termos gerais, o grande número de ameaças FRPELQDGDVSULQFLSDOPHQWHOLJDGDVDRGHVćRUHVWDPHQWR podem causar efeitos cumulativos graves sobre a dinâmica destes ambientes e consequentemente às espécies de aves, principalmente as ameaçadas de extinção. Portanto, ações mais efetivas devem ser impostas na UC pelo órgão gestor. 162 Native forest is of higher quality than shade !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents coffee for a Nearctic-Neotropical migratory bird fuelling for migration in northern Colombia Nicholas J. Bayly1*, Camila Gómez1, Keith Hobson2, Kenneth V. Rosenberg3 ǢWV2='9ধ+!$-Õ26!8!£!329'8=!$-Õ2'2'£'3;836-$3T ǣW2=-8321'2;!2!&!TǤW382'££!#3(82-;,3£[email protected] r2-$0W#[email protected]£@|9'£=!W38+W$3 ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III The impact of habitat choice on fuelling behaviour and migration strategy in birds has rarely been examined, despite the potential impact of widespread transformation of natural habitats in key stopover regions. The elevated energetic requirements of migrating birds means that resource DEXQGDQFHWKURXJKLWVLQćXHQFHRQIXHOGHSRVLWLRQUDWHV is expected to be the main determinant of stopover habitat quality. To test whether shade coffee plantations provide high-quality habitat relative to pre-montane forests, we examined six indicators of habitat quality for Tennessee Warblers (Oreothlypis peregrina) on spring migration in northern Colombia: 1) rate of body mass change; 2) foraging rates; 3) ERG\PDVVGLVWULEXWLRQGHQVLW\ćRFNVL]HDQGDJH and sex ratios. Tennessee Warblers stopped at our study site IRUWRGD\VDQGOHIWZLWKHQRXJKIXHOWRć\ km. All six measures of habitat quality indicated that premontane forest was of higher quality than shade coffee, with forest supporting faster rates of foraging and fuel deposition, KLJKHUGHQVLWLHVDQGODUJHUćRFNVL]HV7KHVHGLIIHUHQFHV LQćXHQFHGVWUDWHJ\WKURXJKORQJHUVWRSRYHUGXUDWLRQVDQG lower departure masses in shade coffee, which in turn may {փdփTT ID t ABSTRACT t KDYHĆWQHVVFRQVHTXHQFHVWKURXJKFDUU\RYHUHIIHFWV7KH FRQVXPSWLRQRIIUXLWVLQIRUHVWSUREDEO\PDGHDVLJQLĆFDQW contribution to the observed habitat differences and we recommend the inclusion of appropriate fruiting trees in shade coffee plantations to increase their quality for frugivorous birds. 163 7KHHIIHFWRIODQGVFDSHFRQĆJXUDWLRQDQG dispersal capacity on habitat availability for birds of Campos grasslands, RS Brazil Ricardo Contreras Osorio1*, Santiago Saura2, Fernando Gertum Becker3 ǢW<9'3&' 33£3+Ð! TǣW;3-9;'[email protected]'$<8939 !;<8!£'932;'9TǤW;3$3£3+-! [email protected]$32;8'8!9|+1!-£W$31 ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY Campos are recently threatened due to changes in human practices, from extensive livestock grazing to monoculture forestry and industrialized agriculture. Presently, native grassland, crops and tree plantations form heterogeneous mosaics. Landscape connectivity analysis has shown to EHDQHIĆFLHQWWRROWRLGHQWLI\NH\DUHDVIRUFRQVHUYDWLRQ of endangered species based on the amount of available habitat resulting from its spatial distribution. The aim of this study was to assess habitat availability for birds with different dispersal capacities and in different landscape FRQĆJXUDWLRQV7KHFRQQHFWLYLW\ZDVFDOFXODWHGZLWKD probabilistic index PCI. Dispersal distance is determining the DPRXQWRIUHDFKDEOHKDELWDWKRZHYHUVSHFLĆFVLWHODQGVFDSH FRQĆJXUDWLRQYDULDELOLW\VHYHUDOO\LQćXHQFHVWKHSURSRUWLRQ in which distance determines reachable habitat. Dispersal distance had a positive effect over reachable habitat in 99.3% !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents of Campos fragments. The available habitat varied up to 27% in more than 25% of the landscapes only as effect of FRQĆJXUDWLRQZKHUHLQVRPHORFDWLRQVUHGXFHGXSWR habitat availability. In the regional scale, all stages of landscape fragmentation process can be found across Campos in Rio Grande do Sul, and in areas with mid-low native cover, the FRQĆJXUDWLRQHIIHFWGHWHUPLQLQJUHDFKDEOHKDELWDWLVVOLJKWO\ higher than and in areas with low or medium cover. Our results illustrate the effect of changing landscape on habitat availability for bird communities. With this information new management practices can be designed for reducing the impact of landscape change in Campos bird communities. 165 The diet of Procnias nudicollis (Cotingidae), in a 12 year study at east Parana state, Brazil Bernardo Clausi @8;£!< [email protected];£!<|+1!-£W$31 ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET Procnias nudicollis is endangered in most of its original range. Being a specialist frugivore, its diet is not well known. This study investigates what these birds are eating throughout the year. Started in July 2003, data comes from regurgitated seeds from the male perches while singing, collected with seed traps, combined with direct observations at fruiting trees in two main study sites: QU in Morretes, PR, and BA in Campina Grande do Sul, PR. The QU site was a submontane site and the vocalization season began in early July, after a brief period of silence between mid February and late June (04 months). At BA the vocal season starts in late August ending at same {փdփTT ID t ABSTRACT t mid February. The plants: a total of 99 tree species have been LGHQWLĆHGFRPLQJIURPSODQWIDPLOLHVDOOZLWKGUXSHOLNH ćHVKIUXLWV0\UWDFHDHDQG/DXUDFHDHDUHWKHPRVW species rich, followed by Moraceae (08) and Sapindaceae (05), Arecaceae (02), Myrsinaceae (02), Symplocaceae (02) and another 11 families represented by only one species. The data is still being gathered. A special study was conducted with one species Myrcia lajeana, as its one of only 3 species present in both sites (QU and BA). Male perches proved to be 20x richer in seedlings than random locations in the forest. At highland area, in a nearby botanically compared site (BV) distant only 1.5 km from main BA site, the vegetation, specially tree diversity were remarkable different. The birds in the area %$VKRZVDYHU\VSHFLĆFVLWHĆGHOLW\ZKDWVXJJHVWVVRPH limits in natural regeneration. Further study should include a gps tagging to trace their exact route through the year. 166 Elevational migration in the Yungas Manakin (Chiroxiphia boliviana, Pipridae): Insights from stable isotopes Mariana Villegas-Bilbao1*, John G. Blake1, Seth D. Newsome2 ǢW2-='89-;@3( £38-&!TǣW2-='89-;@3('>'?-$3 r1!8-!2!=-££'+!9|<*W'&< ID t ABSTRACT t Table of Contents boliviana prior to the breeding season along an elevational gradient of the Central Andes of Bolivia; we do this by HVWLPDWLQJWKHGLIIHUHQFHEHWZHHQ +LQPHWDEROLFDOO\LQHUW (feathers and claws) and metabolically active tissues (whole blood) at the beginning of the breeding season. Feathers are inert once grown and represent hydrogen inputs at the WLPHRIPROWZKHUHDVFODZVDQGZKROHEORRGUHćHFWPRUH recent integrations of hydrogen. During breeding seasons of 2013 and 2014, we sampled 68 individuals at two sites at the extremes of an elevational gradient in Cotapata National Park: Sandillani at 1980m, and El Jiri at 1350m. Preliminary LVRWRSLFDQDO\VHVRIWDLOIHDWKHUVDQGFODZVVKRZVLJQLĆFDQWO\ ORZHUOHYHOVRI +LQIHDWKHUVSDLUHGWWHVWW df = 9, p-value < 0.001) which supports our hypothesis that C. boliviana migrates along the elevational gradient and suggests that the species made an uphill migration prior to the breeding season. These preliminary results provide insights on C. boliviana natural history and on its potential behavioral strategies to cope with high elevation conditions. 171 Variaciones ecorregionales y estacionales de Haemoproteus sp. en aves Passeriformes del Norte Grande de Chile ORAL PRESENTATION SESSION 7: MIGRATION AND SEASONAL VARIATION Luis G. Torres1*, Lucila Moreno1, Daniel González1 Seasonal movement patterns and many other life-history traits are poorly known for Neotropical birds. Chiroxiphia boliviana inhabits humid hill forests along the eastern slope of the Andes of Bolivia and Peru; it has a wider elevational range (600 to 2300 m) than other members of the genus. Here we examine if there is partial uphill or downhill movement in C. r£<;388'9|<&'$W$£ !+'S8!¡8'9'2;!ࣅ329 ǢW2-='89-&!&&'32$'6$-Õ2 ORAL PRESENTATION SESSION 18: AVIAN DISEASES Diversos estudios a lo largo del mundo han evidenciado la presencia de hemoparásitos en aves. En Chile, se han registrado hemoparásitos pertenecientes a los géneros {փdփTT ID t ABSTRACT t ID t Haemoproteus, Leucocytozoon, Plasmodium, Trypanosoma y GLVWLQWDVHVSHFLHVGHPLFURĆODULDV(OREMHWLYRGHHVWHHVWXGLR fue determinar la prevalencia de parásitos sanguíneos en aves Passeriformes del Norte Grande de Chile y comparar las diferencias entre ecorregiones (Di Castri, 1968, CNRS Volumen 4) y estaciones del año. Entre mayo de 2011 y agosto de 2012 se realizaron cuatro visitas estacionales a diez localidades correspondientes a las ecorregiones: Desértica de Litoral, Desértica de Interior, Tropical Marginal y Tropical de Altura. Fueron capturadas 507 aves (38 especies), incluidas en nueve familias: Furnariidae, Tyrannidae, Hirundinidae, Troglodytidae, Turdidae, Thraupidae, Emberizidae, Fringillidae y Passeridae. De cada ave se obtuvo un frotis sanguíneo, el cual fue teñido mediante la técnica Diff Quick y analizado a través de microscopía de luz. En 91 (17,95%) de las aves (12 especies) se detectó la presencia de hemoparásitos morfológicamente compatibles con el género Haemoproteus, siendo la especie más parasitada Phrygilus fruticeti (83,78%; $WUDY«VGHODSUXHEDGH&KLFXDGUDGR\HOWHVWH[DFWR de Fisher se detectaron diferencias (p<0,01) en las prevalencias del hemoparásito entre estaciones en las ecorregiones Tropical Marginal y Tropical de Altura y también diferencias ecorregionales durante las estaciones de invierno y verano, hecho que se puede explicar por las características propias de cada ecorregión y su relación con las poblaciones de aves. 172 Impacto del cambio climático en la distribución !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents de aves frugívoras en el gradiente altitudinal Caribe-Villa Mills en Costa Rica Katherine Araúz-Ponce1*, Viviana Ruiz-Gutierrez2, Bryan Finegan3 ǢW9$<'£!&'39+8!&3T'2;83+832Õ1-$3836-$!£&'2='9ধ+!$-Õ2 @29'Ó!2A!lmTǣ[email protected]<2;!-2-8	'8=!;[email protected]ǤW 83+8!1!&'83&<$$-Õ[email protected]'8=!$-Õ2&'397<'9T'2;83 +832Õ1-$3836-$!£&'2='9ধ+!$-Õ[email protected]'Ó!2A!lm r0!8!<A6|$!ধ'W!$W$8 ORAL PRESENTATION SESSION 23: AVIAN DISTRIBUTIONS AND GLOBAL CHANGE /DVLQYHVWLJDFLRQHVTXHKDQFXDQWLĆFDGRHOLPSDFWRGHO cambio climático sobre las especies tropicales en gradientes altitudinales son limitados. Las estimaciones de ocupación SURYHHQXQDIRUPDHĆFD]GHHVWDEOHFHUO¯QHDVEDVHVGH distribución para explorar cambios potenciales de especies utilizando escenarios de cambio. Se estimó la probabilidad de ocupación y detección de especies de aves frugívoras en el gradiente altitudinal Caribe-Villa Mills en Costa Rica. Generamos historiales de utilizando datos de avistamientos para cuatro ocasiones de muestreo. Aplicamos un modelo de ocupación de una temporada para una especie implementado en el paquete unmarked en R. Para ver efectos de condiciones climáticas sobre la distribución de especies, usamos covariables bioclimáticas y de elevación como covariables de detección y ocupación. Los valores estimados de ocupación fueron bajos DORODUJRGHOJUDGLHQWHDOWLWXGLQDO8WLOL]DQGRORVFRHĆFLHQWHV de regresión del modelo con más apoyo de los datos, logramos proyectar la probabilidad de ocupación según el escenario RCP4.5 al año 2050, resultando en una disminución. Estos {փdփTT ID t ABSTRACT t resultados disponen de una mejor evidencia de los impactos del cambio climático sobre la biodiversidad, siendo uno los primeros estudios ejemplares sobre el impacto del cambio climático sobre las comunidades de aves tropicales para bosques nubosos tropicales de Centroamérica. Este estudio sirve de guía para otros proyectos en el Neotrópico y de esta manera llenar el vacío de información que existe del impacto del cambio climático sobre la avifauna tropical en gradientes altitudinales. 175 Elevational distribution and general ecology of the Canada Warbler (Cardellina canadensis) in Colombia Nicholas J. Bayly V2='9ধ+!$-Õ26!8!£!329'8=!$-Õ2'2'£'3;836-$3 ID t ABSTRACT t Table of Contents (282 points) and playback experiments (301 points) in mature forest showed that Canada Warblers occupied elevations between 1000 and 2250 m, with a tendency to be more abundant between 1250 and 1500 m. The species was more abundant in mature forest relative to shade coffee at the same elevation, and birds in forest foraged primarily in the mid-levels of vegetation between 5 m and 15 m above the ground. There was limited evidence for a difference in the elevational distribution of males and females. The probability RI&DQDGD:DUEOHUVEHLQJREVHUYHGLQPL[HGVSHFLHVćRFNV increased with elevation. These preliminary results provide important baseline information essential to any process that aims to prioritize habitats or elevations for the conservation of Canada Warblers on their non-breeding grounds. 2-$0W#[email protected]£@|9'£=!W38+W$3 ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR The Canada Warbler (Cardellina canadensis) is a declining Neotropical migratory bird that occurs in the Andes of Venezuela, Colombia, Ecuador and Peru during the nonbreeding period. Despite being a relatively abundant species in Andean forests, the elevational distribution of the species and its non-breeding period ecology have yet to be studied in DQ\GHWDLO'XULQJWKHQRQEUHHGLQJSHULRGRIZH YLVLWHGĆYHGLIIHUHQWUHJLRQVRI&RORPELDDQGDWHDFKVLWHZH FDUULHGRXWSDVVLYHĆYHPLQXWHSRLQWFRXQWVDQGRQHPLQXWH long playback experiments in three habitats: mature forest, secondary forest, and shade coffee. For all birds detected, we recorded their perpendicular distance from the transect, age and sex (where possible), foraging height, and their association RUQRWZLWKPL[HGVSHFLHVćRFNV%RWKSDVVLYHSRLQWFRXQWV !+'S8!¡8'9'2;!ࣅ329 189 8 VRGHF¤PHUDVWUDSSDUDLGHQWLĆFD©¥RGH predadores de ninhos em uma comunidade de aves da Mata Atlântica do sudeste do Brasil Lais Ribeiro da Silva1*, Paulo Victor Queijo Zima1, Carlos Humberto Biagolini Júnior1, Daniel Fernandes Perrella1 ǢW2-='89-&!&' '&'8!£&'È3!8£39 r89W£!-9|+1!-£W$31 ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II A perda de ninhos é a principal causa de fracasso na reprodução das aves, sendo a predação um componente importante nas hipóteses relacionadas às adaptações de história de vida e, também, comumente relacionada com o declínio populacional de aves em áreas fragmentadas. Este estudo teve como foco testar o uso de câmeras trap como metodologia para a LGHQWLĆFD©¥RGHSUHGDGRUHVGHQLQKRVGHDYHVHPXPD£UHD {փdփTT ID t ABSTRACT t ID t GH0DWD$WO¤QWLFD1DVHVWD©·HVUHSURGXWLYDVH IRUDPHQFRQWUDGRVQLQKRVGHHVS«FLHVGH DYHVWRWDOL]DQGRKRUDVF¤PHUDGHPRQLWRUDPHQWR Dos 148 ninhos, 37 foram predados (25%) e dos 40 eventos de predação, 26 foram registrados pelas câmeras. Alguns dos SUHGDGRUHVLGHQWLĆFDGRVIRUDPLeopardus pardalis, Marmosops incanus, Sapajus nigritus, Amadonastur lacernulatus, Micrastur UXĆFROOLV3XOVDWUL[NRHQLVZDOGLDQD e Ramphastos dicolorus. TestouVHWDPE«PDHĆFL¬QFLDGRXVRGHXPDRXGXDVF¤PHUDVSRU QLQKRVHQGRTXHHPRFRUUHUDPSUHGD©·HVGDV quais 10 foram registradas utilizando apenas uma câmera por QLQKR-£HPRFRUUHUDPSUHGD©·HVVHQGRTXH 19 foram registradas com o uso de duas câmeras por ninho. As FDXVDVGDVIDOKDVQRUHJLVWURGDVSUHGD©·HVIRUDPLGHQWLĆFDGDV como: lotação do cartão de memória, mal posicionamento e deslocamento da câmera e distância da câmera ao QLQKR'HVWDPDQHLUDDVF¤PHUDVVHPRVWUDUDPHĆFLHQWHV para a realização deste tipo de estudo e se mostraram resistentes às adversidades climáticas. O uso de duas F¤PHUDVSRUQLQKRQ¥RDSUHVHQWRXGLIHUHQ©DVVLJQLĆFDWLYDV no registro de predações, sendo importante checagens mais frequentes para resolução de possíveis problemas. 191 Use of wild food by a reintroduced population of scarlet !+'¢S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents macaws (Ara macao cyanoptera) in Palenque, Mexico Ángela María Amaya-Villarreal1*, Alejandro Estrada1, Nicolás Vargas-Ramírez2 ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3TǣW32ধ)$-!2-='89-&!&!='8-!2! [email protected]!W=-££!88'!£|+1!-£W$31 ORAL PRESENTATION SESSION 13: PARROT ECOLOGY The Scarlet Macaw (Ara macao cyanoptera) is an endangered species in Mesoamerica due to habitat loss, hunting and illegal WUDIĆF,WVUDQJHKDVEHHQUHGXFHGE\LQ0H[LFR%HWZHHQ April 2013 and June 2014, a population of 96 individuals of A. m. cyanoptera was reintroduced in the tropical forests of Palenque, Mexico. One key indicator of adaptation to the wild is the ability of macaws to use food in the new habitat. Hence, the main objective of this study was to document the use of wild food and habitat range by the reintroduced macaws between June-November 2014. We surveyed the presence and feeding activities of macaws along 18 km of trails in the release site and recorded 283 feeding bouts. Macaws used 140 trees of 31 species (19 families; 84% native species) as a source of food. Seeds and fruit accounted for 70% of their diet. The remainder 30% consisted of bark, stems, leaves, LQVHFWJDOOVćRZHUVDQGVKRRWV)LYHWUHHVSHFLHVZHUHKLJKO\ dominant in their diet. Levin´s index of dietary niche breadth was 0.260 indicating a narrow diet. Food trees were found in 36 ha, but total range was 59 ha. Habitat areas used by the macaws displayed a clumped pattern (Morisita index=1.68) and their distribution was not random (X2 = 8478.62, P<0.0001). We compared the use of wild food with other, wild and reintroduced, populations of Scarlet macaws and {փdփTT ID t ABSTRACT t discussed the observed patterns in the context of ecological generalism, high sociality and behavioral innovation. We concluded that these three factors may have been facilitating an initial and successful adaptation to the wild by the reintroduced Scarlet macaws to the rainforest of Palenque. 192 ¿El éxito reproductivo deElaenia albiceps chilensisvaría durante la temporada reproductiva en los bosques andino-patagónicos? Cristian Gorosito1*, Víctor Cueto1 ǢW'2;83&'2='9ধ+!$-Õ297<'£&'32;!Ó[email protected] 9;'6!!;!+Õ2-$!lfm r6£!2';$8-9ধ!2ǡǣǢ|,3;1!-£W$31 ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I Muchas especies de aves muestran una disminución del éxito reproductivo con el avance de la temporada de cría. La especie migratoria Elaenia albiceps chilensis (Tyrannidae) es la más abundante en los bosques andino-patagónicos, pero poco se sabe sobre su biología reproductiva. El objetivo fue evaluar si el éxito reproductivo varía a lo largo de la temporada de cría. Se realizó una búsqueda de nidos en un bosque cercano a Esquel, en Argentina. Los nidos (n = 29) fueron monitoreados diariamente para determinar la duración GHODVHWDSDVGHQLGLĆFDFLµQ\IXHURQFODVLĆFDGRVHQQLGRV con puesta temprana (diciembre, n = 14) y con puesta tardía (mediados de enero, n = 15). Se midieron los huevos y los pichones hasta que abandonaron el nido. Los nidos tempranos tuvieron un mayor tamaño de puesta (temp = 3; tard = 2) y la etapa de puesta fue más prolongada. No hubo diferencias para la duración de las etapas de incubación y polluelos entre !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents nidos tempranos y tardíos y tampoco en el tamaño de los huevos y en las tasas de crecimiento de los polluelos. El éxito reproductivo fue mayor en nidos tempranos (ERtemp = 0,40; ERtard = 0,22) y la tasa de predación de nidos fue mayor en los tardíos (TPtemp = 0,50; TPtard = 0,73). Considerando que los padres atendiendo los nidos tardíos presentaban acumulación de grasa (i.e., se estaban acondicionando para la migración), podrían estar derivando menos energía a la QLGLĆFDFLµQUHćHMDGRHQHOPHQRUWDPD³RGHSXHVWD\PHQRU éxito reproductivo, siendo este último parámetro reproductivo afectado también por una mayor tasa de predación. 196 Geographic variation in coloration and morphometrics in three species of birds along the Purus0DGHLUD,QWHUćXYLXP:HVWHUQ$PD]RQ )HUQDQGR7HµĆOR1*, Juliana Schietti1, Marina Anciães1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-! r;'3)£3ù|+1!-£W$31 ORAL PRESENTATION SESSION 24: ECOMORPHOLOGY II Morphological traits may vary across a species range as a result of drift or local adaptation. Biogeographic studies in Amazon W\SLFDOO\GHVFULEHELRGLYHUVLW\DFURVVLQWHUćXYLDUDUHO\ZLWKLQ them. We test phenotypic variation in three bird species along WKH3XUXV0DGHLUDLQWHUćXYLXPDQGZKHWKHUWKHREVHUYHG phenotypes were explained by geographic distance or HQYLURQPHQWDOKHWHURJHQHLW\&RORUDWLRQLQGH[HVRIUHćHFWDQFH spectra and morphometry of ca. 5 adult males and 5 females from 11 localities were contrasted among localities and with proxies for distance and environmental variation (tree basal area and bird community). Environmental variation was not {փdփTT ID t ABSTRACT t VLJQLĆFDQWO\VSDWLDOO\DXWRFRUUHODWHGDQGWKHUHZHUHQRREYLRXV barriers to dispersal in the study region. Null expectations were of no variation or random variation was not explained by tested YDULDEOHV+DOIRIWKHFDVHVDQDO\]HGVKRZHGLQWUDVSHFLĆF morphological variation. Coloration varied more frequently than morphometrics and color was better explained by environmental heterogeneity, particularly in males, whereas brightness varied also with distance. Distances explained the only case of variation in morphometry. These results indicate that coloration is more labile than morphometric traits and that plumage color is more adapted to local environments than brightness, which is, in addition, under the effects of neutral drift. Higher frequencies of association between male coloration and the environment suggest a role of sexual selection on the expression of these phenotypes. We showed LQWUDVSHFLĆFSKHQRW\SLFYDULDWLRQLQDVSDWLDOH[WHQWXVXDOO\QRW considered in classical biogeographic studies in the Amazon. 197 Oferta de semillas y su relación con la abundancia de aves granívoras en distintas etapas de desarrollo de una plantación de Pinus radiataen Chile ID t ABSTRACT t Table of Contents manejo con tala rasa con la que son tratadas las plantaciones. Este manejo provoca que existan parches con condiciones microambientales diferentes entre los distintos estados de crecimiento de los pinos. El objetivo de este estudio es hacer una estimación de la oferta de semillas disponible en el suelo de plantaciones de pino de distintas edades (2, 5, 10 y 20 años) y relacionarla con la abundancia de aves granívoras. El área de estudio está próxima a la localidad de Dichato (Región del Biobío) en donde se tomaron muestras de hojarasca en las diferentes edades de pino evaluadas, las cuales se tamizaron para separar las semillas obteniendo de esta manera la oferta de semillas. Para evaluar la abundancia GHDYHVVHKLFLHURQFRQWHRVSXQWXDOHVGHUDGLRĆMR6H incluyó a la vegetación como covariable, por lo que se hizo una evaluación del volumen de vegetación en cada rodal. Los resultados muestran que los rodales de 5 años tuvieron la mayor oferta de semillas, lo cual puede deberse a que existan PHMRUHVFRQGLFLRQHVPLFURDPELHQWDOHVTXHEHQHĆFLHQHO desarrollo de especies de plantas que contribuyan con la oferta de semillas. En relación a las aves granívoras, hubo mayor abundancia en los pinos más jóvenes, por lo que se puede asociar a la oferta de semillas que tengan disponible. Romina Chiappe1*, Cristián Estades1 ǢW2-='89-&!&&',-£'T !$<£;!&&'-'2$-!9 38'9;!£'9 @329'8=!$-Õ2&'£!!;<8!£'A! r$,-!66'W831-2!|+1!-£W$31 ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET &KLOHSRVHHXQDJUDQVXSHUĆFLHGHVXWHUULWRULRGHVWLQDGRD plantaciones de pino radiata, las cuales han sido utilizadas como hábitat por diversas especies de aves. A nivel de paisaje se puede apreciar una heterogeneidad espacial producto del !+'£S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 206 Las garrapatas duras (Acari: Ixodida: Ixodidae) en aves silvestres del Neotropico Daniel González-Acuña1*, José Venzal2, Sebastián Muñoz-Leal3, Santiago Nava4 ǢW2-='89-&!&&'32$'6$-Õ2TǣW£-;38!£238;'T ǤW2-='89-&!&&'!3!<£3TǥW!(!'£! ID t ABSTRACT t Table of Contents garrapata como parásito. La cantidad de relaciones hospedador parásito (ave: garrapata) registradas hasta la fecha han sido 425. Futuras prospecciones, principalmente en ambientes escazamente estudiados, arrojarán con seguridad nuevas aves como hospedadores para las garrapatas del neotrópico. Agradecimiento a proyecto FONDECYT 1130948. r&!2-+32A|<&'$W$£ ORAL PRESENTATION SESSION 18: AVIAN DISEASES Las garrapatas duras (Acari: Ixodoidea: Ixodidae) están representados en el mundo por cerca de 700 especies (78% del total de garrapatas), 122 de las cuales se han registrado en el neotrópico. Con el propósito de analizar el estado del arte de las garrapatas duras descritas en aves neotropicales, revisamos de manera exhaustiva toda la información publicada sobre aquellos estudios realizados que involucraran a este grupo de ácaros parasitando aves neotropicales. En el neotrópico hasta la fecha se han descrito parasitando aves, 33 especies de garrapatas duras incluidas en tres géneros, Ixodes con 14 especies, Amblyomma con 17 y Haemaphysalis con dos. Las especies de garrapatas que presentan una mayor cantidad de hospedadores descritos son Amblyomma longirostre con 103 especies de aves, Ixodes auritulus con 64 y Amblyomma tigrinum con 40. Nueve especies de garrapatas se han registrado solo sobre un hospedador. En total 292 especies de aves neotrópicales han sido reportadas como hospedadores de algunas de las 33 especies de garrapatas duras. Las aves con mayor cantidad de registros de especies han sido 7XUGXVUXĆYHQWULV con 10 especies, Turdus albicollis y Turdus amaurochalinus, ambos con siete especies. En 216 especies de aves (74%) se ha registrado solo una especie de !+'S8!¡8'9'2;!ࣅ329 230 $ IUDPHZRUNIRUPHDVXULQJFRQćLFWLQFRQVHUYDWLRQ Karen Mustin1*, Morena Mills2, Fernanda Michalski3, Juliette Young4, Stephen M Redpath5 ǢW TǣW2-='89-;@3(<''29£!2&TǤW T ǥW&-2#<8+,TǦW2-='89-;@3(#'8&''2 r0!8'2W1<9ধ2|+1!-£W$31 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION &RQVHUYDWLRQFRQćLFWVDUHZLGHVSUHDGFRVWO\DQGFKDOOHQJLQJ to resolve. They typically arise when conservation goals compete with other goals such as farming, hunting, recreation, forestry or other human activities. Examples from the avian world include: the killing of predatory birds, such as the hen harrier (Circus cyaneus) in the UK, which impact upon economically or culturally valuable species such as gamebirds or livestock; interactions between frugivorous birds, such as parrots, and commercial orchards; or where forestry activities are impacted by the protected status of a species, such as the northern spotted owl (Strix occidentalis caurina) in North $PHULFD7KHUHLVDQXUJHQWQHHGWRPHDVXUHFRQćLFWWRKHOS target conservation actions and measure the effectiveness of these interventions. Such measurements have proved elusive as they need to incorporate a range of ecological and social features. Here we propose a framework to measure the {փdփTT ID t ABSTRACT t LQWHQVLW\RIFRQVHUYDWLRQFRQćLFWV:HGUDZXSRQOLWHUDWXUH from institutional analysis and social psychology to extract FRPSRQHQWVRIFRQVHUYDWLRQFRQćLFWVLQFOXGLQJERWKWKHLVVXHV ZKLFKDUHDVRXUFHRIFRQćLFWDQGWKHEHKDYLRXUVGLVSOD\HG We conclude that our methodology will help identify the LVVXHVZKLFKDUHJHQHUDWLQJKLJKHUOHYHOVRIFRQćLFWZLWKLQ a system and furthermore, this standard methodology will facilitate comparison across systems and studies to help SULRULWLVHLQYHVWPHQWLQFRQćLFWLQWHUYHQWLRQDFWLRQV 239 Territorial behavior of the Grey-Bellied Flowerpiercer (Diglossa carbonaria) in an urban environment Daniela Morales Moreno1*, Alvaro Garitano-Zavala1 ID t ABSTRACT t Table of Contents 114 hours per couple in each season. The three couples kept their territories along the study period, and males and females defended them equally; three agonistic behaviors (scare, chase DQGĆJKWDQGWKUHHYRFDOL]DWLRQVDVVRFLDWHGVRQJWKULOODQG call) were recognized. The agonistic behaviors were performed WRZDUGVELUGVSHFLHVLQFOXGLQJFRQVSHFLĆFVDQGRQH carpenter bee, most of the agonistic behaviors were executed WRFRQVSHFLĆFVDQGKXPPLQJELUGVWRJHWKHUXVLQJDKLJK rate of scare (range: 27.5 - 53.4%) and chase (40.6 - 62.7%), LQVWHDGRIĆJKW0DOHVXVHGDKLJKHUUDWHRIVRQJV (range: 43.8-94.7%) than females to make them conspicuous to competitors. Therefore, the Grey-Bellied Flowerpiercer is resident, holds annual territories in urban environments and behaves agonistically against other nectar-feeding species. ǢW29ধ;<;3&'$3£3+Ð!T2-='89-&!&[email protected]&'!22&8Ì9 r&!W138!£'9138'23|+1!-£W$31 ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR Territorialism is energetically demanding and is used by species LIWKHFRVWEHQHĆWEDODQFHLVDSSURSULDWH,QFLWLHVWKHUHDUH limited space and food resources for specialized birds, in particular for nectar-feeding ones, despite this, several bird species established in urban areas access to nectar resources. In the Neotropics there are no reports about territorialism for birds of the genus Diglossa in urban environments. In this study we evaluated if the Grey-Bellied Flowerpiercer (Diglossa carbonaria) shows territorial behaviors in an urban area against other nectar-feeding competitors. Three couples were monitored in green areas of La Paz city (Bolivia) along wet (NovFeb) and dry season (Apr-Jul), identifying and quantifying all the behaviors related to territorialism. We used between 84 and !+' S8!¡8'9'2;!ࣅ329 244 Responses of hummingbirds to land use change: insights from taxonomic and functional diversity Boris A Tinoco1*, Vinicio Santillán2, Catherine Graham3 ǢW2-='89-&!&&'£A<[email protected]ǣW-3&-='89-;@!2&£-1!;' '9'!8$,'2;'8TǤW;[email protected]='89-;@ r#ধ23$3|<!A<[email protected]'&<W'$ ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY Most of the current knowledge about the effects of land use change on biodiversity comes from taxonomic diversity studies; nonetheless, other facets of biodiversity, such as functional diversity, could also be affected. We sampled hummingbirds in six landscapes, in the Andes of Ecuador, to H[SORUHWKHLQćXHQFHRIODQGXVHFKDQJHLQWD[RQRPLFDQG functional diversity. The land use gradient was characterized by GIS landscape level variables: landscape diversity, edge {փdփTT ID t ABSTRACT t density and coverage of native vegetation. Hummingbirds were sampled by point counts between 2011 and 2012, from which we obtained taxonomic and functional diversity indices. We also explored how different hummingbird functional WUDLWVPD\LQćXHQFHVSHFLHVUHVSRQVHVWRODQGXVHFKDQJH by performing a RLQ test, an analysis of environment traits relationships. Overall the most abundant species included Metallura tyrianthina, Coeligena iris and Eriocnemis luciani. We GLGQRWĆQGYDULDWLRQLQWD[RQRPLFGLYHUVLW\DFURVVWKHODQG use gradient; however, functional diversity decreased in the most altered landscapes. The RLQ analysis showed associations between bill length and body size, and characteristics of less altered landscapes. Considering that functional diversity is often positively associated with ecosystem functions, the decreased in functional diversity of hummingbirds driven by land use change can be detrimental for the pollination services they provide. This study highlights the importance considering multiple dimension of biodiversity to have better understanding of the potential impacts of land use change. 246 Diversity and distribution of avian haematozoa across an elevation gradient in northern South America ID t ABSTRACT t Table of Contents many groups of organisms. Bird species commonly exhibit narrow elevational distributions and close relatives show sharp replacements along elevational gradients. Although patterns of diversity and distribution of avian taxa in the Andes and other tropical mountains are relatively well known, this is not the case for bird pathogens, which have been hypothesized to mediate elevational replacements and to limit the elevational distributions of species. With the goal of understanding the ecology and evolution of bird-parasite interactions across elevational gradients, we studied the distribution of avian haemosporidian parasites from 700 to 2800 m elevation in the Sierra Nevada de Santa Marta (SNSM) in Northern Colombia. A preliminary assessment of parasites detected using microscopy and molecular analyses based on samples collected from ca. 350 individuals of 65 understory bird species revealed a diverse parasite assemblage, dominated by Haemoproteus, followed by Plasmodium and then Leucocytozoon. Tanagers (Thraupidae) and thrushes (Turdidae) showed high parasite prevalence relative to other groups. Overall prevalence reached 30% and peaked at elevations between 1300-1500 m, where parasite diversity was also high. The peaks in diversity and prevalence of parasites at mid elevations may be related to turnover in avian species distributions along the elevational gradient. Paulo C Pulgarin-R1*, Staffan Bensch2, Daniel Cadena1 ǢW'6!8;!1'2;3&'-'2$-!9-3£Õ+-$!9T2-='89-&!&&'39 2&'9TǣW'6!8;1'2;3(-3£[email protected]<2&2-='89-;@ r6$W6<£+!8-2ǦǢ|<2-!2&'9W'&<W$3 ORAL PRESENTATION SESSION 18: AVIAN DISEASES Montane areas in the Neotropics are highly diverse and FRPSOH[V\VWHPVWKDWKDYHSURPRWHGWKHGLYHUVLĆFDWLRQRI !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 248 Avaliação das correntes de educação ambiental em projetos de birdwatching no Brasil Guilherme Sementili Cardoso1*, Reginaldo José Donatelli2 ǢWÖ9f8!&<!%È3'1-Í2$-!9-3£Ö+-$!9l 33£3+-!mTǣW!#38!;Ö8-3&'82-;3£3+-! r+<-9'1$!8|@!,33W$31W#8 ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II O século XXI é marcado pela crescente preocupação mundial com os temas socioambientais que enfocam a relação entre o homem e o ambiente. A observação de aves (ou birdwatching) surge como uma ferramenta de integração entre a conservação, o desenvolvimento socioeconômico e a educação ambiental. Todavia, é necessário avaliar se os discursos defendidos pelos SURMHWRVGHPRQVWUDPSUHRFXSD©¥RFRPSU£WLFDVVLJQLĆFDWLYDV e transformadoras de educação. Sendo assim, nosso estudo busca avaliar quais as correntes de educação ambiental presentes nos projetos birdwatching pelo Brasil. Os projetos IRUDPVHOHFLRQDGRVSRUXPOHYDQWDPHQWRELEOLRJU£ĆFR utilizando palavras-chave relacionadas com birdwatching, educação ambiental, ecoturismo e ornitologia. Escolhemos apenas os artigos e resumos publicados em periódicos e anais. Após uma leitura criteriosa, categorizamos as correntes de HGXFD©¥RGDVSURSRVWDVVHJXQGRRWH[WR8PDFDUWRJUDĆD das correntes em educação ambiental- de Lucie Sauvé. Foram LGHQWLĆFDGDVDVFRUUHQWHVSULQFLSDLVHVHFXQG£ULDVSUHVHQWHV WDQWRQDVFRQFHS©·HVLQLFLDLVTXDQWRQDVSURSRVWDVĆQDLVGRV HVWXGRV$QDOLVDPRVSURMHWRVHYHULĆFDPRVDSUHGRPLQ¤QFLD da corrente recursista nas concepções iniciais e propostas ĆQDLV(PGRVSURMHWRVKRXYHXPDGHVYLRQRGLVFXUVR1D maioria dos casos, o discurso de sustentabilidade foi desviado para as correntes recursista ou resolutiva. Num primeiro !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents momento há uma preocupação com temas socioambientais que se, desviam para a exploração consciente de recursos e a resolução de problemas. Em 26% dos estudos, houve um esvaziamento de conteúdo em educação ambiental, com a diminuição de correntes no decorrer do discurso. 251 Did change spectro-temporal and synchronization features in the White-eared Ground-sparrow (Melozone leucotis) duets according to different contexts? Carolina Méndez1*, Luis Sandoval1 ǢW2-='89-&!&&'39;!-$! r$!8-;31'2&=!97|+1!-£W$31 ORAL PRESENTATION SESSION 8: BIOACOUSTICS I Territorial defense and mate guarding are in general the two main hypotheses of duets functions. Nevertheless, acoustic characteristics of duets under both functions have rarely EHHQTXDQWLĆHGLQGHWDLO7KHDLPRIWKLVZRUNZDVWKHUHIRUH to analyze changes in the spectro-temporal characteristics and variations of synchronization in White-eared Groundsparrow duets produced under two context: territory defense and mate guarding. If context affect either the spectrotemporal characteristics or synchronization, we expect to observe differences when compare duets of the same pair in each context. We conducted the study in 35 color banded ground-sparrows pairs in Costa Rica, during breeding season in 2014. To examine duet characteristics under mate guarding context, we recorded pair duets produced spontaneously when members of the pair came into contact. To analyze duet characteristics under a territory defense context, we recorded duets produced in response to simulate intrusions simulated {փdփTT ID t ABSTRACT t by using acoustic playbacks. To analyze synchronization, we compared the variation in duration of the initial, middle, DQGĆQDOVHFWLRQRIGXHWVSURGXFHGXQGHUERWKFRQWH[WV Spectro-temporal characteristics and synchronization of duets were similar under both contexts. However, we noted that when ground-sparrows produced duets in response to playbacks stimulus, they also approached closer and faster to the speaker, maybe to elicit more aggressive responses. We suggest that duets are important in territory defense and that producing duets with overlapping elements could also be related to producing more threatening signals. 257 Comportamento reprodutivo do Tangará- dançarino, Chiroxiphia caudata(Aves, Pipridae) Paulo V. Q. Zima1*, Carlos H. Biagolini-Júnior1, Daniel F. Perrella1, Lais Ribeiro-Silva1, Mercival R. Francisco1 ǢW2-='89-&!&' '&'8!£&'È3!8£39 r6=iA-1!|,3;1!-£W$31 ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I As Aves da família Pipridae, endêmicas da região neotropical, KDELWDPRHVWUDWRP«GLRGDVćRUHVWDVHSRVVXHPFRPR característica o hábito alimentar frugívoro. Os machos de algumas espécies fazem exibições sexuais complexas para atrair as fêmeas. Das 51 espécies, 29 têm seus ninhos descritos, cinco têm descrições de períodos de incubação, e seis têm períodos de permanência dos ninhegos nos ninhos relatados. O Tangará-dançarino, Chiroxiphia caudata, é comum HPćRUHVWDV¼PLGDVHVHFXQG£ULDVGDUHJL¥RVXGHVWHGR Brasil, nordeste da Argentina e leste do Paraguai e dados de sua biologia reprodutiva são pouco documentados. Aqui !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents analisamos 36 ninhos ativos em duas estações reprodutivas HHPXPFRQW¯QXRGH0DWD$WO¤QWLFD bem preservada. Os ninhos foram taças rasas, pendurados por suas bordas em forquilhas horizontais de pequenos arbustos, sobre ou próximos aos córregos. Atividades reprodutivas foram registradas no período de outubro a fevereiro e tamanhos de ninhada foram invariavelmente de dois ovos. O período de incubação foi de 18 dias (n = 7 ovos de 4 ninhos), HRGHQLQKHJRVIRLGHDGLDVQ ĆOKRWHVGHQLQKRV A estimativa total de sucesso dos ninhos foi de 35%, sendo maior do que a maioria dos estudos sobre piprídeos que, possivelmente, foram realizados em ambientes alterados. Os nossos dados dão suporte à teoria de que na família Pipridae apenas fêmeas fornecem cuidados parentais. 260 Manejo genético do criticamente ameaçado Formicivora paludicola: translocações são necessárias? Mariellen C Costa1*, Crisley Camargo, Leslie Gibbs, Luis F Silveira, Mercival R Francisco1 ǢW2-='89-&!&' '&'8!£&'È3!8£39 r1!8-'££'2W$39;!|+1!-£W$31 ORAL PRESENTATION SESSION 20: CONSERVATION GENETICS Populações de espécies ameaçadas frequentemente são pequenas e isoladas e podem ter a viabilidade afetada pela perda de variabilidade genética devido à deriva genética e à endogamia. Quando estes efeitos se tornam críticos, eles podem ser amenizados através da translocação de indivíduos ou da restauração da conectividade das populações. Por isto, FRQKHFHURVQ¯YHLVGHYDULDELOLGDGHJHQ«WLFDHRćX[RJ¬QLFR entre populações são primordiais para que as melhores {փdփTT ID t ABSTRACT t decisões de manejo sejam tomadas. Formicivora paludicola é um passeriforme criticamente ameaçado, endêmico de brejos da Mata Atlântica do Estado de São Paulo, com população estimada em 250-300 indivíduos, distribuídos em apenas 15 áreas isoladas. As maiores áreas apresentam 20, 30 e 45 ha. Nesse estudo foram utilizados17 loci de microssatélites para estimar os níveis de variabilidade genética e a conectividade entre estas três populações. O grau de estruturação genética foi um dos maiores já encontrados para aves neotropicais e análises de coalescência revelaram que são historicamente estáveis e que o isolamento precede as ações antrópicas de fragmentação dos habitats. Os tamanhos efetivos populacionais foram pequenos (31-116 indivíduos), porém sem indícios de endogamia. Dado que isolamento histórico pode implicar em adaptações locais, translocações ou reconexão das áreas poderia implicar em disruptura de complexos adaptativos e esta prática não é indicada. Uma vez que as ameaças continuam constantes, sugerimos que novas populações sejam criadas em áreas protegidas, e que indivíduos de áreas distintas sejam utilizados para compor estas novas e protegidas populações. 261 $YLIDXQDGD%DFLD+LGURJU£ĆFDGRULR8EHUDELQKD (Alto Paraná), Triângulo Mineiro, Minas Gerais Gustavo Bernardino Malacco1*, Eurípedes Luciano Silva-Júnior1, Dimas Pioli1 ǢW993$-!%È36!8!'9;È33$-3!1#-'2;!£&38-Ç2+<£3-2'-83 r1!£!$$3|+1!-£W$31 ID t ABSTRACT t Table of Contents 0LQDV*HUDLVDEUDQJHQGR£UHDJHRJU£ĆFDGHNPt $LQWHQVLĆFD©¥RGDVDWLYLGDGHVSURGXWLYDVQRV¼OWLPRV DQRVQD%DFLDSURYRFRXVLJQLĆFDWLYRVLPSDFWRVDPELHQWDLV resultando em paisagem com 23% da cobertura vegetal original. Em razão da pressão sobre os recursos hídricos e os ecossistemas associados, torna-se essencial a implantação de ações de monitoramento, pesquisa e gerenciamento da biodiversidade. Dessa forma, entre os anos de 1998 a 2015 realizou-se diagnóstico da avifauna em 31 unidades amostrais da Bacia. Mais seis áreas foram analisadas mediante UHVXOWDGRVGHSXEOLFD©·HVW«FQLFDVHRXFLHQW¯ĆFDV3DUD análise da representatividade da distribuição da avifauna QD%DFLDRSWRXVHSRUUHFRQKHFHUUHJL·HVJHRJU£ĆFDV Registrou-se 362 espécies, sendo 353 diagnosticadas em FDPSRRQGHV¥RFODVVLĆFDGDVFRPRDPHD©DGDVGHH[WLQ©¥R em alguma lista vermelha (Minas Gerais; Brasil; Global), com destaque para Sporophila palustris, S. melanogaster, S. cinnamomea, Alectrurus tricolor, Coryphaspiza melanotis, Geositta poeciloptera e Urubitinga coronata(QWUHDVUHJL·HVJHRJU£ĆFDV destacaram-se em riqueza: Bom Jardim (265) e Cerradão (224). A área de maior riqueza de espécies ameaçadas foi 1DVFHQWHVGRULR8EHUDELQKDHVS«FLHVFRQĆJXUDQGR se importante local de populações de A. tricolor e de área de invernada para espécies do complexo dos caboclinhos (SporophilaVSS2VFDPSRVKLGURPµUĆFRVGHVVDUHJL¥RV¥R intensamente impactados para retirada de argila refratária, sendo necessária a urgente adoção de ações conservacionistas. ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY $%DFLD+LGURJU£ĆFDGRULR8EHUDELQKDORFDOL]DVHQDUHJL¥R GR$OWR3DUDQ£PHVRUUHJL¥RJHRJU£ĆFDGR7UL¤QJXOR0LQHLUR !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 262 $ YLIDXQDDPHQD]DGDGHODYHUWLHQWHSDFLĆFD de Nariño-Suroccidente de Colombia Cristian Flórez-Paí1*, Natalia Bacca-Cortes2 ID t ABSTRACT t Table of Contents 264 Área de acción y uso de hábitat de un juvenil de Spizaetus isidori en un paisaje fragmentado de la Cordillera Oriental de Colombia r$8-9ধ!2*38'A|/!='8-!2!W'&<W$3U$8-9ধ!2(6!-|+1!-£W$31 Daniel Felipe Aristizábal Ramírez1*, Santiago Zuluaga2, Giovany Guevara1, Fausto Sáenz3 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION ǢW2-='89-&!&&'!£&!9Tǣ[email protected]'$;3Æ+<-£!$8'9;!&!TǤW <2&!$-Ö2'3;836-$!£ ǢW fÐ3º!1#Ðf2-='89-&!&!='8-2!TǣW fÐ3º!1#Ð Colombia es considerado el país con mayor riqueza de aves GHOSODQHWD6LQHPEDUJRXQDIUDFFLµQVLJQLĆFDWLYDGHHVWD biodiversidad se encuentra en peligro de extinción. Estudiamos ODDYLIDXQDODYHUWLHQWHSDF¯ĆFDGH&RORPELDXELFDGDVHQWUH \PVQPFRQHOREMHWLYRGHLGHQWLĆFDUODGLYHUVLGDG de aves y conocer las especies amenazadas presentes en esta importante región. Durante salidas realizadas entre el 2007 y 2013 registramos un total de 610 especies de aves agrupadas en 52 familias y 346 géneros, de las cuales un total de 108 especies son catalogadas dentro de las categorías de importancia para la conservación de las aves $,&$,%$'HQWURGHODVHVSHFLHVUHJLVWUDGDVHQFRQWUDPRV Neomorphus radiolosus, Dacnis berlepschi, Micrastur plumbeus, Vireo masteri, Odontophorus melanonotus y Oreothraupis arremonops catalogadas como las especies de mayor riesgo de extinción a nivel regional. De igual manera con esta investigación reportamos 14 especies de aves amenazadas (Crítico-CR, En Peligro-EN, Vulnerable-VU) de la vertiente SDF¯ĆFDGHOVXURFFLGHQWHGHOSD¯V\FRQFOXLPRVTXHODYHUWLHQWH SDF¯ĆFDVHFRQVLGHUDHO£UHDFRQPD\RUFRQFHQWUDFLµQGH aves amenazadas de Colombia y debe considerarse medidas de manejo especial por parte de los entes nacionales. !+'S8!¡8'9'2;!ࣅ329 r&!('!8iǡǧ|,3;1!-£W$31 ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II Spizaetus isidori ocurre en norte de Argentina, Bolivia, Perú, Ecuador, Venezuela y Colombia. Ha sido categorizada “En peligro” a nivel mundial, es una de las rapaces neotropicales menos conocidas y presenta una baja densidad poblacional; estimándose requerimientos de territorio de 100 km2 por cada pareja. Este trabajo evaluó el área de acción y el uso de los diferentes elementos del paisaje de para un juvenil de la especie. Se realizó el seguimiento del juvenil a partir de la toma de registros con coordenadas, tipo de hábitat y actividad, desde su nacimiento hasta los 9 meses de edad, en los lugares donde este se encontraba perchado. El juvenil IXHLGHQWLĆFDGRSRUVXFRORUDFLµQGHSOXPDMHGLIHUHQWHDORV adultos. Los registros fueron tomados cada 25 minutos durante jornadas de seguimiento diarias entre las 0700-1700 horas, y se obtuvo un total de 909 puntos. Se aplicó el método del Mínimo Polígono Convexo al 100% para determinar el área de acción y por medio del estimador Kernel se calculó el uso preferencial de hábitat al 95% de probabilidad. Se obtuvo un área de acción de 149 Ha y las coberturas vegetales al interior del polígono mostraron porcentajes similares (51% para bosque nativo y 49% para potrero). Según el estimador Kernel existe un 95% de probabilidad de uso para el bosque nativo; esto se {փdփTT ID t ABSTRACT t debe a que el individuo siempre utilizó perchas en árboles al interior del bosque, y los potreros solo fueron utilizados para desplazarse de un parche de bosque a otro. Estos resultados sugieren gran importancia del bosque nativo para los juveniles del Spizaetus isidori y corresponden al primer aporte en el conocimiento del uso de hábitat por parte de la especie. 265 De la efectividad de manejo a la efectividad de conservación de áreas protegidas, usando las aves como indicador de evaluación ID t ABSTRACT t Table of Contents dependientes de bosque. La densidad de aves fue mayor en la RFGD y el PNPB. La irremplazabilidad calculada a nivel mundial es mayor en la RFGD, seguida del PNPB. Se analizan los resultados de acuerdo a la extensión, diversidad de ecosistemas, amenazas, antigüedad de creación, manejo y gestión de las AP, entre otros. A pesar de que las AP evaluadas son “efectivas”, se sugiere que el cumplimiento de los objetivos de conservación de las AP en Costa Rica enfrenta mayores retos de los supuestos previamente y, la información que se proporciona aquí es sólo una parte de la necesaria para evaluar la efectividad total y apoyar las decisiones de manejo y gestión. Yuly Lorena Caicedo-Ortiz 29ধ;<;32;'82!$-32!£'2329'8=!$-Õ[email protected]!2'/3&'-&!-£='9;8'lmf 2-='89-&!&!$-32!£&'39;!-$!W93$-!$-Õ2382-;3£Õ+-$!&'39;!-$!lm @<£@£$!-$'&3|+1!-£W$31 ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV Las áreas protegidas (AP) son el instrumento de conservación más consolidado a nivel mundial. Sin embargo, son relativamente escasos los trabajos que evalúan su efectividad, principalmente desde un enfoque ELROµJLFR&RQHOĆQGHHYDOXDUODHIHFWLYLGDGGHWUHV$3FRQ diferente categoría de manejo en Costa Rica, se comparó la composición de la avifauna, se determinó la densidad de ciertas aves dependientes de bosque y se usó el criterio de irremplazabilidad en la evaluación. En cada AP se realizaron puntos de conteo para estudiar las aves y se analizaron valores de irremplazabilidad para la evaluación. En el Refugio de 9LGD6LOYHVWUH*ROĆWR596*VHUHJLVWUDURQHVSHFLHV 139 en el Parque Nacional Piedras Blancas (PNPB) y 158 en la Reserva Forestal Golfo Dulce (RFGD); el PNPB y la RFGD presentaron mayor similitud y mayor número de especies !+'¢S8!¡8'9'2;!ࣅ329 272 Comunidade de aves em áreas de manejo ćRUHVWDOQD$PD]RQLD2ULHQWDOGR%UDVLO Miguel Angel Quimbayo1*, Teresa Cristina Magro2, Hilton Thadeu Couto2 ǢW2-='89-&!&'&33£-1!TǣWc r1-+<'£7|<;W'&<W$3 ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES Este estudo foi desenvolvido no município de Paragominas (Pará), no Centro de Manejo Florestal Roberto Bauch. As amostragens de campo foram feitas entre outubro de 2010 e abril de 2011 durante as temporadas de seca e chuva em seis £UHDVGHPDQHMRćRUHVWDOFLQFR£UHDVFRPDWLYLGDGHVGHSµV exploração dos anos 1997, 2000, 2003, 2006 e 2009, e uma área com atividades de pre-exploração. Foram monitorados seis transetos de 1 km cada um com seis pontos de contagem por transeto, com diâmetro de 50 m durante 15 min. Registraram-se HVS«FLHVQRFHQWURGHGHPDQHMRćRUHVWDOUHSUHVHQWDGDV por 43 famílias. As famílias com a maior abundancia relativa de espécies foram Thamnophilidae (9,44%), Tyrannidae (8,26%), {փdփTT ID t ABSTRACT t Thraupidae (7,08%) e Trochilidae (6,29%). 16 espécies são endêmicas e 10 espécies estão em categoria de risco segundo a IUCN. 235 espécies foram registradas somente nas áreas GHPDQHMRćRUHVWDOGXUDQWHDWHPSRUDGDGHVHFDHFKXYD registraram-se 200 e 165 espécies de aves, respetivamente. A maior riqueza de espécies foi encontrada nas áreas de manejo exploradas nos anos 2000, 2009, 2003 e 1997 (146, 106, 102 e 100 species, respetivamente). Thamnophilidae foi a familia mais abundante em todas as áreas amostradas. EncontraramVHGLIHUHQ©DVVLJQLĆFDWLYDVWDQWRHQWUHDV£UHDVGHDPRVWUDJHP (p<0,005) quanto na interação entre as áreas e as temporadas de amostragem (p<0,005). As espécies com maior abundância QDV£UHDVGHPDQHMRćRUHVWDOIRUDPLipaugus vociferans, Cercomacra cinerascens, Pyriglena leuconota, Pionus menstrus, Ramphastos tucanus, Amazona farinosa e Ara chloropterus (353, 321, 303, 188, 169, 167 and 152 individuals, respectively). 273 $HURG\QDPLFHIĆFLHQF\RIZLQJPRUSKRW\SHVLQWKHSDUWLDOO\ migratory Forked-tail Flycatcher (Tyrannus savana) Valentina Gómez-Bahamón1*, Juan J. Gómez1, Ignacio M. Soto2, Alex E. Jahn3, Daniel Cadena1 ǢW2-='89-&!&&'£392&'9TǣW2-='89-&!&&'<'239 -8'9TǤW2-='89-&!&'9;!&<!£!<£-9;! ID t ABSTRACT t Table of Contents a partial migrant comprised of three sedentary subspecies distributed in Central America and northern South America, and one austral migratory subspecies that reproduces in central and southern South America and spends the nonbreeding period in northern South America. A character that differs among the subspecies is the shape of a notch in the outermost primary feathers, which is narrower in the migratory subspecies. In this project we aimed to: 1) determine LIWKLVFKDUDFWHUGLIIHUVVLJQLĆFDQWO\EHWZHHQWKHVXEVSHFLHV GHWHUPLQHLIWKH\GLIIHULQDHURG\QDPLFHIĆFLHQF\DQG determine if notches are correlated with migratory behavior in a larger phylogenetic context. We determined that 1) the VKDSHRIWKHIHDWKHUVGLIIHUHGVLJQLĆFDQWO\E\XVLQJ)RXULHU ecliptics and principal component analysis; 2) that there is DSRWHQWLDOO\KLJKHUDHURG\QDPLFHIĆFLHQF\LQWKHVKDSHRI the migratory subspecies by constructing 3D models and WHVWLQJWKHPXVLQJćLJKWVLPXODWLRQVDQGE\FRQVWUXFWLQJ robotic models of the wings and testing them in a wind WXQQHODQGWKDWPRGLĆFDWLRQVRIWKHRXWHUPRVWSULPDULHV in the family Tyrannidae are not correlated with migratory behavior. It has been suggested before that this character is used in sexual selection; thus, in T.savana it could be possible that it is under both natural selection and sexual selection. r=W+31'AǢǢ|<2-!2&'9W'&<W$3 ORAL PRESENTATION SESSION 6: ECOMORPHOLOGY I $QLPDOVWKDWć\UHTXLUHDGDSWDWLRQVWKDWDOORZWKHPWR accomplish locomotion according to their ecological needs. 0DQ\PLJUDWRU\ELUGVDUHDEOHWRć\ORQJGLVWDQFHVIRVWHUHG by elongated and pointed wings and lean bodies that allow them to optimize energy consumption. Tyrannus savana is !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 274 Overwintering strategies of migratory birds: a novel approach for making inferences on movement patterns of residents and transients Viviana Ruiz-Gutierrez1*, William Kendall2, Saracco James3 Ǣ[email protected]<2;!-2-8	'8=!;[email protected]ǣW3£38!&3336'8!ধ=' -9,!2&-£&£-(''9'!8$,2-;TǤW,'29ধ;<;'(38-8&36<£!ধ329 ID t ABSTRACT t Table of Contents and transients, in the absence of recaptures of individuals at multiple sites. The MSORD-SU also allows us to estimate the proportion of individuals that reside in the study area relative to the total number of individuals that use the area (residents + transients), which is a useful metric for determining the ecological importance or conservation value of an area. r=-=-!2!W8<-A|81#3W38+ ORAL PRESENTATION SESSION 7: MIGRATION AND SEASONAL VARIATION Patterns of movement in wildlife populations make up the core foundation of much of our current ecological knowledge. Direct measures of movement can be made using marked individuals, but this requires a spatial allocation of capture effort that is not feasible for most studies. We demonstrate how movements can be monitored indirectly by accounting for permanent and temporary emigration, as well as transience. We apply a multistate open robust design with state uncertainty model (MSORD-SU) to account and estimate transience, to infer movement patterns of overwintering migrants. We applied the MSORD-SU to eight species of Neotropical migrants, using a data set of captures from 14 countries collected in 20022XUUHVXOWVLGHQWLĆHGRYHUZLQWHULQJPRYHPHQWSDWWHUQV which were largely independent of prior categorization of territoriality for each species. The timing of when transients enter a site varied widely between species, and did not correlate with when residents entered a site. Residents of all species were likely to enter a site early in the season, but on average, individuals did not remain at sites for the full duration of the overwintering period. The MSORD-SU model is a useful tool to correct for and estimate dynamics of both residents !+'£S8!¡8'9'2;!ࣅ329 275 Aportes de la avifauna a la ordenación forestal en el Departamento del Tolima (Colombia) Miguel Angel Quimbayo1*, Hugo Nelson Loaiza1 ǢW2-='89-&!&'&33£-1! r1-+<'£7|<;W'&<W$3 ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II Este estudio fue realizado en bosques naturales del departamento del Tolima para el desarrollo del Plan General de Ordenación Forestal. Se muestrearon seis tipos de bosque: húmedo tropical (bh-T), muy húmedo montano bajo (bmhMB), muy húmedo montano (bmh-M), húmedo montano bajo (bh-MB), húmedo premontano (bh-PM) y seco tropical (bsT), distribuidos en ocho Unidades de Ordenación Forestal 82)LGHQWLĆFDGDVSDUDGHWHUPLQDUVXXVRFRPR£UHDVGH protección o de producción. La avifauna fue muestreada mediante conteo por puntos y capturas con redes de niebla. Se registraron 317 especies (59 familias y 19 órdenes). Las familias más representativas fueron Tyrannidae (17,03%), Thraupidae (11,99%) y Trochilidae (10,09%). Se registraron cuatro especies endémicas, seis de gran tamaño y amplio rango de distribución, dos migratorias y cuatro en categorías de riesgo según la IUCN. En UOF I 154 especies (115 en bs-T {փdփTT ID t ABSTRACT t y 125 en bhT), En UOF II 158 especies (94 en bmh-MB, 53 en bmh-M y 69 en bh-MB), en UOF III 51 especies solo en bmh-M, en UOF IV 97 especies solo en bs-T, en UOF V 63 especies solo en bmh-M, en UOF VI 113 especies (106 en bh-MB) y 47 en bmh-MB), en UOF VII 139 especies (101 en bmh-MB, 37 en bh-PM y 57 en bs-T) y en UOF VIII 99 especies VRORHQEK0%)LQDOPHQWHQRVHLGHQWLĆFDURQ£UHDVSDUD SURGXFFLµQIRUHVWDO\VLVHLGHQWLĆFDURQ£UHDVIRUHVWDOHVGH protección para preservación y para uso sostenible en las cuales se plantean actividades como investigación, vedas y prohibiciones, monitoreo, educación y sensibilización ambiental. 279 Estrategias para incrementar la funcionalidad de las aves en la restauración ecológica del bosque sub-andino Nestor Peralta-Zapata 2-='89-&!&!$-32!£&'3£31#-!f <2&!$-32!;<8! 2'9;386'8!|+1!-£W$31 ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV El establecimiento de plantas dispersadas por aves bajo perchas DUWLĆFLDOHVHVXQSURFHVRSRFRHVWXGLDGRHQHO1HRWUµSLFR que podría usarse como herramienta en la recuperación de hábitats o en la restauración ecológica. Se puso a prueba, si en pastizales cercanos a bosques sub-andinos la regulación del microclima del suelo (con vegetación pionera), el control GHODKHUELYRU¯DODGLVSRVLFLµQHVSDFLDOGHSHUFKDVDUWLĆFLDOHV y la cantidad de cobertura vegetal cerca a estas estructuras afecta el establecimiento de plantas dispersadas por aves. Se instalaron 40 perchas, que se distribuyeron en dos tipos de disposición espacial, a los cuales se les aplicaron diferentes tratamientos. Bajo las perchas se registró el establecimiento !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents de 440 individuos de 22 especies de plantas dispersadas por aves. Entre las plantas mas abundantes se encuentran Viburnum triphyllum y Bocconia frutescens. Por su parte se registraron cerca de 75 individuos de 22 especies de aves visitando las SHUFKDVDUWLĆFLDOHVCrotophaga ani y Tangara vitrolina fueron las especies dispersoras que más visitaron las perchas. Hubo una gran variación en el número de individuos y de especies de plantas establecidas en los diferentes tratamientos; sin embargo áreas con cobertura vegetal cerca y con perchas agrupadas tienden a incrementar la cantidad de especies de plantas que se establecen y de aves que visitan las perchas. (QFRQFOXVLµQODVSHUFKDVDUWLĆFLDOHVSXHGHQDXPHQWDUOD cantidad de plantas nativas de consumo para las aves en la zona de estudio, sin embargo falta por explorar metodologías P£VHĆFLHQWHVSDUDRSWLPL]DUODIXQFLµQHFROµJLFDGHOD dispersión en los procesos de restauración ecológica. 282 $UHUHVSRQVHVWRKHWHURVSHFLĆFPREELQJFDOOV learned or innate in Neotropical birds? Luis Sandoval1*, Dave Wilson2 ǢW2-='89-&!&&'39;!-$!TǣW'138-!£2-='89-;@3('>(3<2&£!2& r#-39!2&3=!£|,3;1!-£W$31 ORAL PRESENTATION SESSION 8: BIOACOUSTICS I Many birds produce conspicuous mobbing calls that cause FRQVSHFLĆFDQGVRPHWLPHVKHWHURVSHFLĆFELUGVWRDSSURDFK and harass the predator. How and why birds respond to the mobbing calls of other species remains unclear. One possibility LVWKDWELUGVOHDUQWRDVVRFLDWHKHWHURVSHFLĆFPREELQJFDOOV with shared predators. Another is that mobbing calls of {փdփTT ID t ABSTRACT t ID t multiple species share structural features that universally UHćHFWSHUFHLYHGWKUHDWRUIHDU,QWKLVVWXG\ZHH[DPLQHGWKH mobbing responses of Neotropical birds to the mobbing calls of Black-capped Chickadees (Poecile atricapillus), which are not found in the tropics. We broadcast chickadee mobbing calls at 6 locations: 2 in Costa Rica, 2 in Colombia, and 2 in Brazil. At each location, we also broadcast two controls: the chickadee “fee bee” song and silence of equal duration. Playbacks were conducted during the temperate breeding season to ensure that responses were not obscured by migrants that were potentially familiar with chickadee vocalizations. For each WULDOZHTXDQWLĆHGWKHVWUHQJWKRIWKHKHWHURVSHFLĆFPREELQJ response as the number of species and individuals that approached the loudspeaker, the closest approach by any bird, DQGWKHWLPHUHTXLUHGIRUWKHĆUVWELUGWRDSSURDFKWRZLWKLQ 5 m of the loudspeaker. Mobbing responses were strong in response to mobbing calls and weak in response to songs and silence. Responses also diminished as the distance between the chickadee distribution and the playback site increased. Our VWXG\VKRZVWKDWOHDUQLQJFDQQRWIXOO\H[SODLQKHWHURVSHFLĆF mobbing responses, and that structural features distinguishing mobbing calls from other types of vocalizations are important. 287 Principais dialetos de curió (Sporophila angolensis, !+' S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents Passeriforme: Emberizidae) cultivados no Brasil e suas implicações na conservação a espécie James Leão Araujo 29ধ;<;3!$-32!£&''97<-99&!1!AÖ2-!c /!1'9W£'!3|-26!W+3=W#8 ORAL PRESENTATION SESSION 12: BIOACOUSTICS II Típica da América do Sul o S. angolensis é uma ave utilizada como “pet” possuindo centenas variações vocais entre populações. A partir de 1970 dialetos extintos foram vetorizados em FDWLYHLURHDWXDOPHQWHFULDGRUHVDOHJDPWHUUD©DVHVSHF¯ĆFDV para cada dialeto. Neste estudo analisaram-se os sete dialetos mais cultivados no Brasil, observando-se os cantos (notas) a quantidade, frequência e tempo. Propõe-se a discussão sobre a relação melhoramento e variabilidade. Os harmônicos foram extraídos do CD de áudio “50 anos de curió”, para o formato wav 44,1 KHz-16 bits (mono), com o Nero Wave Editor v10, os espectrogramas obtidos com o Avisoft v5.2.09, tiveram cantos numerados sequencialmente e na reincidência assinalou-se A, B e C a cada número. As vocalizações apresentam de 7 a 15 tipos de notas divididas em módulos de entrada (3 a 12 notas), de repetição (5 a 14 notas) e de fechamento (5 a 12 notas). A espécie possui cantos agudos decrescentes entre 3 a 6 KHz e 0,18s a 0,64s em média. Os dialetos Praia Grande, Paracambi, Goiana e Vô-vô-viu se afastam do padrão silvestre, devido a provável retirada de trinados e cantos inatos. A busca por raças mais alinhadas aos fenótipos pretendidos, através de cruzamentos endogâmicos, teve como consequência a redução da variabilidade genética da espécie (COUTO et al. 2012) que sob o ponto de vista da conservação dos recursos {փdփTT ID t ABSTRACT t genéticos inviabiliza o uso de aves oriundas desta modalidade de criação em programas de reintrodução na natureza. 296 Cambios poblacionales de las aves que usan el paso portachuelo, Parque Nacional Henri Pittier, Venezuela Miguel Lentino <2&!$-Õ2-££-!1,'£69c3$-'&!&<&<#32&''2'A<'£! 1-+<'££'2ধ23|(<2&!$-32>,6,'£69W38+ ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS El mantener en una región censos anuales por un largo periodo de tiempo, permite detectar cambios en las poblaciones, y es más importante en zonas que son sitios de paso en que la diversidad y abundancia de aves puede ser explosiva por cortos períodos de tiempo y que además ser indicadores de la calidad ambiental. El paso de Portachuelo, es uno de estos sitios en que pasan miles de aves durante la migración de otoño. Durante los últimos 25 años se ha registrado a 330 especies que han usado dicho paso, 53 son migratorias de Norteamérica. Entre 1991VHWUDEDMDURQKRUDVUHG\FDSWXUDURQ aves. El número total de aves capturadas en ese período declinó GHDYHVKRUDUHGDHQ/DVHVSHFLHVPLJUDWRULDV GHFOLQDURQGHDYHVKRUDUHGHQDHQ(O número de especies que usan el Paso se redujo a 201 al eliminar las ocasionales. Al comparar los periodos 1991-1995 vs 20102014, se encontró que la comunidad de aves que utilizan el paso ha cambiado en un 18%. En los últimos cinco años han dejado de usar el Paso, especies de selva nublada (Haplospiza rustica, Pipreola aureopectus, Contopus fumigatus, Chlorostilbon alice) y aumentaron las especies de zonas bajas (Basileuterus culicivorus, Microcerculus marginatus, Hylophilus aurantiifrons, Basileuterus !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents ćDYHROXV). algunas especies de migratorios han dejado de ser capturadas en los últimos 5 años (Setophaga castanea y Vermivora chrysoptera), otras han disminuido su abundancia (Setophaga striata y Catharus minimus). Los datos indican que hay una reducción en la abundancia y diversidad de aves. 298 Diversidade Genética da população de Antilophia bokermanni (Coelho & Silva, 1998) sugere redução populacional histórica Leilton Luna1*, Thainara Souza1, Weber Silva2, Juliana Araripe1, Iracilda Sampaio1, Horacio Schneider1, Péricles Sena Rêgo1 ǢW2-='89-&!&' '&'8!£&3!8ÆTǣW993$-!%È3&''97<-9!' 8'9'8=!%È3&'$399-9;'1!97<Æধ$39 *[email protected] ORAL PRESENTATION SESSION 20: CONSERVATION GENETICS Antilophia bokermanni é uma ave pertencente ao grupo dos “manakins” que se encontra criticamente ameaçada de extinção, sendo endêmica do Estado do Ceará, nordeste do Brasil. Esta espécie vem sofrendo ameaças à sua perpetuação, principalmente pela fragmentação e descaracterização do seu habitat. Este estudo utilizou técnicas de sequenciamento de regiões do genoma mitocondrial (Região controle e ND3) para 35 indivíduos, através de métodos de coletas não invasiva, para avaliar a diversidade genética e aspectos GHPRJU£ĆFRVGHVWDDYH)RUDPHQFRQWUDGRVPRGHUDGRV níveis de diversidade genética para os marcadores avaliados, estando esta distribuída de forma homogênea ao longo da distribuição da população, refutando processo de subestruturação dentro da área ocorrência. Os dados WDPE«PHYLGHQFLDUDPXPSURY£YHOGHFO¯QLRGHPRJU£ĆFR histórico, em dois distintos períodos, há 40.000 anos, que {փdփTT ID t ABSTRACT t compreende o Pleistoceno Tardio e um segundo ponto de LQćH[¥RK£DSUR[LPDGDPHQWHDQRVDWU£VVHQGRHVWH FRUUHVSRQGHQGRDR0£[LPD*ODFLDO7DUGLR,GHQWLĆFDPRVXPD tendência histórica de redução do Nef do A. bokermanni, onde os níveis de diversidade genética aqui apresentados indicam que esta ave não encarou drásticas reduções populacionais, mas sim, vem passando por uma tendência ao decaimento constante desde sua provável fundação. Portanto, não somente as pressões antrópicas e ambientais atuais podem ter levado à sua redução populacional, mas provavelmente a atual diversidade genética observada nesta população deve VHUUHćH[RGHSUHVV·HVDPELHQWDLVHFOLP£WLFDVSDVVDGDV 303 Soundscapes and acoustic activity of the avifauna of Amarakaeri Comunal Reserve, Madre de Dios, Peru Marconi Campos Cerqueira1*, Andres Hernandez1, T. Mitchell Aide1, Jessica L. Deichmann2 ǢW2-='89-;@3(<'8;3-$3TǣW'2;'8(38329'8=!ধ32&<$!ধ32 !2&<9;!-2!#-£-;@T1-;,932-!2329'8=!ধ32-3£[email protected]ধ;<;' ID t ABSTRACT t Table of Contents from a natural gas exploration platform, and approximately 1,500 1-minute recordings were collected from each site in 2FWREHU:HGHYHORSHGVSHFLHVVSHFLĆFPRGHOVIRU the six bird species. The model accuracy was >60% for all species. The models were then applied to all recordings from DOOVLWHVWRGHWHUPLQHSUHVHQFHDEVHQFHDQGDFWLYLW\SDWWHUQV of six species of birds. Two species, Myrmeciza hemimelaenea and Thamnophilus schistaceus, were detected in all sites, whereas +\SRFQHPLVVXEćDYD and Myrmoborus leucophrys were detected in nine and seven sites respectively. In contrast, Percnostola lophotes and Myiothlypis bivittata were detected LQRQO\ĆYHVLWHV$OOELUGVSHFLHVKDGDSHDNRIDFWLYLW\DW AM. The soundscape analysis was used to determine the GHJUHHRIVLPLODULW\DQGELUGGLYHUVLW\FRPSRVLWLRQLQWKH PRUQLQJFKRUXVDPDPRQJWKHVLWHV7KHLGHQWLĆFDWLRQ of the bird species whose songs contribute to the activity peaks in the soundscapes indicates that areas within ~250 m of the platform exhibit lower bird diversity and lower vocal activity relative to sites >250 meters from the platform. r1!8$32-W$!1639W$'87<'-8!|+1!-£W$31 ORAL PRESENTATION SESSION 8: BIOACOUSTICS I Acoustic monitoring is an excellent way to survey many sites simultaneously, but it continues to be a challenge to extract GHWDLOHGSUHVHQFHDEVHQFHGDWDIRUPXOWLSOHVSHFLHVRUWR GHYHORSDELRGLYHUVLW\PHDVXUHPHQWWKDWUHćHFWVWKHRYHUDOO GLYHUVLW\RIPDQ\VLWHV7KLVVWXG\SUHVHQWVVSHFLHVVSHFLĆF analyses for six bird species along with soundscape analyses for 10 sites in the Amarakaeri Communal Reserve using the ARBIMON II web application. Two portable recorders were SODFHGDWĆYHGLVWDQFHVDQGP !+'S8!¡8'9'2;!ࣅ329 304 Abundance patterns of endemic forest birds in a neotropical savanna Luane Santos1*, Miguel Ângelo Marini1 ǢW2-='89-&!&'&'8!9У-! r9!2;39W£<!2'|+1!-£W$31 ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION Local abundance patterns are recognized into species range (geographic distribution area). In order, to understand species abundance patterns is important to assess the relationship with {փdփTT ID t ABSTRACT t ID t climatic and habitat factors. Here we used GLMs with Poisson distribution to assess hypotheses on bird species abundance across the geographic distribution: centroid-periphery and habitat suitability, and to local variables - forest amount and forest cover (NDVI, Normalized Difference Vegetation Index, NPEXIIHUDURXQGVXUYH\SRLQWV:HH[SHFWHGWRĆQGD negative relationship between species abundance and the distance to the distribution centroid and a positive relationship with forest amount and forest cover. We estimate a suitability index using bioclimatic variables in MAXENT. We conducted point-counts (3-5) in 53 independent forest sites across the Cerrado central region and estimated abundance of three endemic bird species. The mean abundance was 5.22±0.72 for Antilophia galeata, 2.98±0.88 for Myiothlypis leucophrys and 4.62±0.71 for Herpsilochmus longirostris:HIRXQGVLJQLĆFDQW relationships only for Myiothlypis leucophrys. The model including distance to centroid, habitat suitability and forest amount explained 36% of the abundance variation. Contrary to our expectations, species abundance decreased with increasing amount of forest and increased with distance to the distribution centroid. Regarding habitat suitability the relationship with species abundance was positive, abundance increased in more suitable sites. Thus, we found that at least for one bird species, abundance probably increases towards the periphery of the distribution in areas of suitable climatic conditions. 305 Ara macao movements and conservation: A !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents comparison of results and implications from point counts, ARGOS and GIS tracking technologies Donald J Brightsmith1*, Janice D Boyd1 ǢW'?!9{2-='89-;@ r-+,;91-;,|$=1W;!1<W'&< ORAL PRESENTATION SESSION 13: PARROT ECOLOGY Understanding avian movements is key for conservation, but differing spatial and temporal movement scales force researchers to face complex trade-offs between location frequency, location accuracy, and data collection duration. Nowhere is this clearer than in the study of psittacines where protective housing greatly increases the weight of tracking devices. We have been studying Ara macao movements in Peru using point counts, Argos satellite telemetry, and GPS tracking for 9 +years. Point counts show high macaw densities from WKHSUHEUHHGLQJVHDVRQWKURXJKćHGJLQJZLWKERWKPDFDZ DEXQGDQFHDQGIRRGVXSSOLHVGURSSLQJSRVWćHGJLQJ$UJRV telemetry shows that 1) most but not all birds leave the area post breeding, 2) non-breeding ranges averaged 1384 ± 1183 km2 (N = 9 birds) and 3) birds ranged up to 150 km from the nest. An experimental GPS collar deployed in 2015 gave us 3 weeks of high precision movement data. The bird spent about half the time within 50 m of the nest and trips >1 km from the nest were rare (< 2 per day). Despite the reported importance of clay licks 1) clay licks were visited only 60% of the days during breeding, 2) visits did not occur immediately before or after foraging bouts suggesting clays may not be used to protect from dietary toxins, and 3) licks were rarely visited during the non-breeding season. Conservation implications from our {փdփTT ID t ABSTRACT t data sets are complementary: Argos data suggest that loss of habitats up to 150 km away could reduce breeding populations by reducing post breeding survival and GPS data suggest that conservation of breeding habitat needs to preserve not only nest trees but also nearby regions of high food plant densities. 307 (IHLWRVGDIUDJPHQWD©¥RćRUHVWDOQRFRPSRUWDPHQWRVRFLDO de Corapipo gutturalis em uma paisagem da Amazônia Central Mariana Tolentino1*, Marina Anciães1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-! r1!8-!2!;3£'2ধ23|+1!-£W$31 ID t ABSTRACT t Table of Contents encontramos leques. Machos jovens se mostraram sensíveis à métrica de leque, sendo mais frequentes em palcos mais distantes de outros palcos. Já a distribuição de machos adultos e a taxa de exibição foram explicadas por fatores da paisagem. Enquanto machos adultos são mais frequentes em SDOFRVURGHDGRVSRUPDLRUSRUFHQWDJHPGHćRUHVWDSULP£ULD a taxa de exibição foi menor em palcos mais próximos a borda. C. gutturalis, apesar de comum na paisagem, apresenta PXGDQ©DVFRPSRUWDPHQWDLVGHYLGR¢IUDJPHQWD©¥RćRUHVWDO que ao longo do tempo pode afetar aspectos populacionais por mudanças em padrões de movimentação e acasalamento, o que poderia afetar a viabilidade destas populações. ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION &RPRHIHLWRGDIUDJPHQWD©¥RćRUHVWDOREVHUYDPVH principalmente alterações na riqueza e abundância de espécies. Entretanto, poucos estudos avaliaram efeitos da fragmentação no comportamento das espécies. Testamos se o comportamento social de Corapipo gutturalis (Ave-Pipridae), espécie de sub-bosque com sistema de leque, apresenta variações em resposta a variações ambientais em uma paisagem fragmentada da Amazônia Central. Capturamos, anilhamos e observamos indivíduos da espécie em seus palcos nos leques em 11 áreas: quatro de fragmentos de 1, três GHGRLVGHKDHGRLVSORWHVGHKDHPćRUHVWDV contínuas . Registramos o número de machos jovens e adultos, e suas taxas de exibição. Testamos o efeito de métricas de paisagem (distância do palco até a borda mais próxima e SRUFHQWDJHPGHćRUHVWDSULP£ULDHPXPUDLRGHPH métricas de leque (distância do palco ao palco e leque mais próximo), utilizando GLM e comparações de modelos com verossimilhança. Em fragmentos menores que 10 ha não !+'S8!¡8'9'2;!ࣅ329 315 Multiple lineages and cryptic diversity in the Automolus infuscatus complex (Aves:Furnariidae) Eduardo D. Schultz1*, Camila C. Ribas1 1. 29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-! r'&9#-3|+1!-£W$31 ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY & PHYLOGEOGRAPHY Although the Neotropical region harbors more avian species than any other on Earth, the knowledge of this diversity is still incipient. Poor taxonomic knowledge leads to underestimating the number of species and misinterpretation of evolutionary and biogeographic processes. Examples of this problem are the species in the genus Automolus, endemic to the Neotropics and morphologically very similar. Recent studies indicate the polyphyly of A. infuscatus. However, the lack of a broad sampling left gaps in the understanding of how many lineages there are and what are the limits of their distributions. Thereby we {փdփTT ID t ABSTRACT t investigated the phylogenetic relationships among the lineages included in the A. infuscatus complex and other closely related lineages and assessed their geographical distribution. For this we broadly sampled nuclear and mitochondrial markers for the known distribution of each lineage of the complex. Our results corroborate the non-monophyly of A. infuscatus and indicate the validation of some of the subspecies described in the literature, with new insights on their distribution limits. The remaining species of the complex, A. ochrolaemus, A. subulatus, A. paraensis, A. leucophtalmus and A. lammi were PRQRSK\OHWLFLQRXUDQDO\VLV6WLOODGGLWLRQDOLQWUDVSHFLĆF VXEOLQHDJHVZHUHLGHQWLĆHGVHSDUDWHGE\GLIIHUHQWJHRJUDSKLF barriers, already known for other bird lineages. The future comparison of the divergences of different lineages, allied to GHPRJUDSKLFDQDO\VLVZLOODOORZXVWRHYDOXDWHWKHLQćXHQFH RIWKHPDLQELRJHRJUDSKLFHYHQWVRQWKHGLYHUVLĆFDWLRQ of the clade, with implications for the comprehension of the evolution of the Neotropical forest landscapes. 319 How much does vegetation matter? The importance of environmental variables for the distribution of Anopetia gounellei (Aves: Trochilidae) Erica C. Nolasco1*, Thiago Moura2 ǢW39;+8!&<!;'83+8!132!8;,$-'2$'9!2&2=-8321'2;!£ 3&'£-2+f2-='89-&!&'9;!&<!£&' '-8!&'!2;!2!TǣW 33£[email protected] 39;+8!&<!;'83+8!1f2-='89-&!&'9;!&<!£&' '-8!&'!2;!2! ID t ABSTRACT t Table of Contents closely relation with dry climates and vegetations, but no one knows the contributions of them to the species habitat suitability. To address the issue, we tested the importance of bioclimatic (temperature, precipitation, evapotranspiration and elevation) and vegetational variables on a species GLVWULEXWLRQPRGHOLQJ6'0ĆWWHGIRUb$bJRXQHOOHL. We run six SDM algorithms and selected for analysis only the algorithms that performed excellent. We evaluated the variables importance based on 50 randomizations of each variable. The climatic variables was the major contributors for WKHb$bJRXQHOOHLbGLVWULEXWLRQKRZHYHUWKHDUERUHDOFDDWLQJD vegetation has contributed as much as the temperature range. Climate is a major driver of species distribution on large VFDOHVSOD\LQJYHJHWDWLRQDQLPSRUWDQWUROHLQĆQHUJUDLQV While climate limits the distribution, vegetation constrain WKHVSHFLHVWRVSHFLĆFDUHDVLQVLGHWKHVHOLPLWV:HIRXQGWKH VDPHSDWWHUQIRUb$bJRXQHOOHLbGLVWULEXWLRQZKHUHYHJHWDWLRQ with arboreal structure provide a suitable environment DQGFRXOGEHDUHćHFWLRQRIELRORJLFDOLQWHUDFWLRQDVIRRG resources. In the opposite direction, the absence of arboreal structure could be a dispersion barrier, avoiding populations FRQWDFWDQGJHQHWLFćRZDVZHOODVDWUHDWWRWKHVSHFLHV Despite of the great climate contribution, natural vegetation UHYHDOHGWROLPLWb$bJRXQHOOHLbGLVWULEXWLRQDQGWRFRQWULEXWHWR the species habitat suitability, a concerning issue on caatinga region that has 50% of the native vegetation deforested. r'$23£!9$3|+1!-£W$31 ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS $QRSHWLDbJRXQHOOHLbLVDbVWLObSRRUO\NQRZQKXPPLQJELUGPDLQO\ registered inside the caatinga region; apparently it has a !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 324 Avaliação preditiva de perda de habitat potencial para $YHVQDUHJL¥RGHLQćX¬QFLDGDURGRYLD%5 Marcelo A. dos Santos Junior1*, Paulo M. de A. Graça1, Vinícius M. Rocha1, Marina Anciães1, Mario Cohn-Haft1, Fernando H. T. de Abreu1, Juliana da S. Menger2, André P. Antunes1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!fT ǣW'£1,3£;A'2;8'(382=-8321'2;!£'9'!8$,f r1!9/8|-26!W+3=W#8 ID t ABSTRACT t Table of Contents no desmatamento foi de 5%, e no “com estrada” foi de 11%. Segundo essas estimativas, até 2012, as espécies perderam 4% do seu habitat potencial original, enquanto que em 2030, a perda seria de até 8,1% no cenário “sem estrada”, chegando até 16,3% no “com estrada”. Regiões de alta riqueza de espécies estão localizadas onde atualmente há maior grau de ameaça e são as mais afetadas pelo desmatamento previsto para 2030 sendo que 36% delas estão fora das áreas protegidas. ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION A destruição dos habitats, principalmente pelo desmatamento, é a principal ameaça para espécies na Amazônia. A proposta de reconstrução da rodovia BR-319, abandonada desde DPHD©DDELRGLYHUVLGDGHORFDOQRLQWHUć¼YLR0DGHLUD Purus. Simulamos o desmatamento até 2030 para a região da BR-319 com software Dinamica-EGO. Desenvolvemos dois cenários: “sem estrada” que não considera a reconstrução da BR-319 e “com estrada” prevendo sua reconstrução em 2015. Modelamos a adequabilidade de habitat para 42 espécies de Aves usando o software Maxent. Derivamos suas distribuições potenciais e criamos um mapa de diversidade alfa com o somatório destas. Validamos os modelos de desmatamento FRPXPDPRGLĆFD©¥RGRWHVWH)X]]\HRVPRGHORVGHQLFKR usando a curva ROC. Usamos as estimativas do desmatamento acumulado até 2012 (PRODES) e as das simulações para avaliar DHYROX©¥RGDSHUGDGHćRUHVWD8WLOL]DPRVHVWDVHVWLPDWLYDV também, para calcular a perda de habitat por espécie e avaliar a diversidade alfa nas áreas afetadas pelo desmatamento. Comparamos ainda a contribuição das áreas protegidas na GLYHUVLGDGHDOID$£UHDGHVPDWDGDDW«IRLGH$RĆQDO da simulação de 20 anos, no cenário “sem estrada”, o aumento !+'¢S8!¡8'9'2;!ࣅ329 327 Depredación de aves de corral por Spizaetus isidori (Accipitridae), una aproximación desde el estudio de sus hábitos de forrajeo y la dimensión humana Santiago Zuluaga1*, Maria Ãngela Echeverry-Galvis2 Ǣ[email protected]'$;3+<-£!8'9;!&!TǣW32ধ)$-!2-='89-&!&!='8-!2! rA<£<!+!8!6!$'9|+1!-£W$31 ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR El conocimiento de la dieta de Spizaetus isidori es escaso, se considera que se alimenta principalmente de aves y mamíferos silvestres, y aves de corral (Gallus gallus). Históricamente ODGHSUHGDFLµQGHDYHVGHFRUUDOKDJHQHUDGRXQFRQćLFWR entre la especie y las comunidades humanas en algunas zonas de Colombia. Este estudio evaluó los hábitos de forrajeo, la percepción del impacto económico generado por depredación de aves de corral y la aceptación de las comunidades humanas hacía el águila. Los hábitos de forrajeo se evaluaron durante 660 horas de observación directa, en dos nido de la especie, y se registraron datos de ocurrencia y biomasa de las presas. Se realizaron entrevistas, teniendo como grupo objetivo 18 comunidades campesinas (2.706 habitantes) asentadas {փdփTT ID t ABSTRACT t ID t alrededor del corredor biológico “Farallones de Gachalá y Medina” departamento de Cundinamarcá, Colombia. Dentro de las presas aportados por los adultos se registraron 43 ítems presa, distribuidos en 6 taxa. Gallus gallus fue la especie más importante en términos de biomasa consumida y Sciurus granatensis en términos de ocurrencia. Se obtuvo niveles bajos de tolerancia en la competencia por espacio y alimento. La mayor parte de los entrevistados (54,7%) considera que el impacto de la pérdida de Gallus gallus, a causa de Spizaetus isidori, puede hacer que una familia pierda parte o toda su base económica. El 57% de los entrevistados manifestó haber tenido pérdidas, con un promedio de 1,3 DYHVD³RYDORUPRQHWDULRHQWUH86(VWHHVWXGLR describe la situación de la especie desde un enfoque ecológico y etno-ecológico, permitiendo planear medidas de conservación que integren las comunidades rurales. 331 Fatores históricos, espaciais e ecológicos !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents determinantes da composição das comunidades de DYHVćRUHVWDLVGR5LR0DGHLUD3RUWR9HOKR52 Cassiano A.F.R. Gatto1*, Roberta Lúcia Boss2, Mônica Sberze2, Marconi C. Cerqueira3, João Vitor Silva4, Bruno de Freitas Xavier5, Luiza Magalli Pinto Henriques1, Marina Anciães2 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW!#38!;Õ8-3&'=3£<%È3' 31638;!1'2;32-1!£fTǤW2-='89-;@3(<'8;3-$3cfTǥW f$3£3+-!f cfTǦWf 33£3+-!f cf r$!99-!23+!ħ3|+1!-£W$31 ORAL PRESENTATION SESSION 23: AVIAN DISTRIBUTIONS AND GLOBAL CHANGE 3DUDLQYHVWLJDUDLQćX¬QFLDGHIDWRUHVKLVWµULFRVHHFROµJLFRV na estruturação de comunidades da avifauna do Rio Madeira, Porto Velho (RO), amostramos 7 módulos PPBio nas duas margens, em seis expedições (2009-2011). Foram registradas 520 espécies, das quais 386 em censos pontuais (182 pontos; 6.364 indivíduos) e 176 em redes de neblina (17.328 horasrede; 3.379 indivíduos). O Rio Madeira é o principal fator estruturante, por estabelecer limites de distribuição e segregar alo-espécies. Apesar de similares em riqueza e abundância, comunidades em margens opostas apresentam distintas taxas de captura e detecção de espécies entre as margens para vários táxons. Na escala regional, encontramos diferenças nas abundâncias proporcionais de táxons, tanto dominantes quanto raros, entre margens e módulos (NMDS). ANOVA mistas GHWHFWDUDPHVSHFLDOLVWDVHPWHUUDĆUPHHDPELHQWHVDODJ£YHLV DOJXQVGHY£U]HDVRXWURVGHEDL[LRVćRUHVWDLV5HVXOWDGRVHP geral, foram convergentes e co-variaram sempre em níveis KLHU£UTXLFRVHVWDEHOHFLGRVLGHQWLĆFDQGRHIHLWRGR5LR0DGHLUD {փdփTT ID t ABSTRACT t FRPREDUUHLUDGLVW¤QFLDJHRJU£ĆFDHQWUHPµGXORVHQ¯YHOGH alteração antrópica como principais fatores estruturantes. A estrutura da vegetação não foi diretamente relacionada à abundância de espécies, mas módulos entre margens diferiram em tamanho e número de árvores, palmeiras e cipós em três eixos ambientais (PCA), o que demonstra uma provável LQWHUD©¥RHQWUHDVSHFWRVKLVWµULFRJHRJU£ĆFRVHIDWRUHV ORFDLVQDHVWUXWXUD©¥RGDVFRPXQLGDGHVGHDYHVćRUHVWDLV 333 What do we know about the rare and Critically (QGDQJHUHG%ODFNEUHDVWHG3XIćHJEriocnemis nigrivestis Esteban A. Guevara1*, Elisa Bonaccorso2, Joost F. Duivenvoorden3, Tatiana Santander G.1 ǢW='[email protected]'8=!$-Õ2c-8&-('-2$<!&38TǣW'2;83&'2='9ধ+!$-Õ2'2 -3&-='89-&!&@!1#-3£-1Æধ$3T2-='89-&!&'$23£Õ+-$!2&3!1Ì8-$!TǤW 29ধ;<;'(38-3&-='89-;@!2&[email protected];'[email protected]!1-$9T2-='89-;'-;=!219;'8&!1 ID t ABSTRACT t Table of Contents each plot using GIS tools. We modeled BBP presence as a function of microhabitat variables (summarized as PC1 in Principal Component Analysis) and distance to nearest forest border applying Generalized Linear Mixed Models. In addition non-metric multidimensional scaling (NMDS) was employed to characterize hummingbird communities. Our results suggest that landscape variables play a role in habitat VHOHFWLRQVSHFLĆFDOO\WKHGLVWDQFHWRQHDUHVWIRUHVWERUGHU KDGDVLJQLĆFDQWHIIHFWRQRXUKDELWDWPRGHO%%3SUHVHQFH probability increased with distance to forest borders. On the other hand NMDS indicates that BBP and the GS do not overlap spatially. We speculate that, as the species performs seasonal movements, the avoidance of forest borders might reduce the physiological stress caused by altitudinal PLJUDWLRQ2XUĆQGLQJVVXJJHVWWKDWHQVXULQJIRUHVWWUDFW connectivity, between the altitudinal extremes of the species’ range might be crucial for survival during its annual cycle. r'+<'=!8!|!='9$329'8=!$-32W38+ ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III 7KH%ODFNEUHDVWHG3XIćHJ%%3Eriocnemis nigrivestis is a Critically Endangered hummingbird endemic to northwestern high-Andean forests of Ecuador. We investigated habitat use patterns using landscape and microhabitat information. In addition, we explored competition hypothesis concerning %ODFNEUHDVWHG3XIćHJDQG*RUJHWHG6XQDQJHO*6Heliangelus strophianus. We censused hummingbirds along four 1,2 km transects during 2007-2011 period. BBP feeding territories (N=19) and a set of random absence points (N=31) were mapped for further habitat measurement. Microhabitat structure at 12,5 m radius circular plots were taken, and the distance to nearest forest border was estimated for !+'£S8!¡8'9'2;!ࣅ329 337 Avian diversity and composition in native and afforested environments in the Northern Campos Grasslands of Uruguay Juan A. Martínez-Lanfranco1*, Francisco J. Vilella2, Darren A. Miller3 ǢW'6!8;1'2;3(-£&£-('T -9,'8-'9!2&7<!$<£;<8'T-99-99-66-;!;' 2-='89-;@TǣWWW'3£3+-$!£<8='@T336'8!ধ=' -9,!2&-£&£-(' '9'!8$,2-;T'6!8;1'2;3(-£&£-('T -9,'8-'9!2&7<!$<£;<8'T -99-99-66-;!;'2-='89-;@TǤW'@'8,!'<9'[email protected] r/!$3£31£|+1!-£W$31 ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III Pampean grasslands are the most extensive grassland ecosystem of the Neotropics, where habitat loss and {փdփTT ID t ABSTRACT t ID t degradation has been broad. Large scale commercial forestry has become common practice. However, bird communities have not been fully characterized in afforested landscapes in the Pampas. To better understand avian community response to afforestation we conducted 1573 bird point counts within native (grasslands and forests) and afforested habitat types (pine and eucalyptus) of different ages and management regimes during the 2013-14 breeding season in northern Uruguay, on land managed by Weyerhaeuser Co. and other local companies. We documented 3407 individuals of 112 bird species and used rarefaction to compare species richness and evenness, and assessed community structure among habitat types using multivariate techniques. We found higher species diversity, and compositional differences, in native habitat types versus plantations. Avian communities in plantations were more similar to native forests than to grasslands, with one exception. Newly planted stands, available to some grassland facultative birds, were more similar to grasslands than to older plantations or native forests. As plantations aged, bird community shifted to forest generalist assemblages. Plantations of similar age under different thinning practices had different bird communities but similar richness. As plantation structure can be manipulated with predicable bird responses, this information will assist bird conservation in afforested landscapes. Furthermore, relative value of tree plantations to bird conservation in grasslands should be compared to other land uses such as intensive agriculture. 341 Landscape Perception and the Value of !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents Secondary Forests for Atlantic Forest Birds Cassiano A.F.R. Gatto16RĆD&DPSLROR1 ǢWf 33£3+-! r$!99-!23+!ħ3|+1!-£W$31 ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY Primary tropical forests are being replaced by degraded stands of secondary vegetation, while the conservation value of these secondary forests is controversial. Southern Bahia harbors a highly endemic and threatened Atlantic Forest bird community, which is spread over a landscape mosaic of plantations and anthropogenically impacted forests. To understand the importance of forest classes for these bird species we extended DORFDOVFDOHVWUXFWXUHEDVHGIRUHVWFODVVLĆFDWLRQLQWRHDUO\ growth, intermediate growth, and mature forests) to the regional scale and used GLMM to model the responses of birds (in terms of relative abundance) for forest types across multiple spatial scales. Most species exhibit an extra-local LQćXHQFHRIIRUHVWJUDGLHQWVDQGZKLOHWKHVWUHQJWKRIIRUHVW W\SHLQćXHQFHYDULHGDFURVVVSDWLDOVFDOHVLWZDVVWURQJHVW at spatial scales between 500 and 2000m. The distinction between secondary forest classes allowed the recognition of birds clearly associated to minimally structured intermediate growth secondary forests. Secondary forests were important for some threatened and Atlantic Forest endemics (e.g., Amazona rhodocorytha), although sensitive birds were more often associated with mature forests (e.g., Glaucis dohrnii, in isolated patches of mature forest). Unexpectedly, endemic and threatened birds were not markedly distinct in their patterns of landscape spatial response. Our results suggest that minimally {փdփTT ID t ABSTRACT t structured secondary forests have an important present and future role in regional bird conservation. Nevertheless, mature forest stands clearly do have a unique bird community and their role as a biotic repository is not replaceable. 352 Revisão dos itens alimentares das aves do cerrado brasileiro Sérgio Roberto Posso1*, Wagner de Freitas Pereira1, Rosiani Ramos Lopes Brinck1, Giovana Russo Bom1, Laila Ottoni1, Lara Augusto1, Leila S. Belini1, Thais G. Marcon1 ǢW r9863993|,3;1!-£W$31 ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET Não há uma compilação sobre os itens que compõem a dieta alimentar das aves do Cerrado em uma única fonte, QHFHVVLWDQGRVHGHUHSHWLGDVUHYLV·HVELEOLRJU£ĆFDV2 objetivo deste trabalho foi obter uma lista das preferências alimentares das aves do Cerrado brasileiro por meio de XPDUHYLV¥RELEOLRJU£ĆFD7DOUHYLV¥RIRLUHDOL]DGDFRPR auxílio do Google Acadêmico. Uma espécie foi considerada dentro de uma categoria alimentar desde que a literatura indicasse tal categoria em pelos menos 75% das citações. Casos em que esta porcentagem não foi atingida a ave foi considerada onívora. Das 837 espécies de aves ocorrentes no Cerrado, 97 não foram encontradas referências de estudos alimentares e, portanto, carecem de estudo. 310 espécies foram consideradas insetívoras, sendo 96 não-Passeriformes (NP) e 214 Passeriformes (P); 81 carnívoras NP e apenas um Passeriforme (Cyclarhis gujanensis); 138 frugívoras (75NP e 63P); 147 onívoras (57NP e 90P), 35 nectarívoras NP e apenas um Passeriforme (&RHUHEDćDYHROD); 23 granívoras !+'¢ S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents (seis NP e 17P) e quatro detritívoras (Cathartidae). Trabalhos com itens alimentares de aves no Cerrado geralmente indicam um número maior de espécies insetívoras, devido à entomofauna rica e abundante disponível para as aves neste bioma. O alto número de Passeriformes onívoros indica maior plasticidade de uso de recursos alimentares por aves desta ordem. Esta lista proporciona uma única base de consulta que será útil para determinação rápida e segura das LQWHUD©·HVWUµĆFDVGDDYLIDXQDHPWUDEDOKRVGHHFRORJLD conservação e manejo dos ecossistemas do Cerrado brasileiro. 353 Acciones de conservación con el águila harpía (Harpia harpyja) en Panamá Karla Aparicio Ubillús +<-£!!86Ð!f!2!1Æ 08£!W!6!8-$-3|+1!-£W$31 ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV El águila harpía (Harpia harpyja), una de las mayores rapaces, es el ave nacional de la República de Panamá, según la Ley 18 del 10 de abril del 2002. Contamos con el Patronato Amigos del Águila Harpía, creado en 1999, y en donde participan entidades, empresas y personas interesadas. Administra el Centro del Águila Harpía situado en el Parque Municipal Summit (a 30 minutos de la ciudad), que incluye la jaula más grande con un ejemplar vivo (“Panamá”, una hembra de 5 años de edad nacida en el Metro Zoo de Miami, USA) y una exhibición interactiva. En algún domingo del mes de abril, todos los años celebramos el FestiHarpía, una feria a la que asisten cerca de 5.000 personas, en donde se educa y muy cerca de la ciudad. En el campo, en el 2014, y continuando {փdփTT ID t ABSTRACT t con el programa “Promoviendo el orgullo darienita sobre el águila harpía como ave nacional de Panamá” se visitaron 4 comunidades vecinas al Parque Nacional Darién. Cabe resaltar que en Panamá, el Darién es el área más importante para águilas harpías, ya que es allí donde se encuentran las mejores poblaciones y el mejor hábitat. Se realizaron actividades (charlas, presentación de videos, juegos y obras de teatro con títeres) con 704 estudiantes. Panamá es el único país que tiene al águila harpía como ave nacional, tiene la jaula más grande, cuenta con un Patronato que vela por su conservación y es donde se realizan los mayores esfuerzos en Centroamérica. 357 Avifauna de importancia para la restauración ecológica comunitaria en la Laguna de la CochaCuenca Alta de la Amazonía Colombiana Yuri Rosero1*, CRISTIAN FLOREZ1, Jhon Calderón1, Ruben Jurado1, Arias Yenni2 ID t ABSTRACT t Table of Contents alguna categoría de amenaza y 39 especies son migratorias. A partir del análisis de grupos funcionales y el conocimiento tradicional de la comunidad, se logró determinar aves de importancia para dar inicio a estrategias de restauración ecológica comunitaria con especies de aves que aportan por su función dentro de los ecosistemas (polinizadores y dispersores). Dentro de las especies encontradas se destaca Andigena hypoglauca, Penelope montagnii, Trogon personatus, Coeligena torquata, Turdus fuscater, Cacicus chrysonotus, como las especies más abundantes, con una alta vagilidad y consumidores de gran abundancia de especies vegetales nativas empleadas para los procesos de restauración ecológica comunitaria. De igual manera con esta investigación se reportan 20 especies que aportan a los procesos de restauración ecológica del bosque alto andino y además se establece uno de los primeros esquemas de monitoreo con el establecimiento de perchas para aves y parcelas permanentes. ǢW93$-!$-Õ2TǣW83+8!1!&'!$-32'92-&!96!8!'£'9!883££3f r$388'[email protected]<8-ǣǣ|+1!-£W$31 358 Genómica de poblaciones em Cyanocorax yucatanicus ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV con crianza cooperativa en un gradiente ambiental Las aves son especies claves y de gran importancia en la recuperación de los bosques, como un proceso clave en la dinámica de la vegetación natural y cobertura de vegetación después la perturbación. En el marco del proyecto Territorios Sostenibles y Adaptados implementado por la Alcaldía de Pasto y el Programa de Naciones Unidas para el Desarrollo (PNUD) se realizaron talleres con la comunidad y salidas de campo para el levantamiento de la línea base de la avifauna presente en la Laguna de La Cocha. Se obtuvo un total de 213 especies, 148 géneros y 41 familias de aves. 31 especies se encuentran en Flavia Termignoni1*, PATRICIA ESCALANTE1, Juan P. Jaramillo-Correa2, Juan Chable3, ScottV. Edwards4 !+'¢S8!¡8'9'2;!ࣅ329 ǢWfTǣWfTǤWTǥW!8=!8&2-='89-;@ r*!W<!1?|+1!-£W$31 ORAL PRESENTATION SESSION 20: CONSERVATION GENETICS Cyanocorax yucatanicus es endémica de la Península de Yucatán, México, habita en un gradiente ambiental sin barreras JHRJU£ĆFDVH[SUHVDXQVLVWHPDVRFLDOFRQFULDQ]DFRRSHUDWLYD SOXUDO\SUHVHQWDYDULDFLµQJHRJU£ĆFDHQGLPRUĆVPRVH[XDO {փdփTT ID t ABSTRACT t ID t El sistema social con crianza cooperativa en aves sugiere la presencia de alta estructuración genética, altos niveles de endogamia y baja heterocigocidad. Para entender si dicha YDULDFLµQJHRJU£ĆFDVHUHćHMDHQODJHQ«WLFDSREODFLRQDO\HQ el sistema social, colectamos en toda su distribución durante dos años (2012-2013), datos en aspectos del sistema social y su relación con variables ambientales como precipitación y tipos de vegetación. También realizamos bibliotecas genómicas (ddRAD-tag) de 61 individuos para realizar el análisis de la genómica de poblaciones. Los resultados sugieren variación LQWUDHVSHF¯ĆFDHQORVDVSHFWRVHVWXGLDGRVGHOVLVWHPDVRFLDO en relación a los tipos de vegetación contrastantes nortesur de la península (GLM mínimo, p=0.000). Sin embargo, la JHQµPLFDSREODFLRQDOFRQaPDUFDGRUHVSROLPµUĆFRV (SNPs) en equilíbrio de Hardy-Weinberg, indicaron valores de diversidad genética y heterocigosis entre 0.05-0.2, niveles de endogamia de cero y una estructura genética casi ausente (K=2-3). Cyanocorax yucatanicus apesar de expresar crianza cooperativa y distribuirse en un gradiente ambiental, podría emplear otras estrategias sociales (no conciderados en este HVWXGLRFRPRODGLQ£PLFDVGHIXVLµQĆVLµQTXHSRGU¯DQ homogenizar la diferenciación genética y eliminan la estructura. Lo cual podría ser sustancial para evitar consanguineidad y perdida de diversidad genética en esta especie. 362 Occupancy trends of psittacines in Nicaragua over a 20- !+'¢S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents year monitoring period and the conservation implications David Hille1*, David A Wiedenfeld2, Martin LezamaLopez3, Donald J Brightsmith4, Michael A Patten1 ǢW2-='89-;@3(0£!,31!TǣW1'8-$!2-8&329'[email protected] ǤW!93!$-)$3TǥW'?!9{2-='89-;@ r,-££'&!=-&|+1!-£W$31 ORAL PRESENTATION SESSION 13: PARROT ECOLOGY Biodiversity monitoring is a valuable conservation tool when assessing potential conservation and management decisions and can be successfully applied to psittacine conservation. Psittacines are of worldwide conservation concern and Nicaragua has a representation that are confronted with similar conservation problems as are seen throughout the world: habitat loss and pressures from pet trade. We implemented a national psittacine monitoring program in Nicaragua, FRQGXFWLQJVXUYH\VLQDQG to produce a 20-year data set in order to assess population trends for the 16 species in Nicaragua. Surveys included up to 313 point counts, which broadly spanned the three ecological regions of the country. We estimated occupancy rates, using occupancy modeling, for all 4 survey years and tested for VLJQLĆFDQWRFFXSDQF\UDWHFKDQJHVEHWZHHQ\HDUVXVLQJ ANOVA tests. Useful models were produced for 11 of the 16 VSHFLHVDQGVLJQLĆFDQWWUHQGVZHUHGHWHFWHGIRUVSHFLHV 5 increasing and 4 decreasing. Conclusions imply that both increasing and decreasing population trends are driven by ODQGXVHODQGFRYHUFKDQJHDVDUHVXOWRIGHIRUHVWDWLRQEXW there may also be evidence to suggest effects of pressures of pet trade as well. The results help to establish species- {փdփTT ID t ABSTRACT t VSHFLĆFSULRULWLHVLQUHVRXUFHDOORFDWLRQIRUFRQVHUYDWLRQDQG management action to ensure the conservation of psittacine diversity in Nicaragua and the whole of Central America. 364 Status of threatened bird species in Colombia: 13 years of change Luis Miguel Renjifo1*, Angela María Amaya-Villarreal2 ID t ABSTRACT t Table of Contents responses to conservation actions. Yet most changes were due to improvements on knowledge. An increase in total number of threatened species is due to a combination of description of new species or taxonomic splits, and to a lesser extent to species whose population status genuinely declined and are threatened now. Our results emphasize the importance of periodic assessments considering the dynamism of threats, and improvement in knowledge and conservation action. ǢW32ধ)$-!2-='89-&!&!='8-!2!TǣW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3 r£18'2/-(3|/!='8-!2!W'&<W$3 ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS Extinction risk assessments are fundamental for conservation planning and practice. Periodic assessments allow detection of new threats as well as monitoring effectiveness in conservation. We evaluated extinction risk of bird species in Colombia following the IUCN system. With this purpose we characterized species distributions using niche and expert models, and estimated changes in population sizes and distribution based on species ecology, threats, rates of habitat loss or gain, and degree habitat fragmentation. Then we compared changes for Colombian species in 2002 and 2015. We found that 139 species are currently threatened vs. 112 species in 2002. Currently, one endemic species is extinct, 15 are critically threatened (10 endemic), 54 are endangered (21 endemic), and 70 are vulnerable (22 endemic). In addition 27 are near WKUHDWHQHGDQGGDWDGHĆFLHQW:HIRXQGLPSRUWDQWFKDQJHV on species status. A total of 26 species were up listed, 52 down listed, 77 remained in the same category, and several are new to the list. Some variations were due to genuine status changes involving declines and improvements on bird populations and habitats, including a small number species with positive !+'¢S8!¡8'9'2;!ࣅ329 365 Testing competing models for differentiation in Mexican tropical lowland birds: a preliminary assessment Luis A. Sánchez-González1*, Adolfo G. Navarro-Sigüenza1 ǢW r£!9+|$-'2$-!9W<2!1W1? ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS Niche divergence has long attracted interest from evolutionary ELRORJLVWVGXHWRWKHLUSUREDEOHVLJQLĆFDQWUROHLQVSHFLDWLRQ Among Mexican tropical lowland birds, a high number of VSHFLHVDUHGLVWULEXWHGLQERWKWKH*XOIVORSHDQGWKH3DFLĆF slope, yet the environmental conditions seem to be quite different: in contrast to tropical evergreen forests and high KXPLGLW\OHYHOVLQWKH*XOIVORSHWKH3DFLĆFVORSHKDUERUV highly seasonal dry forests. These differences are also evident in the phenotype of bird populations in both slopes, which is translated as subspecies in current taxonomic schemes. :HKHUHWHVWHGWZRFRPSHWLQJGLYHUVLĆFDWLRQPRGHOVDVDQ explanation for differentiation of bird populations in both slopes: a) has this differentiation evolved as a consequence of vicariant mechanisms?, or, b) is this differentiation the outcome {փdփTT ID t ABSTRACT t of a gradient differentiation model, in which bird populations are differentiated as a consequence of adaptation to different ecological gradients? Preliminar analyses have suggested mixed support, thus differentiation may be idiosyncratic. 366 Distribuição e conservação de Cyanocorax hafferi nas FDPSLQDVGRVLQWHUć¼YLRV0DGHLUD3XUXV7DSDX£ Marcelo A. dos Santos Junior1*, Mario Cohn-Haft1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!f r1!9/8|-26!W+3=W#8 ID t ABSTRACT t Table of Contents populacional usando a densidade e o habitat disponível (dados da literatura e DP). A espécie teve sua DP prevista para as FDPSLQDVHFDPSLQDUDQDVGRHQWRUQRVRPDQGRNPt As áreas protegidas cobrem 90% da distribuição potencial, sendo que 59% estão dentro de Unidades de Conservação (UCs) de Proteção Integral, 24% em Terras Indígenas e 8% em UCs de Uso Sustentável. O modelo populacional com dados da literatura estimaram 6409 indivíduos e o feito com a DP estimou 35821 indivíduos. Baseado nesses resultados os graus de ameaça encontrados para a espécie foram vulnerável e quase ameaçada, respectivamente. ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION A destruição dos habitats é a principal ameaça para espécies na Amazônia. A proposta de reconstrução da rodovia BR-319 (Manaus-Porto Velho), expansão madeireira, da agropecuária HTXHLPDGDVDPHD©DPDELRGLYHUVLGDGHQRVLQWHUć¼YLRV formados pelos rios Madeira, Purus e Tapauá. Nas campinas GHVWHVLQWHUć¼YLRVRFRUUHXPDQRYDHVS«FLHGHJUDOKDUHF«P descrita e já ameaçada por pressão antrópica, Cyanocorax hafferi. Utilizamos pontos de ocorrência da espécie e de ninhos de 17 campinas para modelar adequabilidade de habitat usando o software Maxent. Utilizamos 40% dos pontos para validação e derivamos a distribuição potencial (DP) aplicando um limiar de corte, escolhendo probabilidades iguais e maiores a 10%. Validamos o modelo de nicho usando a curva ROC. Usamos as áreas protegidas até 2012 para avaliar a contribuição proporcional na DP. Adicionalmente, com dados de 11 bandos, a partir do número de indivíduos no bando e cálculo da área de vida da espécie obtivemos a densidade de bandos por área. Avaliamos o grau de ameaça de acordo com a IUCN, baseado em modelos de tamanho !+'¢S8!¡8'9'2;!ࣅ329 368 Aspectos de la ecología reproductiva del chorlito cordillerano (Phegornis mitchellii) en los andes de Chile Central Andrea Minoletti1*, Fernando Díaz2, Jim Johnson3, Andrea Contreras1, Anir Muñoz2 ǢW2-='89-&!&&',-£'T !$<£;!&&'-'2$-!9 38'9;!£'[email protected]&'£! 329'8=!$-Õ2&'£!!;<8!£'A!W!#38!;38-3&'$3£3+Ð[email protected]&! -£='9;8'WTǣW'&&'#9'8=!&38'9&'='[email protected]&!-£='9;8'&',-£'T TǤW -9,!2&-£&£-(''8=-$'T£!90!W2$$,38!+'W!2!&!W r!2&8'!W1-23£'ষ|+1!-£W$31 ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I El Chorlito Cordillerano (Phegornis mitchellii) es una especie endémica de los humedales altoandinos, siendo una de las aves playeras más raras del mundo. Su población estimada es de <10.000 individuos, y su hábitat se encuentra amenazado por efectos antropogénicos y climáticos. Nuestro estudio es el primer esfuerzo para determinar aspectos de la ecología reproductiva de P. mitchellii, desarrollándose en el Valle {փdփTT ID t ABSTRACT t ID t del Río Yeso (-33,64° S, -69,93° O), Chile central. Entre 2010-2014, hemos marcado individualmente 101 aves, PRQLWRUHDPRVIDPLOLDV\FODVLĆFDPRVODFREHUWXUDGHO VXHORSDUDFDUDFWHUL]DUHOVXVWUDWRGRQGHQLGLĆFDODHVSHFLH Nuestros resultados muestran que la temporada reproductiva se prolonga desde los meses de septiembre-octubre hasta abril-mayo. La nidada se compone de 2 huevos, los cuales son incubados por ambos padres durante un periodo cercano a los 28 días. El cuidado parental se prolonga por cerca de 45 días, para luego formar una segunda nidada en el mismo VLWLRGHQLGLĆFDFLµQ/RVDGXOWRVWLHQHQXQDDOWDĆGHOLGDGDO sitio reproductivo y a la pareja, y encontramos una fuerte DVRFLDFLµQGHORVVLWLRVGHQLGLĆFDFLµQDORVPDQDQWLDOHV salobres. Los nidos miden en promedio 9,3 cm de diámetro, formados sobre reducidos sectores de suelo desnudo, y se componen de barro, ramas secas y piedras de pequeño tamaño. Nuestro estudio muestra que P. mitchellii forma varias nidadas pequeñas durante una temporada reproductiva relativamente larga, probablemente como una estrategia para aumentar las posibilidades de reproducción ante las condiciones climáticas extremas del ambiente altoandino. 369 $Q£OLVHĆORJHRJU£ĆFDLQGLFDXQLGDGHVHYROXWLYDV !+'¢S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents independentes dentro de Lepidothrix coronata (Spix, 1825) (Aves, Passeriformes) Camila Reis1*, Juliana Araripe1, Iracilda Sampaio1, Alexandre Aleixo1, Péricles Rêgo1, Horacio Schneider1 ǢW<9'<!8!'29'1У-33'£&-c2-='89-&!&' '&'8!£&3!8Æ r$!8'-9#-3|+1!-£W$31 ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY & PHYLOGEOGRAPHY Lepidothrix coronata é uma ave amplamente distribuída pela região Neotropical, principalmente no bioma amazônico. São atualmente descritas oito subespécies, possuindo uma alta complexidade comportamental de coorte, com diferenças HPGHWHUPLQDGRVJUXSRVJHRJU£ĆFRV7DPE«PSRVVXLXPD alta variação de plumagem, sendo seu elevado número de subespécies descrito apenas com base morfológica e GLVWULEXL©¥RJHRJU£ĆFD2SUHVHQWHWUDEDOKRYLVDDYDOLDURV SDGU·HVĆORJHRJU£ĆFRVGHL. coronata através de análise comparativa da coloração da plumagem e análises moleculares baseadas em sequências de genes mitocondriais (ND2 e COI) e nucleares (G3PDH e Mioglobina) de 133 exemplares provenientes de distintos pontos da área de ocorrência no Brasil. Os resultados preliminares obtidos através de GLVWLQWDVDQ£OLVHVĆORJHQ«WLFDVDSRQWDPSDUDDH[LVW¬QFLDGH diferentes populações dentro da espécie, com altos valores de divergência compatíveis com táxons válidos, chegando a valores superiores a 3% para o marcador ND2. Também foram encontrados espécimes de colorações similares em SRSXOD©·HVJHRJUDĆFDPHQWHGLIHUHQWHVHLQGLY¯GXRVGH FRORUD©·HVGLVWLQWDVGHQWURGDPHVPD£UHDJHRJU£ĆFD {փdփTT ID t ABSTRACT t não corroborando com as subespécies descritas. Além disso, assim como em estudos prévios, grandes rios deste bioma devem ter atuado como barreiras que promoveram DGLYHUVLĆFD©¥RGDHVS«FLH3RUWDQWRVXJHULPRVTXH existam unidades evolutivas independentes dentro de L. coronata, podendo esta tratar-se de um complexo de espécies crípticas que merece revisão taxonômica. 370 Atividades de observação de aves realizadas pela ID t ABSTRACT t Table of Contents geral, com 1044 alunos, e 7 para multiplicadores, com 174 professores. Atingiu-se 18 escolas municipais, 1 estadual e 4 particulares. Segundo cálculos da Secretaria Municipal da Educação potencialmente 12075 alunos receberam o conteúdo através dos multiplicadores. O sucesso das atividades se deve a regularidade e capacitação dos técnicos envolvidos. Ao longo dos anos houve aumento da procura por leigos em relação aos estudantes, redução do conteúdo acadêmico e maior investimento no curso voltado para professores. Prefeitura Municipal de São Paulo (PMSP) - 1996 a 2014 Anelisa Magalhães1*, Maria Vicentim, Marcos Vasconcellos, Crede Ricardo, Tiago Ostorero, Juliana Summa, Marco Silva, Maria Carvalho ǢW-=-9È3Ì$2-$!&''&-$-2!';'8-2Æ8-!'!2'/3&! !<2!-£='9;8'c'6!='fǤ !2'£-9!1!+!£,!'9|+1!-£W$31 ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II A PMSP, através da DEPAVE-3, oferece há 18 anos atividades de observação. A estrutura e conteúdo das atividades são adaptadas ao público alvo e objetivos pretendidos. Analisouse duas atividades principais: Mini curso de Observação de Aves e Observação de Aves como instrumento para estudo do meio. A estratégia é demonstrar na prática que há diversidade de fauna na cidade através de uma atividade lúdica. Os cursos possuem carga horária de 12 horas. O conteúdo DERUGDW«FQLFDVGHREVHUYD©¥RGHDYHVRĆFLQDVSDUDH[SORUDU o tema no estudo de ciências (professores), observação PRQLWRUDGDOLVWDJHPHH[LEL©¥RGDVIRWRJUDĆDVGDVHVS«FLHV registradas e palestras de convidados. Durante as atividades são observadas cerca de 50 espécies, número superior às expectativas dos alunos. Realizou-se 26 cursos para o público !+'¢¢S8!¡8'9'2;!ࣅ329 377 Geographically Independent Genetic Structure of the Cantabrian Capercaillie (Tetrao urogallus cantabricus) Alberto Fameli1*, María Morán Luis2, Rolando Rogríguez Muñoz3, Alberto Fernández Gil2, María Bañuelos2, Patricia Mirol1 ǢW['82!8&-23-=!&!=-!\!;<8!£$-'2$'9<9'<1TǣW3-2;-3&-='89-;@ '9'!8$,2-;T-'8'9!16<9T2-='89-;@3(=-'&3TǤW'2;8'(38 $3£[email protected]{329'8=!ধ32T$,33£3(-39$-'2$'9T2-='89-;@3(?';'8 r!£#'8;3(!1'£-|,3;1!-£W$31 ORAL PRESENTATION SESSION 20: CONSERVATION GENETICS The Cantabrian capercaillie (Tetrao urogallus cantabricus: PHASIANIDAE) constitutes a peripheral subspecies inhabiting QRUWKHUQ6SDLQ,WLVFRQVLGHUHGDQ(YROXWLRQDU\6LJQLĆFDQW Unit under high extinction risk, living in patchily distributed high altitude forests. We extracted DNA from feces collected LQĆYH]RQHVVHSDUDWHGE\YDOOH\VLQWKH:HVWHUQSDUWRIWKH Cantabrian Mountains, an area that includes many high quality habitat zones for the bird. We analyzed 9 microsatellite markers in order to assess the possibility of genetic structure and study the effect valleys may have on genetic variability. Global AMOVA showed that zones differ in terms of allele frequencies {փdփTT ID t ABSTRACT t (p=0.005). Pairwise Fst comparisons between zones showed VLJQLĆFDQWGLIIHUHQFHVEHWZHHQWKHPDOSKD H[FHSW for the two in the South of the study area, indicating that the valley between them might not be acting as a barrier to JHQHćRZ*HQHWLF,QWHUSRODWLRQJDYHVLPLODUUHVXOWVZLWK high values of genetic difference between all sampling zones except for the two located in the South. This suggests these zones could be managed as one. Bayesian analyses performed either taking or not into account geographic position of individuals divide the population in two-three clusters with JHQHćRZEHWZHHQWKHP2QHRIWKHPVHHPVWREHPRUH common in the Northwest, and other in the Southeast of the study area, but all of them can be found throughout the study area. This indicates that the valleys between zones do not act as barriers to capercaillies movements, and the differences between sampling zones in terms of allele frequencies may be maintained by behavioral traits rather than geographic barriers. 386 Interação alimentar entre arara-azul (Anodorhynchus hyacinthinus), besouros bruquíneos e acuri (Attalea phalerata) Iara Roberta Azevedo-Niero1*, Wesley R. Silva1 ǢW2-$!16 r-!8!2-'83|+1!-£W$31 ID t ABSTRACT t Table of Contents sofrer predação por larvas de besouros bruquíneos. Como as araras-azuis forrageiam frequentemente no solo, podem encontrar sementes infestadas por estas larvas, o que suscita as seguintes questões: 1) existe algum padrão de infestação das sementes por estas larvas?; 2) araras-azuis distinguem entre sementes infestadas e não infestadas?; 3) quando se alimentam de sementes infestadas, elas ingerem as larvas que encontram? 9HULĆFDPRVVHDSURSRU©¥RGHVHPHQWHVSUHGDGDVSRUEHVRXURV varia entre os períodos seco e úmido e se dependem da presença do exocarpo. Examinamos a morfologia das sementes em busca de pistas que permitissem às araras-azuis distinguir entre as sementes infestadas e não infestadas. Oferecemos experimentalmente sementes com e sem larvas a araras-azuis de vida livre e em cativeiro. A infestação por besouros foi maior no período seco e nas sementes sem exocarpo. As araras-azuis não distinguem entre sementes infestadas e não infestadas, possivelmente porque estas diferem pouco em peso e tamanho e são visualmente idênticas. Mesmo não selecionando sementes com e sem larva, as araras-azuis ingeriram as larvas encontradas nas sementes que abriram. Embora sejam raros os casos de insetivoria em psitacídeos, nosso estudo indica que araras-azuis incluem propositadamente larvas de besouros em sua dieta, um comportamento que pode ter implicações energéticas para essas aves. ORAL PRESENTATION SESSION 13: PARROT ECOLOGY Conhecer a dieta de uma ave vulnerável como a arara-azul (Anodorhynchus hyacinthinus) é de extrema importância para direcionar esforços à sua conservação. No Pantanal SulMatogrossense estas aves se alimentam principalmente de sementes de Attalea phalerata, as quais, uma vez no solo, podem !+'¢S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 392 Renaturalización: Primer año del programa de reverdecimiento de Bogotá vinculando a las aves como eje de la biodiversidad Julian Eduardo Avila-Campos1*, Nadezhda Juliet Bonilla-Sánchez2 ǢW!8&Ð23;Æ2-$339Ì'£'9ধ23<ধ9TǣW2-='89-&!&!$-32!£&'3£31#-! r/<'!=-£!$!|<2!£W'&<W$3 ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II Los procesos de urbanización son reconocidos como factores de intervención humana que representan una amenaza VLJQLĆFDWLYDSDUDODELRGLYHUVLGDG'XUDQWHHOHVWDEOHFLPLHQWR de una ciudad se da lugar a procesos que afectan la estructura y el funcionamiento de las comunidades bióticas, contrastando las condiciones al interior de ecosistemas notablemente diferentes. En los últimos 200 años la colonización y el atractivo económico creciente de la ciudad de Bogotá produjeron una transformación drástica del paisaje, reduciendo los espacios del agua, de los bosques nativos y de las más de 200 especies de aves de la sabana, producto de un territorio HQGXUHFLGR\FDUHQWHGHSODQLĆFDFLµQ(VWDVLWXDFLµQHVW£ siendo afrontada por el equipo de Renaturalización cuyo objetivo es reverdecer la ciudad y darle nuevas oportunidades a su biodiversidad valiéndose del proceso de biomímesis y apostando por el diseño urbano sostenible. Se ha desarrollado el trabajo del primer año teniendo a las aves como eje principal de la biodiversidad, procurando evaluar el potencial de conectividad de las áreas intervenidas para favorecer su movilidad y aprovechar su función de sombrilla para los demás componentes del ecosistema. Se implementaron coberturas vegetales en más de 11.000 m2 de áreas urbanas, de forma diversa y heterogénea con cerca de 150 especies !+'¢£S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents vegetales que aportan diferentes recursos alimenticios y de hábitat a las aves. En los sitios endurecidos se produjeron coberturas no convencionales. Los monitoreos y el interés de la ciudadanía en la conservación de las aves permitieron registrar cuatro especies no reportadas para la región y una casi amenazada (Contopus cooperi) de un total de 82. 393 The Birds of Diadema Marco Silva1*, Gabriel Macedo1, Vagner Cavarzere2 ǢW TǣW r1!8$39!1!|+1!-£W$31 ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES Diadema is the city with the second smallest area of Metropolitan Region of São Paulo, and the second largest SRSXODWLRQGHQVLW\RI%UD]LOZLWKPtRIJUHHQDUHDSHU inhabitant. The vegetation remnants are located mainly near the Billings dam. In these areas, however, there are irregular occupations and lack of basic sanitation. There are no studies documenting the birds of Diadema and, considering the environmental vulnerability of the region, ZHFRQGXFWHGDELUGVXUYH\RIWKHFLW\:HSHUIRUPHGĆHOG WULSVDWOHDVWRQFHDPRQWKIURP0D\WR$SULO during the morning and afternoon using the MacKinnon lists PHWKRG:HLGHQWLĆHGWKHVSHFLHVE\DXGLWRU\DQGRUYLVXDO contact with the aid of binoculars. In total, we accumulated OLVWVKRIVDPSOLQJDQGLGHQWLĆHGVSHFLHVLQ families and 19 orders, including an individual of Phibalura ćDYLURVWULV (near threatened category) and an individual of Parabuteo unicinctus (vulnerable category). There was a high {փdփTT ID t ABSTRACT t dominance of a small number of species. Pitangus sulphuratus - the most abundant species - was present in 50% of the lists. We observed most of the species in the protected areas on the banks of the Billings. We didn´t register understory VSHFLHVZKLFKLVDUHćHFWLRQRIHQYLURQPHQWDOGHJUDGDWLRQ and fragmentation processes. Despite Diadema´s social and environmental problems, the species richness we found is relatively high for an urban area. The results of this study are important for future work such as environmental education programs, comparisons with birds from other areas with different degrees of environmental degradation and human impacts affecting the birds of urban environments. 395 Functional diversity and habitat use of Andean ćRFNVLQPDQDJHGDJURIRUHVWU\ODQGVFDSHV Molly E. McDermott1*, Amanda D. Rodewald2, Stephen N. Matthews3 ǢW,-3;!;'2-='89-;@TǣW382'££2-='89-;@TǤW,-3;!;'2-='89-;@ r1$&'813ħWǨǦ|39<W'&< ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY Agroforestry systems contribute to tropical biodiversity conservation by providing habitat for functionally diverse bird communities. Among these assemblages are foraging ćRFNVWKDWSURYLGHLPSRUWDQWHFRV\VWHPVHUYLFHVVXFKDV pest control and seed dispersal. Socioeconomic pressures KDYHIDYRUHGFRQYHUVLRQDQGVLPSOLĆFDWLRQRIDJURIRUHVWU\ potentially altering ecological functioning. We studied foraging JXLOGVKDELWDWXVHPLJUDWRU\DQGWD[RQRPLFFODVVLĆFDWLRQRI PL[HGVSHFLHVćRFNVWREHWWHUXQGHUVWDQGFRPSRVLWLRQDQG functional diversity among different agroforestry systems. In -DQ)HEZHVXUYH\HGćRFNVLQVKDGHFRIIHH !+'¢S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents shade-cardamom, secondary forest, and silvopastures in the Colombian Andes. Silvopastures supported smaller, less diverse ćRFNVZLWKIHZHU1HRWURSLFDOPLJUDQWVSDUWLFXODUO\3DUXOLGV fewer resident forest specialists (insectivores and understory species), and more common generalist species. Otherwise, distribution of species among foraging guilds was constant DQGIDPLOLHVZHUHHYHQO\GLVWULEXWHGLQćRFNVDPRQJKDELWDWV Richness and abundance of rare forest species increased with surrounding woodland cover and forest connectivity, indicating the importance of the landscape for conservation. Our research demonstrates that suitability of agroforestry IRUIXQFWLRQDOO\GLYHUVHćRFNVPD\EHLPSURYHGE\HQKDQFLQJ vegetative structure in farms and forest connectivity. Though LQWHQVLĆFDWLRQPD\UHSODFHELUGFRPPXQLWLHVZLWKIXQFWLRQDOO\ simpler ones comprised of habitat generalists, our results indicate that some services (e.g., seed dispersal by frugivores) may be maintained in agroforests with adequate tree cover. 404 Revisão sistemática de Zimmerius gracilipes (Aves:Tyrannidae) Ítalo Aguiar1,2*, Alexandre Aleixo1, Horacio Schneider2 ǢW<9'<!8!'29'1У-33'£&-TǣW2-='89-&!&' '&'8!£&3!8Æ r-;!£38+!+<-!8|+1!-£W$31 ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS $SULPHLUDĆORJHQLDGRJ¬QHURZimmerius elevou ao nível de espécie Zimmerius acerDQWHULRUPHQWHFODVVLĆFDGDFRPR subespécie de Z. gracilipes. Isso levou a alguns problemas WD[RQ¶PLFRVHGLĆFXOGDGHVQDGHOLPLWD©¥RGDV£UHDVGH distribuição de Z. gracilipes e Z. acer, pela ausência das populações do sudeste amazônico e do nordeste brasileiro {փdփTT ID t ABSTRACT t ID t nas análises. O objetivo deste estudo é esclarecer os OLPLWHVLQWHUHVSHF¯ĆFRVHQWUHGLIHUHQWHVSRSXOD©·HVGHZ. acer e Z. gracilipes com base em dados moleculares. Foram utilizadas 34 sequências de DNA dos genes COI, ND2 e BF5. $VĆORJHQLDVIRUDPHVWLPDGDVFRPEDVHQRVFULW«ULRVGD Máxima Verossimilhança e Inferência Bayesiana, e estimada DGLYHUVLGDGHQXFOHRW¯GLFD7RGDVĆORJHQLDVUHFXSHUDUDPD PRQRĆOLDUHF¯SURFDHQWUHZ. gracilipes e Z. acer com alto apoio estatístico. As subespécies de Z. gracilipes foram recuperadas FRPRSDUDĆO«WLFDVFRPXPDGLYHUVLGDGHQXFOHRW¯GLFDLQIHULRU a 1% entre elas. Z. acer apresentou uma divisão entre as populações da Guiana e as do sudeste amazônico e nordeste brasileiro, com alto valor de suporte. Esses dois clados possuem distância genética de 1,2%, indicando um processo GHGLYHUVLĆFD©¥RDORS£WULFR2VUHVXOWDGRVFRUURERUDPRV OLPLWHVJHRJU£ĆFRVHVWDEHOHFLGRVDWXDOPHQWHentre Z. gracilipes e Z. acer, baseados em caracteres morfológicos e vocais, com as populações do escudo das Guianas, sudeste amazônico e nordeste brasileiro reconhecidas como Z. acer, e as do oeste Amazônico como Z. gracilipes. No entanto, é necessário ainda LQFOXLUDPRVWUDVGHSRSXOD©·HVGRLQWHUć¼YLR0DGHLUD 7DSDMµVSDUDHVWDEHOHFHURSRVLFLRQDPHQWRĆORJHQ«WLFR como pertencente ao clado Z. gracilipes ou Z. acer. 405 Waterbirds community structure and !+' S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents population trends in Western Ecuador Mateos Judith1*, Agreda Ana2, Santander Tatiana2, Guevara Esteban2, Luzuriaga Nivia3 ǢW2-='89-&!&'2Ì2&'A'£[email protected]ǣW='[email protected]'8=!$-32T ǤW2-='89-&!&'2;8!£&'£$<!&38 r/<&-;1!;'39|+1!-£W$31 ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS The study of community structure and population trends of waterbirds is important to understand mechanisms behind changes in aquatic ecosystems. We rely on bird count data collected twice a year over a nine-year period (2004-2012) to document the structure and changes in bird communities. Our study area encompasses seven wetlands in the coastal region of Ecuador which includes estuaries, inland freshwater DQGDUWLĆFLDOVDOWSRQGVLH(FXDVDO(DFKVSHFLHVUHFRUGHG during counts was assigned a diet and migratory behavior according to bibliography. We applied a Principal Component Analysis to describe community structure. Then, a Generalized Linear Mixed Model was applied to determine drivers of the community structure and explore time trends. Response variable were the bird counts and explanatory variables were \HDUGLHWPLJUDWRU\VWDWXVDQGVHDVRQDOLW\%HVWĆWWHGPRGHO was the linear response of bird counts against year with diet and seasonality as factors. Wilson’s Phalarope was the most abundant species. Many boreal migrants remain in Ecuador during northern summer while austral migrants show large ćXFWXDWLRQV:HIRXQG\HDUO\GLIIHUHQFHVLQDEXQGDQFHVGXH to seasonality and diet. Counts of boreal migratory species exhibit an overall positive trend, while sedentary species {փdփTT ID t ABSTRACT t seem to be declining. Species feeding on invertebrates are the only dietary group with a positive trend. Other species analyzed showed a negative trend. Multivariate methods are straightforward approach to describe community structure. Diet and seasonality are the most important factors explaining species abundances. Sites like Ecuasal Ponds are important wintering sites for boreal migrants. 410 Phylogeny of the polytipic species Piprites chloris (Temmink, 1822; Pipritidae) Sidnei Dantas1*, Carlos Eduardo Portes1, Gragory Silva2, Alexandre Aleixo1 ID t ABSTRACT t Table of Contents 02 nuclear genes for ca. 60 individuals, covering most of the range of the species, making morphometric and vocal measures in the available material, and checking for consistent morphological (color) differences between the populations. Preliminary results using the mitochondrial genes produced a mostly non-resolved tree, although there were some wellsupported clades, like the one from Belém Endemism Center, corresponding to P.c. grisescens, and two non-sisters clades in Atlantic forest, separated by the São Francisco river, hence the unnamed population and P.c. chloris. Relations between these clades are not clear yet, and analysis with more robust data are in progress to better clarify these questions. Morphological and vocal analysis are also in progress. ǢW<9'<!8!'29'1-£-33'£&-TǣW29ধ;<;3&'-3$-Í2$-!9g r91&!2;!9|@!,33W$31 ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY & PHYLOGEOGRAPHY Piprites chloris is a forest canopy Suboscine species with seven subespecies distributed over Amazon and Atlantic Forests in South America. The subspecies differ mainly in underparts color, seemingly showing little or no geographic variation in song. Some populations occupy relatively small ranges under severe deforestation and may be on risk of extinction, once P. chloris is highly sensitive to environmental disturbance. Two populations in particular, P.c. grisescens restricted to Belém Endemism Center in East Pará State, and a recently discovered population in the states of Pernambuco and Alagoas, are certainly to be given a high status of extinction threat in a near future. In the present work, we are making a phylogeny of the species allying molecular, morphological and vocal data. We are sequencing 03 mitochondrial and !+'S8!¡8'9'2;!ࣅ329 412 Temporal changes in body condition correlated among species in hummingbird assemblages? Vitor A. Lima1*, Jaqueline E. Persegona2, Felipe L. Shibuya2, James J Roper3 ǢW2-='89-&!&'-£!'£,!TǣW2-='89-&!&' '&'8!£&3 !8!2ÆTǤW2-='89-&!&'-£!'£,!T r=!8!</3W£-1|+1!-£W$31 ORAL PRESENTATION SESSION 7: MIGRATION AND SEASONAL VARIATION A espécie migratória Tyrannus savana de ampla distribuição no Brasil, apresenta-se em sub-espécies, com destaque T. savana savana (raça meridional), que realiza migração até Equador, Colômbia, Guiana, Curaçao, Trinidad e Texas. Ocorre na Amazônia entre fevereiro a julho, sendo sua área de invernada os campos e adjacências dessa região. Para o Planalto Central do Brasil migra de julho a agosto, se reproduzindo de setembro {փdփTT ID t ABSTRACT t ID t a dezembro. A partir de setembro, passa o seu segundo pico migratório, provavelmente de aves que se reproduzem no Sul do Brasil, Argentina e Uruguai. Após a reprodução no Planalto Central, se deslocam para o Norte de janeiro a fevereiro. Durante buscas de ninhos ativos de aves, nas áreas GHLQćX¬QFLDGLUHWDGRUHVHUYDWµULRGD$+(-LUDX5RQG¶QLD foram registrados ninhos ativos de T. savana (N=7), na localidade dos Igarapés: Jirau, Raul e Mutum, tributários do Rio Madeira, entre os meses de outubro a dezembro de 2014. Em MDQHLURGHHMDQHLURIHYHUHLURGHIRUDPUHJLVWUDGRV jovens e adultos nas localidades supracitadas, diferentemente do esperado em literatura no qual os indivíduos retornam e se reproduzem no Planalto Central. As aves da população do Sul do Brasil se reproduzem um pouco mais tarde que as do 3ODQDOWR&HQWUDOVHQGRHQFRQWUDGRVĆOKRWHVQRVQLQKRVHP janeiro, deixam o Rio Grande do Sul em fevereiro e março, voltando a este Estado em setembro. Portanto comportamento semelhante pode estar acontecendo concomitantemente HP5RQG¶QLD(VWH«RSULPHLURUHODWRQDOLWHUDWXUDFLHQW¯ĆFD de registro reprodutivo na Amazônia de T. savana. 421 An attempt to solve the enigmatic taxonomy of !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents the ‘San Isidro Owl’ (Ciccaba aff. huhula) Juan F. Freile1*, Mitch Lysinger2, Heimo Mikkola3, Elisa Bonaccorso4 ǢW31-;Ì$<!;38-!23&''+-9;83982-;3£Õ+-$39TǣW!#!Ó!9!2 9-&83TǤW2-='89-;@3(!9;'82 -2£!2&TǥW'2;83&'2='9ধ+!$-Õ2&'£! -3&-='89-&!&@!1#-3£-1Æধ$3T2-='89-&!&'$23£Õ+-$!2&3!1Ì8-$! r/(8'-£'3|@!,33W$31 ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS Ciccaba huhula and C. nigrolineata have allopatric distributions in the Neotropical lowlands and foothills. In 1999-2000, an isolated population of Ciccaba was discovered in subtropical forests at San Isidro, Napo province, northeast Ecuador (2,050 m elevation). Individuals of this population appear intermediate between C. huhula and C. nigrolineata, suggesting hybrid origin. However, these species ranges in Ecuador are separated by the Andean massif (4,000 m elevation on average), making the contact between C. huhula and C. nigrolineata very unlikely. C. huhula only ranges below 1,000 m elevation in Amazonian Ecuador, with no known altitudinal movements. Further, there are specimens labeled as C. huhula from Jujuy, Argentina (c. 2,500 m elevation), which apparently resemble “San Isidro Owl”, while there are specimens from AndeanAmazonian slopes of Colombia morphologically intermediate, though more similar to C. nigrolineata. Colombian specimens were described as C. spilonotus but later synonymized with C. nigrolineata. The enigmatic taxonomy of the San Isidro population possibly even sheds doubt on the group as a whole. We are undertaking comparative analyses of plumage, vocalizations, and ecological niches of the “San Isidro Owl”, C. huhula and C. nigrolineata. Our study suggests differences {փdփTT ID t ABSTRACT t in ecological niches among the three forms. Vocalizations are generally similar, but the San Isidro population utters some calls not known for C. huhula and C. nigrolineata. We need to revise more specimens, vocalizations, and genetic material of C. huhula, C. nigrolineata (including C. “spilonotus”), to elucidate the taxonomy of the “San Isidro Owl” and its close relatives. 422 0 L[HGVSHFLHVELUGćRFNVDNH\WR understand tropical bird communities Jenny Munoz1*, Jill Jankowski1 ǢW ID t ABSTRACT t Table of Contents species. This study took place along an environmental gradient (400-3400m) on the eastern slope of the Andes in Peru. In WKLVVWXG\ZHVKRZWKDWOLNHORZODQGVćRFNVPLGDQGKLJK HOHYDWLRQćRFNVDUHGLYHUVHDQGFRKHVLYHPXOWLVSHFLHVJURXSV that exhibit communal territoriality over years. Moreover, based in the co-ocurrence patterns, and elevational ranges of species, we suggest that facilitation-mediated effects play an important role in the range limits of species. Range GLIIHUHQWLDWLRQEHWZHHQćRFNLQJDQGQRQćRFNLQJVSHFLHV was comparable to species level-range divergence of noncongeners indicating large impacts on range limits. Facilitation may be an overlooked factor in bird communities structure. r<!2-;!ǡǣǧ|+1!-£W$31 ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES Understanding the importance of species interactions on community structure is a long-standing goal in ecology. While many studies have focused on negative biotic interactions, the role of other processes has received less attention, in particular facilitation. In birds, facilitation occurs in mixed VSHFLHVćRFNVLQZKLFKLQGLYLGXDOVRIVHYHUDOGLIIHUHQWVSHFLHV IRUDJHDVDVWURQJO\DVVRFLDWHGJURXSWRREWDLQEHQHĆWV from the association. These complex associations had been described in several different habitats during the last century, however there are still a lot of debate in the stability and strength of these associations and the role they play in communities. In this study we assess the stability (space and WLPHRIćRFNVDORQJDQHOHYDWLRQDOJUDGLHQWDQGWHVWWKHUROH of facilitation in the co-ocurrence and distributional patterns of birds To address these questions, we integrated data from ćRFNREVHUYDWLRQVRFFXUUHQFHDQGHOHYDWLRQDOUDQJHVRI !+'S8!¡8'9'2;!ࣅ329 427 Caracterización y dinámica de la Avifauna de las sabanas inundables de la Reserva Natural La Palmita, Casanare, Colombia Diego Carantón Ayala1*, Manuela Restrepo Chica1 ǢW <2&!$-Õ2'9'8=!!;<8!£!!£1-;! r$!8!2;Õ2ǣ|+1!-£W$31 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION Las sabanas inundables de Colombia y Venezuela, se caracterizan por una topografía plana y zonas particularmente bajas que corresponden a áreas que se inundan durante la estación de lluvias. La fuerte dependencia de la dinámica hídrica hace este ecosistema único y vulnerable. Estudiamos la composición, riqueza y estructura, así como la variación estacional y los grupos de dieta de la comunidad de aves en los principales hábitats (sabana, bosque y esteros), en el centro de investigación Reserva Natural La Palmita (Casanare, Colombia).Realizamos censos por transectos distribuidos en {փdփTT ID t ABSTRACT t ORVK£ELWDWVFXDQWLĆFDPRVODDEXQGDQFLDUHODWLYD\DQDOL]DPRV los índices de diversidad para cada hábitat en temporada GHOOXYLDV\VHFD6HLGHQWLĆFDURQHVSHFLHVGHDYHV en lluvias y 223 en temporada seca. Los esteros y bosques que cubren menos área en la Reserva, albergan el 70% de la avifauna total. La riqueza de especies presentó variaciones estacionales en los tres hábitats, siendo máximas en bosques. En los esteros la riqueza aumenta durante las lluvias, mientras que en bosques y sabanas aumenta durante la época seca. Encontramos interacción entre la avifauna de los tres hábitats. Las sabanas y los bosques presentan especies exclusivas y las comparaciones de estructura entre coberturas mostro GLIHUHQFLDVVLJQLĆFDWLYDVHQWUHODVHVWDFLRQHVGHOOXYLD\ seca, dando un aumento en la riqueza y la abundancia de ciertas especies para la época seca. La avifauna estudiada alberga una importante sección de los llanos del Orinoco y es clave la implementación de medidas de conservación. 429 Testing for a shared biogeographic history: bird speciation ID t ABSTRACT t Table of Contents (Furnariidae, Trochilidae, Thraupidae, Emberizidae) with trophic differences (insectivores, nectarivores, frugivores, mix diets), all mountain forest species and similar geographic distributions in the Andes of South and parts of Central America were tested. Co-estimation of relationships and divergence times from mitochondrial Cyt-b and ND2 genes for all sister species groups was done through Bayesian analysis (*Beast). The phylogenetic trees and divergence times suggest in four clades non-concordant topologies. When members of the groups include Central American forms, they are the oldest inside each group, but its spatial relationships and divergence times change in the Northern Andes. Divergence times for the FRGLVWULEXWHGVLVWHUVSHFLHVJURXSVLQWKH1RUWKHUQ$QGHV expand 4MY and must be explained as the result of recurrent events (repeated climatic changes) separating allopatrically the VSHFLHVSDLUVJURXSVLQGLIIHUHQWSHULRGVRIWLPH6RPH*ODFLDO Interglacial cycles affected the distributions and divergence in the same geographical locations, but sorted differently the geographical populations even though having similar ecologies. in the Northern Andes using comparative phylogeography Sergio Cordoba-Cordoba1,2*, Peter Andolfatto1, Henry S. Horn1 430 Exploring the morphology of migration: Are ǢW8-2$';322-='89-;@TǣW93$!$-323+3;!2!&'82-;3£3+-! subspecies of Tyrannus diverging via diet? r9'8+$38&3#!|@!,33W$31 Maggie P MacPherson ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY & PHYLOGEOGRAPHY <£!2'2-='89-;@ Co-distributed species could have a shared evolutionary history with a concerted response to a single event, or have spatial congruence but temporal differences, favoring more independent evolutionary paths but with similar spatial outcomes. Five different species pairs in four separate lineages ORAL PRESENTATION SESSION 6: ECOMORPHOLOGY I !+'S8!¡8'9'2;!ࣅ329 11!$6,'|;<£!2'W'&< Migrants are thought to have increased opportunistic foraging strategies compared to residents, and there is evidence that heterogeneous populations (of specialized individuals) are {փdփTT ID t ABSTRACT t ID t ecological generalists. This phenomenon, termed individual specialization, has been shown in many taxa and such phenotypic variation within populations has also been linked to species thought to be at the cusp of radiations; typically island species such as GeospizaĆQFKHV+HUH,XVHXQLYDULDWH measures of bill morphology across Kingbird (Tyrannus) species and subspecies to answer the question: Are migrant versus resident subspecies of Tyrannus diverging via diet. There are 13 species of Tyrannus, 5 of which have both resident and PLJUDQWVXEVSHFLHV8VLQJ6WXGHQWVWWHVWVDQGFRHIĆFLHQWV of variation in bill morphometrics I found that migrants and residents differed in bill morphology in addition to migrants having increased variation in their morphologies. For example, in Tyrannus savana: nMigrant=371, nResident=90; t-test: bill ZLGWK3ELOOGHSWK3FRHIĆFLHQWRIYDULDWLRQELOO width migrant=0.084, bill width resident=0.064, bill depth migrant=0.082, bill depth resident=0.059. Using principal component analysis (PCA) and discriminant analysis, I discuss WKHPRUSKRORJ\RIUHVLGHQWQ VSHFLHVVXEVSHFLHV LQGLYLGXDOVYHUVXVPLJUDQWQ VSHFLHVVXEVSHFLHV individuals) Tyrannus including wing (wing length and Kipps index) and tail measurements. This research shows how diet (individual specialization within populations in addition to specialist versus generalist population life history strategies) could contribute to divergence in mainland radiations of birds. 438 9 DULDFLµQLQWUDHVSHFLĆFDHQODIRUPD\GLPHQFLRQHV !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents de los nidos de cuatro especies de aves Karla Conejo-Barboza1*, Gilbert Barrantes1 ǢW2-='89-&!&&'39;!-$! r0!£-2!#!8#3A!|+1!-£W$31 ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II Los nidos son el resultado de la combinación del FRPSRUWDPLHQWRWDPD³RGHVDUUROORI¯VLFRHLQćXHQFLD ĆORJHQ«WLFDGHVXFRQVWUXFWRU(VWDHVWUHFKDUHODFLµQKD llevado a extrapolar las descripción del nido de una especie DRWUDVUHODFLRQDGDV$QLYHOLQWUDHVSHF¯ĆFRODIRUPDGHORV QLGRVYDU¯DVHJ¼Q£UHDJHRJU£ĆFDFOLPD\VXVWUDWR1XHVWUR objetivo es analizar la variación en los nidos de cuatro especies GHDYHVGHXQDPLVPD£UHDJHRJU£ĆFDDQDOL]DQGRODVPHGLGDV morfométricas usadas por otros autores y las propuestas en este estudio. Analizamos 12 nidos de Amazilia tzacatl , 17 de Quiscalus mexicanus , 60 de Turdus grayi y 34 de Zonotrichia capensis y tomamos 19 medidas externas y 5 internas, las cuales consideramos como sistemas de medición independientes. Utilizamos análisis de componentes principales para determinar cual sistema de medición (incluyendo los de otros autores) GHĆQHPHMRUODIRUPDGHOQLGRVHJ¼QODHVSHFLH&RQIRUPH DXPHQWDHOQ¼PHURGHYDULDEOHVSRUQLGRVHGHĆQHQPHMRUORV grupos correspondientes a cada especie, pero existe una zona de traslape entre los nidos de Z. capensis, T. grayi y Q. mexicanus. A pesar de esto, los nidos de este último presenta al menos dos formas. Los nidos de A. tzacatl formaron siempre un grupo separado de las otras especies. Al analizar las variables internas, a lo largo del CP1 (86% de la variación) sólo las cámaras de Q. mexicanusQRHVWDEDQELHQGHĆQLGDV3DUDGLIHUHQFLDU {փdփTT ID t ABSTRACT t nidos entre especies no basta con conocer sus dimensiones y menos cuando están basadas en pocos ejemplares. Es posible que la variación que presenta Q. mexicanus le permita usar varios sustratos y favorezca su éxito reproductivo. 443 Short term impacts of selective logging on Amazonian birds: a study in Jamari, Rondônia, Brazil Luiz Mestre1*, Samuel Nienow2, Ricardo Krul1, Luciana Festti1 ID t ABSTRACT t Table of Contents were large frugivores and terrestrial insectivores; and in logged sites small arboreal frugivores and omnivores. The species FODVVLĆHGDVPRVWVHQVLWLYHWRLPSDFWVDQGKDELWDWVSHFLDOLVWV DUHVLJQLĆFDQWO\PRUHDEXQGDQWLQSUHVHUYHGVLWHV6HOHFWLYH logging is impacting locally some bird guilds and species, and it is not known how long the community starts to recover. Finally, we emphasize the importance of continued monitoring of selective logging areas in tropical forests to understand the long-term impacts on Amazonian bird communities. ǢW2-='89-&!&' '&'8!£&3!8!2ÆTǣW29ধ;<;3,-$3 '2&'9&'329'8=!%È3&!-3&-='89-&!&' r£<-AW1'9;8'|<(68W#8 ORAL PRESENTATION SESSION 3: AVIAN CONSERVATION I This study compared the Amazonian bird communities in selective logging sites and preserved areas in Floresta Nacional do Jamari, Rondônia, Brazil. We compared the structure of bird communities (richness, abundance and composition) by sampling eight sites in preserved forests and eight in logged areas (after one to three years regeneration, from 2011 to 2013). Each site was sampled by 12 mist-nets for 2 days, and 24 point counts per treatment. We registered 240 bird species. We captured by mist nets 76 species (618 ind) in preserved sites, and 77 species (465 ind) in logged sites. Preserved sites ZHUHQRWVLJQLĆFDQWO\GLIIHUHQWIURPORJJHGVLWHVVWUXFWXUH richness and abundance) for mist-netted birds. However, we FDSWXUHGVLJQLĆFDQWO\PRUHQHFWDULYRUHVDQGVPDOOLQVHFWLYRUHV in logged forests. We registered by point counts 133 species (1572 ind) in preserved sites, and 115 species (1070 ind) in logged sites. We found consistent differences comparing the bird community structure sampled in preserved versus logged sites. The most abundant birds observed in preserved sites !+'¢S8!¡8'9'2;!ࣅ329 444 Assessing the exposure of the threatened and endemic Atlantic Forest species of Hemitriccus(Aves, Tyrannidae) to future climate change Carlos Eduardo C. E. Arlé1*, Michelle M. T. C. Andreu1, V. S. Schwan1, R. R. Fortes1, M. L. Lorini1 ǢW2-='89-&!&' '&'8!£&39;!&3&3-3&'!2'-83l2--3m r0!&<!8£'|+1!-£W$31 ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION Climate change (CC) has already started to induce responses on several species, and will have far-reaching impacts on biodiversity. Therefore, assessing species? CC vulnerability has great importance to support decision in conservation actions. Ecologic Niche Models (ENMs) provide a useful tool for assessing exposure to CC. Here, we applied ENMs approach to estimate the exposure of Hemitriccus mirandae, H. kaempferi and H. furcatus to future CC and the implications for their conservation status. These birds are endemic to the Atlantic )RUHVWKRWVSRWDQGFODVVLĆHGUHVSHFWLYHO\DV9XOQHUDEOH (VU), Endangered (EN) and VU by the IUCN. We performed {փdփTT ID t ABSTRACT t environmental suitability modelling associating occurrence records to bioclimatic variables. We used six algorithms in an ensemble forecasting approach to model current and future (2050, under A2a scenario) climatically suitable areas. From the present to 2050, climatically suitable areas that are covered by IRUHVWVKRZHGDVLJQLĆFDQWORVVIRU H. mirandae, 85.8% for H. kaempferi and 42.6% for H. furcatus. According the IUCN criterion A3(c), they should be then categorized, respectively, as EN, Critically Endangered (CR) and VU. Despite not changing category, H. furcatus showed a substantial range loss, whilst the other two species are predicted to change towards the more threatened category. Thus, this study suggests that CC can be a severe threat increasing the extinction risk to these species. We highlight the importance of additional studies to assess vulnerability, and recommend that CC impacts should be considered in long term conservation strategies for these and other species endemic to the Atlantic Forest. ID t ABSTRACT t Table of Contents been a long held debate that has not been addressed in birds. In this study we used a phylogeographic approach based on one mitochondrial gene (NADH subunit 2) and a comprehensive geographical sampling of the Pantepui region to characterize the genetic differentiation of populations of Myioborus warblers. Four species of this genus are distributed within the region: M. miniatus occupies the lower slopes of most tepuis, whereas a monophyletic group composed of three endemic species (M. castaneocapillus, M. albifacies, M. cardonai) is present in upper-montane habitats. M. miniatus populations were largely genetically undifferentiated, with few differences when compared to populations from the central Andes. However, upper-montane species were clearly differentiated in three monophyletic groups showing a complex pattern of plumage coloration. Both results support a dynamic Pliocene-Pleistocene scenario of dispersal and vicariance challenging the idea of the Pantepui consisting on isolated habitat islands with highly differentiated communities. 448 Myioboruswarblers from the Pantepui region: old endemism of sky island populations? Jorge L. Pérez-Emán1*, Irby Lovette2 ǢW29ধ;<;3&' 33£3+Ð[email protected]$3£3+Ð!836-$!£T2-='89-&!&'2;8!£&''2'A<'£!TǣW 382'££!#3(82-;,3£[email protected]!2&'6!8;1'2;3($3£[email protected]!2&=3£<ধ[email protected]£[email protected] r/38+'W6'8'A|$-'29W<$=W=' 451 La observación de aves como iniciativa de conservación participativa; proyecto AICAs Putumayo, Colombia de CORPOAMAZONIA Orlando Acevedo-Charry1,2*, Vanessa Perdomo1, -$;38 W!6'8!f38'231, 3,2W<'9'9f-92'8391 ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY & PHYLOGEOGRAPHY ǢW TǣW2-='89-;@3(<'8;3-$3TÐ3-'&8!9$!16<9 The tepuis (table mountains) of northern South America represent an archipielago of sky islands characterized by an important endemism. The relative importance of isolation and dispersal in this region, known as the Pantepui, has La conservación y monitoreo de avifauna en la región Neotropical requiere de participación activa desde la ornitología y un compromiso de pobladores locales para !+'S8!¡8'9'2;!ࣅ329 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION {փdփTT ID t ABSTRACT t ID t asegurar su continuidad. Resulta entonces necesario buscar iniciativas que fomenten la articulación entre el sector académico y las comunidades locales de Latinoamérica. Desde 2010, la autoridad ambiental del sur de la Amazonia colombiana CORPOAMAZONIA inició un proyecto de establecimiento de Áreas de Importancia para la Conservación de Aves en Putumayo, al sur de Colombia. Desde ese momento, se iniciaron una serie de esfuerzos en recopilación y levantamiento de información, así como capacitación a observadores de aves de las comunidades del Putumayo en tres fases: 1) valle de Sibundoy o Andes superiores del Putumayo, 2) piedemonte del Putumayo, y 3) llanura amazónica del Putumayo. Los pobladores locales que iniciaron los procesos de capacitación son ahora observadores de aves agremiados y comprometidos con la conservación de su entorno, y algunos han empezado a contribuir con información de la avifauna a nivel nacional; como la segunda localidad en Colombia de Doliornis remseni y el primer registro en Colombia de Glaucidium parkeri. Además de la capacitación y levantamiento de información, se ha planteado la publicación de guías de campo locales que sirvan de herramienta a los observadores de aves en formación. La guía de aves del valle de Sibundoy ya se publicó, se encuentra en impresión la guía de aves del piedemonte del Putumayo y se está elaborando la guía de aves de la llanura amazónica del Putumayo. 452 Acciones de conservación para las aves de las !+'£S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents Lagunas de Volcán, provincia de Chiriquí, Panamá Karla Aparicio Ubillús +<-£!!86Ð!f!2!1Æ 08£!W!6!8-$-3|+1!-£W$31 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION $ORFFLGHQWHGH3DQDP£HVSHF¯ĆFDPHQWHHQODORFDOLGDG de Volcán en la provincia de Chiriquí, existe un sistema de lagunas a 1,200 msnm, que forma parte de las áreas núcleo de la Reserva de Biosfera La Amistad Panamá, está dentro del Megasitio La Amistad y a esa altitud, es la única área compuesta por un complejo de hábitats entre áreas boscosas, arbustos, cafetales, espejos de agua y marismas, que son el refugio de por lo menos 150 especies de aves. Por dos años consecutivos (2010 y 2011) se realizaron monitoreos de las aves (4 pulsos) desde enero a abril y se documentaron especies que hacen de este sitio como uno de los preferidos para la observación de aves. En el 2013-2014, se inició otro proceso para establecer el Plan de Conservación para la Subcuenca del Río Caisán, Chiriquí con la metodología de Estándares Abiertos. 'HORVREMHWRVGHFRQVHUYDFLµQLGHQWLĆFDGRVSDUDHOVLWLR se seleccionaron a la Penelope purparacens y a las Lagunas GH9ROF£Q6HGHĆQLHURQODVDPHQD]DV\VHJ¼QHO0,5$', DOVLWLR&DLV£QVHOHGHWHUPLQµXQDFDOLĆFDFLµQGHDPHQD]D de ALTO y el análisis de viabilidad de sus cuatro objetos de conservación resultó REGULAR, lo cual es preocupante porque con esta investigación se evidencia el deterioro de la subcuenca ocasionado principalmente por acciones antropogénicas. Se presenta una propuesta de indicadores para evaluar el estado y condición de los objetos de conservación. {փdփTT ID t ABSTRACT t 453 Relationships between landscape structure and trophic guilds of birds in Azapa valley, Chile Francisco Santander1*, Juan Aguirre2, María Angélica Vukasovic1, Sergio Alvarado1, Cristián Estades1 ID t ABSTRACT t Table of Contents using these resources due to the high replacement of native vegetation has suffered from development of agriculture. 454 Evolution of avian eggshell structure: evidence ǢW2-='89-;@3(,-£'TǣW2-Õ2&'82-;Õ£3+39&',-£' for adaptation across elevational gradients? r($3/9!2;!2|<W<$,-£'W$£ David Ocampo1*, Carlos Daniel Cadena1, Gustavo A. Londoño2 ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY ǢW!#38!;38-3&'-3£3+Ð!=3£<ধ=!&''8;'#8!&39T'6!8;!1'2;3&'-'2$-!9 -3£Õ+-$!9T2-='89-&!&&'392&'9T3+3;ÆT3£31#-!T ǣW'6!8;!1'2;3&'-'2$-!9-3£Õ+-$!9T2-='89-&!&T!£-T3£31#-! 7KHLGHQWLĆFDWLRQDQGDQDO\VLVRIHFRORJLFDOJXLOGVKDYHEHHQ fundamental to understand the processes that determine the structure and organization of communities. Studies about birds communities and his relationships with the landscape structure are scarce in the valleys of the Atacama desert. We estimate the density of trophic guilds of carnivore, granivore, LQVHFWLYRUHDQGQHFWDULYRUHELUGVZLWKĆ[HGFRXQWVSRLQWV in 109 stations (6 points per station) during spring (October) between 2006 and 2014. In addition, in every station we characterize the percentage of vegetation cover, along with other variables such as the abundance of water, bare soil and human constructions, among others. Using regression analysis (GLM) we determine that density of carnivores is H[SODLQHGVLJQLĆFDQWO\DQGSRVLWLYHO\SRQO\E\WKH presence of water. The density of insectivorous birds and QHFWDUIHHGLQJZDVH[SODLQHGVLJQLĆFDQWO\DQGSRVLWLYHO\E\ the coverage of water, trees, parks, olives and citrus. A positive association between landscape features and granivores guild was detected only detected a negative association with the presence of water, bare soil and meshes to control aphids. The importance of exotic vegetation like olive trees, citrus gardens and parks indicate that the birds of the valley are !+'S8!¡8'9'2;!ࣅ329 r&W3$!163Ǣǡ|<2-!2&'9W'&<W$3 ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II To understand the elevation distribution in birds is important to consider their breeding biology and how birds are responding to different nesting conditions. It’s known, that eggshell of birds evolved to colonize novel environments, to guarantee the correct embryonic development during incubation. Since eggshell structure is leading the gas exchange between the embryo and the external ambient, the shell should be thicker and with less pore density to reduce the water loss and gas exchange in dry and cold ambient, like high-elevation, to avoid the desiccation of the embryo. One ideal place to test this hypothesis of adaptation of the eggshell in tropical birds is the Andes. We evaluated differences in gases conductance rates and eggshell structures, using gases diffusion experiments and scanning electron microscopy. Our functional experiments, involving more than 100 species of Neotropical birds, support the hypothesis that gas diffusion rates across the eggshell vary along elevational gradients. Comparative phylogenetic analyses indicated that eggshell conductance is highly labile evolutionarily and we documented patterns of trait {փdփTT ID t ABSTRACT t evolution consistent with adaptation by natural selection to better retain water vapor in environments with higher gas diffusion rates. However, the mechanisms related to eggshell characteristics underlying this pattern are not the same across our study groups. We found at least two different strategies in variations of the eggshell structure to cope for differences in the gasses diffusion rate of the environment, involving changes in pore characteristics and eggshell thickness. 455 Diversidad y composición de la avifauna en un gradiente altitudinal de Norte de Santander, Colombia Carol Andrea López R.1*, Nabhi Romero R.2, Daira Ximena Villagran3, Linda Carolina Díaz D.4 ǢW2-='89-&!&'&!+Õ[email protected]'$23£Õ+-$!&'3£31#-!TǣW 2-='89-&!&!$-32!£&'3£31#-!TǤW2-='89-&!&-9;8-;!£ 8!2$-9$339Ì&'!£&!9TǥW32ধ)$-!2-='89-&!&!='8-!2! r$£36'AW$32938$-3W99!|+1!-£W$31 ORAL PRESENTATION SESSION 23: AVIAN DISTRIBUTIONS AND GLOBAL CHANGE La variación altitudinal de las montañas genera gradientes climáticos, lo que conduce a hábitats y coberturas vegetales distintas, y a su vez, a comunidades faunísticas diferentes. El departamento de Norte de Santander, que hace parte de ODFXHQFDKLGURJU£ĆFDGHO&DWDWXPERWLHQHXQDYDULHGDGGH ambientes desde los 30m hasta los 4000m. Predominan los ecosistemas del Zonobioma húmedo tropical del Catatumbo, y comprende las zonas de piedemonte de la cordillera oriental en Colombia. El presente estudio tuvo el objetivo GHLGHQWLĆFDUODFRPSRVLFLµQGHODDYLIDXQDHQXQJUDGLHQWH altitudinal desde los 80m hasta 1925m. Para esto se realizaron !+'£ S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents recorridos de observación de aves durante 16 días y se GHWHUPLQµODFRPSRVLFLµQćRU¯VWLFDGHO£UHD6HGHVDUUROOµ XQDQ£OLVLVGHFODVLĆFDFLµQHQWUHODVFREHUWXUDVYHJHWDOHV LGHQWLĆFDGDVXWLOL]DQGRHO¯QGLFHGH%UD\&XUWLVFRQHOĆQ GHLGHQWLĆFDUVL«VWDVVHDJUXSDEDQHQODVGLIHUHQWHVDOWXUDV estudiadas. Se registró un total de 3611 individuos de 184 especies en 15 coberturas vegetales a lo largo del gradiente DOWLWXGLQDO/DFRPSRVLFLµQćRU¯VWLFDGRPLQµFRQODVHVSHFLHV Myrsine guianensis y Vismia baccifera para el gradiente de 900 m a 1925 m; y con las especies Cupania americana, ;\ORSLDDURPDWLFD\3URVRSLVMXOLćRUDSDUDHOJUDGLHQWH inferior. La similitud más representativa (cercana al 50%) estuvo entre las coberturas de Bosque de galería y Mosaico de cultivos, pastos y espacios naturales, y entre Vegetación secundaria alta y Bosque fragmentado con vegetación secundaria. A medida que el gradiente altitudinal cambia, la diversidad de aves y plantas es diferente, aumentando la riqueza de especies de gran interés para la región. 460 Distribuição histórica e declínio populacional da espécie Pyrrhura griseipectus Fabio Nunes1,2*, Ileyne Lopes1, Weber Silva1, Ciro Albano1, Alberto Campos1, jason Mobley1, Luiz Mestre2 ǢW7<!9-9TǣW r(!#-3|!7<!9-9W38+ ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION O periquito da cara suja é considerado criticamente ameaçado GHH[WLQ©¥RFRP£UHDGHYLGDUHVWULWD¢VćRUHVWDV¼PLGDV de serras do Nordeste brasileiro. Neste estudo avaliamos {փdփTT ID t ABSTRACT t ID t a tendência populacional da espécie comparando dados pretéritos e atuais de ocorrência. Os dados foram obtidos em 25 expedições, combinando consulta a 10 museus, busca ativa em campo e 268 entrevistas com moradores, conduzidas entre 2008 a 2014. Dos 50 exemplares analisados em museus, 29 possuíam procedência detalhada. Já os levantamentos etnobiológicos apontaram a ocorrência pretérita da espécie em ao menos 15 localidades desde a década de 1950. Os levantamentos de campo apontaram a presença atual da espécie apenas no Ceará, na Serra de Baturité, em Quixadá; e uma nova localidade, em Ibaretama (CE). Apesar da descoberta destas novas localidades, nossos resultados apontam uma cronologia indubitável de decréscimo da espécie em menos de 50 anos. Na década de 50 registramos 15 pontos de ocorrência em quatro estados brasileiros (CE, RN, PB, PE), na década de 1970 registramos 11 pontos (CE e PE), na década de 1990 oito pontos, e 2014 apenas três localidades (descritas acima). Deste modo, mostramos um declínio histórico alarmante da área de ocorrência e consequentemente número de indivíduos, provocadas principalmente pela SHUGDGHKDELWDWHRWU£ĆFRLOHJDOGHDQLPDLVVLOYHVWUHV 461 Beyond new species: deforestation in unexplored !+'£S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents areas in the Amazon basin may lead to an irreversible loss of ornithological knowledge Marco A. Rêgo1*, Glaucia Del-Rio1, Vitor Q. Piacentini2, Morton L. Isler3, Gustavo A. Bravo4 ǢW<9'<13(!;<8!£$-'2$'3<-9-!2!;!;'2-='89-;@TǣW$!&'[email protected] 3(!;<8!£$-'2$'93(8'?'£2-='89-;@TǤW'6!8;1'2;3('8;'#8!;' 33£[email protected]&9T!ধ32!£<9'<13(!;<8!£-9;[email protected];,932-!2 29ধ;<ধ32TǥW<9'<&' 33£3+-!&!2-='89-&!&'&'È3!<£3 [email protected]&'8<9|+1!-£W$31 ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III Fields such as avian taxonomy, systematics and evolution are KLJKO\GHSHQGHQWRQVFLHQWLĆFVSHFLPHQVDQGWKHLQIRUPDWLRQ associated with them. Furthermore, the geographic provenance RIVSHFLPHQVLVDOVRXVHIXOIRUGHĆQLQJSURWHFWHGDUHDV Because deforestation in Amazonia has increased exponentially during the last 40 years and forecasts are highly pessimist, informed conservation actions are crucial. Using Ornithological Gazetteers and point locality data from nearly 30,000 museum specimens of the widely distributed genera Phaethornis, Hypocnemis, Myrmotherula, Epinecrophylla, and Willisornis, we assembled a database representing Amazonian collecting sites during the last 200 years. Mapping and combining these data with deforestation predictions, we identify current and potential gaps in ornithological knowledge in Amazonia. Our results show that ca. 64% of the Amazon basin has never been surveyed, and within the next 35 years more than 48% of this unsampled area is expected to be lost due to deforestation. Amazonia is a natural laboratory for biogeographical studies that provides important insights on ecological and evolutionary {փdփTT ID t ABSTRACT t processes. Thus, beyond new species, unique habitats, and genetic diversity, current deforestation trends could lead to a striking loss of knowledge on biogeographic patterns, contact zones and ecological interactions. The creation of protected areas and implementation of strict deforestation regulations might represent a useful tool to mitigate diversity ORVVLQ$PD]RQLD8OWLPDWHO\ZHVXSSRUWFRQWLQXRXVVFLHQWLĆF collection of bird specimens to subsidize conservation and explore a fundamental part of Neotropical diversity. 462 Geographic variation of Henicorhina leucophryspopulations in Venezuela Fernando Machado-Stredel1*, Jhonathan Miranda1, John Klicka2, Jorge L. Pérez-Emán1 ǢW29ধ;<;3&' 33£3+Ð[email protected]$3£3+Ð!836-$!£T2-='89-&!&'2;8!£ &''2'A<'£!TǣW'6!8;1'2;3(-3£[email protected]{<80'<9'<13( !;<8!£-9;[email protected]!2&<£;<8'T2-='89-;@3(!9,-2+;32 r(W1!$,!&3W9;8'&'£|+1!-£W$31 ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS H. leucophrys (Troglodytidae) has eighteen subspecies distributed from Mexico to Bolivia, being one of the most diverse group in the wren family. Five of these taxa can be found in northern Venezuela and have been described on the basis of subtle plumage differences but individual variation has not been thoroughly evaluated. Previous studies of pairs of subspecies in altitudinal gradients in Ecuador and Colombia have shown considerable genetic divergence. In this study we aimed to characterize the geographic variation RIWKHĆYHVXEVSHFLHVGLVWULEXWHGLQ9HQH]XHODXVLQJWZR mitochondrial genes (ATPase6-8) and classical morphological !+'£S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents characters. Our phylogeographic analysis showed seven lineages with considerable amount of genetic differentiation between them (6-8%), suggesting that at least the subespecies tamae, meridana and venezuelensis were paraphyletic. We DOVRIRXQGSUHYLRXVO\XQNQRZQVLJQLĆFDQWGLIIHUHQFHVLQ tail, tarsus and bill lengths and, using colorimetric analysis with digital photography, we found concordant patterns of differentiation on the color of ventral plumage patches and on the pattern of streaks on the throat. We discuss WKHFRQVHTXHQFHVRIWKHVHĆQGLQJVIRUWKHFXUUHQWVSHFLHV taxonomy and highlight the importance of using multiple characters when describing the geographic variation of species. 465 Aphrastura spinicaudachange their reproductive strategy with altitude in the Andean temperate forest of South America Tomás A. Altamirano1*, J. Tomás Ibarra2, Mariano De la Maza3, Sergio A. Navarrete4, Cristián Bonacic1 ǢW !<2!<9;8!£-9-£&£-('!#38!;[email protected]ধ)$-!2-='89-&!& !;Õ£-$!&',-£'TǣW'2;8'(3866£-'&329'8=!ধ32'9'!8$,T 2-='89-;@3(8-ধ9,3£<1#-!T!2!&!TǤW!ধ32!£ 38'9;[email protected]'8=-$'T ǥW9;!$-Õ239;'8!&'2='9ধ+!$-32'9!8-2!9!2&'2;'8(38 !8-2'329'8=!ধ32T32ধ)$-!2-='89-&!&!;Õ£-$!&',-£' r;!!£;!1-|<$W$£ ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I Elevational gradients have been proposed as a driver of change in avian reproductive life history strategies. The eventual shorter breeding season and higher predation risk at high altitudes can produce a decline in fecundity, a reduction of clutch sizes, and an increase in parental care and survival. {փdփTT ID t ABSTRACT t ID t We studied whether the breeding strategy of Aphrastura spinicauda varies along an elevation gradient in the Andean temperate forests of Chile. We installed 240 nest-boxes between 260 and 1,115 m a.s.l., and monitored the breeding activity of 162 nests over two seasons (2010-2011, 2011-2012). As predicted, the breeding season was 28% and 55% shorter in highland forests during the two seasons. Timing of egg laying (1 egg every second day) and incubation period (average 15 days) did not vary with altitude. We found smaller clutch sizes (average 4.1 vs. 4.5), a fewer number of nestlings per clutch (average 3.5 vs. 4.2), and longer nestling period (22.2 vs. 21.6 days) in highland than lowland forests. The breeding success declined with altitude, mainly due to predation by Dromiciops gliroides which was 83% in highland and 35% in lowland IRUHVWV2XUĆQGLQJVVXJJHVWWKDW$SKUDVWXUDVSLQLFDXGD change its reproductive strategy along altitudinal gradients to a slower one, likely as an adaptation to shorter breeding seasons. Yet, these changes do not appear to compensate for the increased predation rates at higher elevations, questioning WKHSRWHQWLDODGDSWLYHVLJQLĆFDQFHRIWKLVVWUDWHJ\ 466 Conectividad de humedales altoandinos y diversidad de los !+'£S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents ensambles de aves en la región de Tarapacá, Norte de Chile Paola Araneda1*, Walter Sielfeld1, Vinko Malinarich2, Venecia Herrera1, Cristian Carrasco1 ǢW'2;83&'2='9ধ+!$-Õ2'2'&-31#-'2;'T2-='89-&!& 8;<838!;TǣW'8=-$-3+8Ð$3£!!2&'83 r!8!2'&!W6!3£!|+1!-£W$31 ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION Las aproximaciones tradicionales a la conservación de humedales, centradas en la protección de sitios aislados, pueden ser estrategias poco exitosas a largo plazo. La ecorregión altoandina posee el mayor porcentaje de especies exclusivas de Chile, debido a que corresponden a especies de distribución local o cuyo límite distribucional sur es el altiplano chileno. El objetivo de este trabajo es caracterizar los ensambles GHDYHVHQKXPHGDOHVDOWRDQGLQRV3DUDHVWRVHFODVLĆFDURQ 6 humedales y se realizaron conteos estacionales. Utilizando diversidad alfa, beta temporal, beta espacial y gamma se evaluaron las conexiones bióticas de los humedales. Se registró un total de 66 especies distribuidas en 24 familias. Las más representativas fueron Furnariidae, Tyrannidae, Thraupidae, Anatidae, Phoenicopteridae, Charadriidae y Scolopacidae. Las especies migratorias corresponden a Pluvialis dominica, Calidris bairdii, C. melanotos, C. pusilla, 7ULQJDćDYLSHV y Phalaropus tricolor. Los humedales con mayor diversidad alfa corresponden DVLWLRVFRQDOWDKHWHURJHQHLGDGHVSDFLDOORVFXDOHVGLĆHUHQ VLJQLĆFDWLYDPHQWHGHORVVLWLRVP£VKRPRJ«QHRVS La variabilidad climática de la zona genera altos valores de diversidad beta temporal. La diversidad beta espacial no PRVWUµGLIHUHQFLDVVLJQLĆFDWLYDVHQWUHORVHQVDPEOHVS! {փdփTT ID t ABSTRACT t sin embargo, se observa una tendencia al agrupamiento entre humedales de las mismas características. La diversidad registrada en los humedales representa >50% de la diversidad gamma para la ecorregión. Se concluye que humedales de la zona presentan conexiones bióticas, interactuando unos con otros, aunque estos presenten características distintas. 468 Diseño y establecimiento de una biblioteca bioacústica de referencia de las aves del Suroccidente Colombiano Carlos M Trujillo-Torres1*, Ronald A. FernándezGómez2, Jhon Jairo Calderón-Leyton1 ǢW8<63&'2='9ধ+!$-Õ2'2$3£3+Ð!=3£<ধ=!T2-='89-&!& &'!8-Ó3TǣW!#38!;38-3-3£3+Ð!&'£31638;!1-'2;3T 29ধ;<;3&''<83';3£3+Ð!T2-='89-&!&'8!$8<A!2! r$1;8</-££3ӑӐ|+1!-£W$31 ORAL PRESENTATION SESSION 8: BIOACOUSTICS I Mantener una adecuada, buena y exacta documentación de las grabaciones acusticas, así como de la información biológica y metadatos asociados a cada registro es fundamental SDUDHOWUDEDMRFLHQW¯ĆFRFRQORVVRQLGRV(VWHREMHWLYRVH logra Diseñando y estableciendo una Biblioteca de sonidos ambientales que tenga un sistema funcional que regule todo el proceso de obtención, almacenamiento, administración y XVRĆQDOGHFDGDUHFXUVRVRQRUR'DGDODSRVLFLµQJHRJU£ĆFD estratégica de Nariño, en medio de los Andes del norte y del Sur, la implementación y articulación de la biblioteca acústica en la Universidad de Nariño en conjunto con otras entidades gubernamentales y no gubernamentales, permitirá estructurar y consolidar las bases para el desarrollo de las investigaciones en bioacústica en el suroccidente de Colombia y !+'£S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents en el Ecuador. Para la implementación de la Fonoteca SONARse siguen procesos de almacenamiento y gestión de archivos sonoros, diseño de manuales, formatos de datos y metadatos, protocolos de obtención, almacenamiento y manejo, diseño de manuales para el acceso y uso de los archivos sonoros y sus datos asociados. Adicionalmente se realizan procesos de compilación y recolección de información acústica, de LGHQWLĆFDFLµQ\FRPSOHPHQWRGHORVYDF¯RVGHLQIRUPDFLµQ acústica para las aves de la región. Esto ha permitido integrar diversas áreas del conocimiento en el estudio biológico, comportamental, evolutivo y de la conservación de las especies, las temáticas ambientales, las propiedades físicas de los sonidos naturales y el trabajo con sonido. 470 The Critically Endangered Hooded Seedeater (Sporophila melanops) is a capuchino with a melanistic cap and complicates the taxonomy of the group Juan I. Areta1*, Vitor de Q. Piacentini2, Elisabeth Haring3, Anita Gamauf3, Luis F. Silveira2, Erika Machado2, Guy M. Kirwan4 ǢWfTǣW<9'<&' 33£3+-!&!2-='89-&!&'&' È3!<£3l mTǤW<9'<13(!;<8!£-9;[email protected]'22!T'2;8!£ '9'!8$,!#38!;38-'9TǥW -'£&<9'<13(!;<8!£-9;[email protected] r'96383)£!|@!,33W$31W!8 ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS Known solely from a unique male collected in central Brazil in the 19th century, the Critically Endangered Hooded Seedeater Sporophila melanops has been one of the great enigmas of Neotropical ornithology. We reanalysed the morphology of the type specimen, as well as a female specimen postulated to represent the same taxon, and sequenced mitochondrial {փdփTT ID t ABSTRACT t ID t DNA (COI and Cyt-b) of both individuals. We visited the type locality and its environs on multiple occasions at different seasons, searching for birds with similar morphology to the type, without success. Available evidence demonstrates that the type of S. melanops is not closely related to Yellow-bellied Seedeater S. nigricollis, as has been frequently postulated, but is in fact a representative of the capuchinos clade. Our morphological analysis indicates that the most likely possibility is that the male specimen is a Dark-throated Seedeater 6UXĆFROOLV collected within its wintering range, acquiring breeding plumage and showing melanism on the cap feathers; alternatively, it may be a melanistic-capped individual of a local population of seedeaters known to breed in the Esteros del Iberá, Corrientes, Argentina, to which the name 6UXĆFROOLV might be applicable, whilst the name S. plumbeiceps might be available for what is currently known as6UXĆFROOLV. The purported female specimen pertains either to S. nigricollis or to Double-collared Seedeater S. caerulescens. Morphological conclusions agree with our molecular results. A hybrid origin of S. melanops cannot be ruled out from the available data, but seems unlikely. We conclude that Sporophila melanops is not typical of any natural population of seedeaters. 471 Fragmentación de hábitat deSpizella worthenien !+'£S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents la Meseta Central del Altiplano Mexicano Mirna Almejo-Ramos1*, Laura Scott-Morales2, Patricia 9HOD&RLIĆHU3, Carlos Palomera-García1 ǢW'2;832-='89-;!8-3&'£!39;!<8T2-='89-&!&&'<!&!£!/!8!T ǣW !$<£;!&&'-'2$!9 38'9;!£'9T2-='89-&!&<;Õ231!&'<'=3 'Õ2TǤW29ধ;<;3'$23£Õ+-$3&'32;'88'@T!16<932;'88'@ r8!139W1-82!!|+1!-£W$31 ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION El gorrión de Worthen (Spizella wortheni) es una especie de la familia Emberizidae, endémica del Altiplano Mexicano que actualmente se considera en peligro de extinción. La escasa información existente sobre la especie, resulta en un vacío sobre su verdadero estado poblacional y distribución. El objetivo principal de este trabajo es analizar la fragmentación del hábitat natural de la especie y su distribución a partir de registros de anidación en la Meseta Central del Altiplano Mexicano dentro de los estados de Coahuila, Nuevo León y 6DQ/XLV3RWRV¯6HUHDOL]µXQDFODVLĆFDFLµQVXSHUYLVDGDGH la imagen satelital Landsat 8, 2014 en la cual se ubicaron 14 clases de vegetación; el análisis de fragmentación se llevó a cabo mediante Fragstats ver 4.2. Durante la temporada de reproducción mayo-julio 2012 a 2014 se encontraron QLGRVHQ0DWRUUDO'HV«UWLFR0LFUµĆOR/RVSDUFKHV habitados por la especie tienen un promedio de 11,943 ha (± 4491.8) con un máximo de 20621 ha, y un mínimo de 0.59 ha. La distribución de los nidos en cada estado fue de 27 en Nuevo León, 25 en Coahuila y 39 en San Luis Potosí. El grado de fragmentación es de 0.5898 y los parches habitados presentan un promedio de 12.76 km al parche {փdփTT ID t ABSTRACT t mas cercano. Se determinó que existe una correlación SRVLWLYDHQWUHHOQ¼PHURGHQLGRVSRUSDUFKH\ODVXSHUĆFLH GHOSDUFKHS /RVUHVXOWDGRVFRQĆUPDQ una distribución fragmentada de la especie con pequeñas poblaciones distribuidas en toda la Meseta Central del Altiplano 0H[LFDQRGRQGHODSHUPDQHQFLDGHVXSHUĆFLHVDPSOLDVGH 0DWRUUDO'HV«UWLFR0LFUµĆORHVUHOHYDQWHSDUDODQLGDFLµQ 475 3DWURQHVELRJHRJU£ĆFRVGHODDYLIDXQDGHDOWD montaña en el Departamento de Nariño Edna Calpa1*, Elkin Noguera-Urbano2, Jhon Jairo Calderón-Leytón1 ǢW8<63&'2='9ধ+!$-Õ2'2$3£3+Ð!=3£<ধ=!T2-='89-&!& &'!8-Ó3TǣW'6!8;!1'2;3&'-3£3+Ð!=3£<ধ=!T !$<£;!&&' -'2$-!9W2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3 r#-3'&2!,|+1!-£W$31 ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY & PHYLOGEOGRAPHY En este estudio se analizaron los patrones de riqueza y las áreas de endemismo de la avifauna de alta montaña del departamento de Nariño. Para ello se revisaron registros de distribución de las aves en catorce complejos paramunos de Nariño, se FXDQWLĆFDURQORVQ¼PHURVGHUHJLVWURV\ULTXH]DGHDYHVSRU complejo paramuno para determinar vacíos de información, se aplicó una prueba de correlación no paramétrica de Spearman entre la riqueza de cada complejo paramuno y su área para evaluar la tendencia de la relación riqueza-área considerando que en las islas existe una relación directa entre las dos YDULDEOHVĆQDOPHQWHVHDSOLFµXQ$Q£OLVLVGH3DUVLPRQLDGH (QGHPLVPRVSDUDLGHQWLĆFDUODV£UHDVGHHQGHPLVPR6H obtuvieron 1.231 registros de aves para ocho páramos en 31 !+'£¢S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents localidades; seis páramos no presentan información sobre aves. Los registros representaron a 178 especies, incluidas las especies migratorias. El análisis de correlación entre el número de especies y el área indicó una relación positiva SHURQRVLJQLĆFDWLYDORFXDOLQGLFDTXHKD\XQDOHYHWHQGHQFLD VHPHMDQWHDODVLVODV)LQDOPHQWHVHLGHQWLĆFDURQFLQFR£UHDVGH endemismo con un anidamiento progresivo desde los páramos del occidente de Nariño hasta incluir en una gran área todos los páramos, la conformación de las áreas de endemismo indica que ocurrieron diferentes procesos de expansión y contracción durante los ciclos glaciares e interglaciares del Pleistoceno y el Holoceno, los cuales han aislado progresivamente la biota, pero en este caso desde el occidente. 481 Aproximación a la vulnerabilidad de la avifauna al cambio climático en un paisaje del departamento de Cundinamarca, Colombia Juan Miguel Ruiz Ovalle <2&!$-Ö2$3;8Ö6-$3f3£31#-! /183$!2&'-|@!,33W$31 ORAL PRESENTATION SESSION 23: AVIAN DISTRIBUTIONS AND GLOBAL CHANGE En el trópico las aves de zonas altas, en especial las endémicas, son muy afectadas por el cambio climático. Buscamos evaluar su vulnerabilidad al cambio climático en una región de los andes GH&RORPELD\VH³DODUDTXHOODVP£VYXOQHUDEOHV6HGHĆQLHURQ seis paisajes, caracterizando el uso, la cobertura de vegetación y el grado de fragmentación del territorio. Se determinó la composición de la avifauna para corroborar la ocurrencia de especies en el territorio y complementar su información. {փdփTT ID t ABSTRACT t Para la evaluación de la vulnerabilidad al cambio climático, VHLGHQWLĆFDURQGHWHUPLQDQWHVELROµJLFRVDIHFWDGRVSRUHO cambio climáico usando la información de campo, el criterio de experto y la información secundaria. Cada especie fue FDOLĆFDGDHQWUH\GHSHQGLHQGRGHOQ¼PHURHLPSRUWDQFLDGH los determinantes afectados. El 14% tuvo vulnerabilidad baja, el 15% vulnerabilidad media y el 4% vulnerabilidad alta. De las especies más vulnerables sobresalen las encontradas a más GHPGHDOWLWXG\RVRQH[FOXVLYDVGHOERVTXHQDWXUDO 482 Revisiting ecogeographic hypotheses behind latitudinal morphological variation: climatic correlates of body size in Torrent Ducks Natalia Gutierrez-Pinto1*, Elkin A. Tenorio2 ǢW2-='89-;@3(-!1-TǣW29ধ;<;3<1#3£&; ID t ABSTRACT t Table of Contents 5. Precipitation seasonality; 6. Productivity) by evaluating the latitudinal morphological variation of Torrent ducks. Using body mass data together with climatic data along four rivers from Colombia, Peru and Argentina; we built generalized linear models for each hypothesis and compared them using the $NDLNH,QIRUPDWLRQ&ULWHULRQ$,&WRGHĆQHZKLFKYDULDEOHRU variable combination) better explain spatial variation in Torrent GXFNPRUSKRORJ\$OWKRXJKDOOPRGHOVVLJQLĆFDQWO\H[SODLQHG some level of morphological variation, temperature seasonality was the variable that better explained changes in body size; FRQWUDU\WR%HUJPDQQèVUXOHSUHGLFWLRQVZHGLGQRWĆQGPHDQ temperature as the most important predictor of body size variation. The mechanism relating seasonality and Torrent duck morphology implies that larger organisms cope better with sudden environmental changes typical of greater latitudes? and have better survival chances during resource shortage periods. r2+<ধ|#-3W1-!1-W'&< ORAL PRESENTATION SESSION 24: ECOMORPHOLOGY II Latitudinal patterns of body size variation have been widely studied in varied organisms. The observed increase in body size towards higher latitudes in many endotherms has been explained as a method to enhance body heat conservation in cold habitats, which is known as the Bergmann’s rule. Still, many environmental conditions other than temperature also vary with latitude (i.e. precipitation, seasonality, and productivity) and may also induce morphological changes coherent with the observed pattern. We tested six hypotheses using different climatic variables as predictors of body size variation (1. Mean temperature; 2. Mean precipitation; 3. Mean temperature and precipitation; 4. Temperature seasonality; !+'£S8!¡8'9'2;!ࣅ329 491 Isolation of microsatellite markers in two sympatric tinamou species, the Ornate Tinamou (Nothoprocta ornata) and Darwin’s Nothura (Nothura darwinii) Lina Maria Giraldo Deck1*, Alvaro Garitano-Zavala2, Jan Christian Habel1, Harald Meimberg3 ǢW'6!8;1'2;(Ü8¿03£3+-'<2&¿[email protected];'11!2!+'1'2;c'$,2-9$,'2-='89-;É; Ü2$,'2TǣW29ধ;<;3&'$3£3+Ð!c2-='89-&!&[email protected]&'!22&8Ì9TǤW29ধ;<; (Ü82;'+8!ধ='!;<89$,<;A(389$,<2+c2-='89-;É;(Ü83&'20<£;<8-'2 r£-2!W+-8!£&3|;<1W&' ORAL PRESENTATION SESSION 20: CONSERVATION GENETICS Knowledge about natural history in tinamous is still scarce and microsatellite markers are a helpful tool to elucidate genetic aspects of mating systems and population structures {փdփTT ID t ABSTRACT t in this familiy. In the present study 54 novel microsatellite loci were isolated in two sympatric tinamou species, 30 in the Ornate Tinamou (Nothoprocta ornata) and 24 in the Darwin’s Nothura (Nothura darwinii7KH\ZHUHWHVWHGIRUDPSOLĆFDWLRQ VXFFHVVJUDGHRISRO\PRUSKLVPDQGFURVVDPSOLĆFDWLRQ,Q the Ornate Tinamou 25 loci were polymorphic and in the Darwin’s Nothura 12, with moderate to high number of alleles per locus (2-13 alleles for the Ornate Tinamou and 2-14 alleles for the Darwin’s Nothura). The loci showed an expected heterozygosity (HE) ranging from 0.061-0.909 in the Ornate Tinamou and in the Darwin’s Nothura from 0.044-0.908. 7KHFURVVDPSOLĆFDWLRQZDVPRGHUDWHZKHUHRIWKHORFXV WD[RQFRPELQDWLRQVVXFFHVVIXOO\DPSOLĆHG7KHVH loci will be valuable tools for parentage tests and population analyses in the Ornate Tinamou and the Darwin’s Nothura. ID t ABSTRACT t Table of Contents of sedentary birds are also less pointed than those that are migratory, and their AR is 15% lower than in migratory species. My comparisons of the ecological and taxonomic variables that FRXOGLQćXHQFHWKH:/DQG$5RIVHGHQWDU\VSHFLHVVKRZHG effects of different magnitude. Elevation, vegetation type, sensitivity to habitat disturbance, and range size had no effect on either of the two metrics used. However, both foraging guild and taxonomic family showed strong effects that are highly VLJQLĆFDQW7KHWZRGLIIHUHQWPHWULFVRIZLQJVKDSHXVHGLQWKLV investigation support the predictions of Seebohm’s Rules that the wings of sedentary birds are more rounded and carry more weight than any other bird with published data. The higher WL and lower AR of sedentary species found in my study suggests that these birds are less constrained by long-distance movements than their migratory counterparts and that they can pay the cost of an increased wing-loading and aspect ratio. 497 The wings of neotropical birds are more rounded and carry more weight: a test of Seebohm’s rules Ernesto Ruelas Inzunza 2-='89-&!&'8!$8<A!2! 8<'£!9W<=|+1!-£W$31 ORAL PRESENTATION SESSION 24: ECOMORPHOLOGY II 7KHZLQJVRIELUGVDQGRWKHUć\LQJDQLPDOVDUHVKDSHGE\ FKDUDFWHULVWLFVRIWKHLUćLJKW+HUH,WHVWWKHSUHGLFWLRQV of Seebohm’s Rules using bird data from 71 species (347 individuals) of birds from different habitat types and elevations in Costa Rica. I calculated the wing-loading (WL) and aspect ratio (AR) of these species obtained the same metrics for 10 long-distance migrants. The mean WL of Neotropical birds is 20.73 N m-2, 23% larger than that of migratory birds. The wings !+'££S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 502 Ecological and socio-economic factors affecting extinction risk in parrots George Olah1*, Stuart H.M. Butchart2, Andy Symes2, IIiana Medina Guzmán3, Ross Cunningham1, Donald J. Brightsmith4, Robert G. Heinsohn1 ǢW '22'8$,33£3(2=-8321'2;!2&3$-';@T,'<9;8!£-!2 !ধ32!£2-='89-;@TǣW-8&-('2;'82!ধ32!£TǤW'6!8;1'2;3( $3£[email protected]=3£<ধ32!2&'2'ধ$9T'9'!8$,$,33£3(-3£[email protected],' <9;8!£-!2!ধ32!£2-='89-;@TǥW$,<#3;?3ধ$-8&'!£;,'2;'8T '6!8;1'2;3(';'[email protected]!;,3#-3£[email protected]'?!9{2-='89-;@ r+'38+'W3£!,|!2<W'&<W!< ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR Psittaciformes (parrots) face many threats in the wild and, as a group, are considered amongst the most endangered ELUGV+HUHZHFRQĆUPWKDWSDUURWVKDYHDORZHU5HG/LVW Index of species survival than comparable bird species groups ZDWHUELUGVUDSWRUVSLJHRQVJDPHELUGVDQGbVHDELUGV2XU comparative analyses investigating the factors associated ZLWKKLJKH[WLQFWLRQULVNLQSDUURWVFRQĆUPHGHVWDEOLVKHG WUHQGVIRXQGLQRWKHUWD[DDQGbDOVRSURYLGHQHZLQVLJKWV2XU PRGHOVLQFOXGHGLQWULQVLFELRORJLFDOOLIHKLVWRU\DQGbHFRORJLFDO DWWULEXWHVDVZHOODVH[WHUQDODQWKURSRJHQLFWKUHDWVDQGbVRFLR economic variables of the countries where the parrots occur, while controlling for phylogenetic dependence among species. We found that the likelihood of threatened status in extant parrot species relates to historical distribution size, forest GHSHQGHQF\ERG\VL]HJHQHUDWLRQWLPHDQGbSURSRUWLRQRI human population living in urban areas in their home range. The degree of threat (IUCN Red List category) was further shown to be dependent on the GDP per capita of the countries !+'£S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents RIRFFXUUHQFHVLQJOHFRXQWU\HQGHPLVPDQGbZKHWKHUWKH VSHFLHVDUHXVHGDVSHWV:HDOVRLGHQWLĆHGVHYHUDOLPSRUWDQW threats closely associated with urbanization that are raising the extinction risk of parrots. We highlight countries where conservation needs to be prioritized. Our results are important for understanding the factors associated with endangerment DQGbH[WLQFWLRQLQWKLVKLJKO\WKUHDWHQHGWD[RQRPLFJURXS 505 Chiroxiphia lanceolata y el Bosque Seco Tropical del Valle Alto del Magdalena-Colombia Katherine Certuche-Cubillos1*, Mario J Gômez-Martínez1, Raul Sedano2, Raul Sedano2, Julian LLano Mejia1 ǢW2-='89-&!&&'£3£-1!TǣW2-='89-&!&&'£!££' r0!;$'8;<$,'|+1!-£W$31 ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I El saltarín cola de lanza (Chiroxiphia lanceolata), es un piprido IUXJ¯YRURSHTXH³RFRQPDUFDGRGLPRUĆVPRVH[XDOTXHVH distribuye desde el sur de Centroamérica (Sureste de Costa Rica) hasta el Norte de Suramérica (extendiéndose hasta noreste de Venezuela). En Colombia en la cuenca del río 0DJGDOHQD]RQDGHYLGDGH%RVTXH6HFRWURSLFDObVHGLVWLQJXHQ dos poblaciones, una al sur distribuida en el Valle Alto del Magdalena y otra al norte en la Región Caribe. Estudiamos una población de C. lanceolata en Venadillo, Tolima, Alto Valle del Magdalena, Colombia. Describimos aspectos de historia natural del saltarín a partir de observaciones y 164 capturas entre los años 2012-2014. La consulta de especímenes de museo permitió establecer que esta población del sur se caracteriza por tener un menor tamaño en atributos como la cuerda alar y {փdփTT ID t ABSTRACT t longitud total comparado con la población del norte. Anillamos el 74% de los individuos capturados y recapturamos 15 individuos. C. lanceolata es una especie frugívora y abundante en esta localidad, que dispersa las semillas de al menos 11 especies vegetales, incluyendo las del árbol endémico Trichilia oligofoliolata. A partir del registro de parche de incubación encontramos un pico reproductivo entre febrero y mayo; el seguimiento del estado del plumaje nos indicó una época de PXGDHQPD\R\MXQLR(OK£ELWDWTXHSUHĆHUHHVWHSLSULGRHQ la localidad corresponde a bosques primarios y secundarios con sotobosques densos diversos en arbustos y lianas. 507 Distribuição e conservação do Barranqueiro-do- Nordeste (Automolus lammi): uma espécie ameaçada do Centro de Endemismo Pernambuco Yuri Mendes1*, Flávia Pinto2, Luciano Naka1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3TǣW ID t ABSTRACT t Table of Contents governo brasileiro e “vulneravel” pela IUCN. O objetivo deste trabalho foi i) estimar a extensão de ocorrência (EO), ii) a área de ocupação (AO), e iii) avaliar o status de conservação de A. lammi, utilizando MNE e estimativas populacionais em campo. Para modelar a distribuição de A. lammi usamos o Programa MaxEnt e incluímos todas as 17 localidades de ocorrência conhecidas para esta espécie. Baseados em dados climáticos, calculamos a EO de A. lammi HPNPt PHQRUGRTXHRVRVNPtHVWLPDGRVQDELEOLRJUDĆD Utilizando camadas do uso do solo no Programa ARCGis, UHWLUDPRVDV£UHDVLQDGHTXDGDVVHPYHJHWD©¥RćRUHVWDO GD(2HFDOFXODPRVXPD$2SRWHQFLDOGHNPt%XVFDV DWLYDVHPFDPSRFRQĆUPDUDPDSUHVHQ©DGH$ODPPLHP fragmentos relativamente grandes (>100 ha), mas continuamos realizando esforços em campo para estimar as densidades populacionais, validar os modelos, e determinar o tamanho mínimo de fragmento onde esta espécie ainda sobrevive. [email protected]<8-8!-!|@!,33W$31W#8 ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION As modelagens de nicho ecológico (MNE) tem um papel importante para descrever a extensão de ocorrência potencial das espécies, auxiliando na avaliação do estado de conservação de espécies raras ou ameaçadas de extinção. Ao mesmo tempo, o uso de MNE podem ser úteis para orientar futuras buscas em campo de espécies pouco conhecidas ou com poucos pontos de ocorrência. Nós aplicamos técnicas de modelagem para estudar o status de conservação de Automolus lammi, espécie de ave restrita ao centro de endemismo Pernambuco na Floresta Atlântica do nordeste e atualmente considerada como “em perigo” pelo !+' S8!¡8'9'2;!ࣅ329 508 Ecología funcional de ensamblajes de aves a través de gradientes de cobertura vegetal en bosques secos interandinos de Colombia Néstor Espejo1*, Nathalie Morales1, Jorge Posada1 ǢW <2&!$-Õ2!;<8! [email protected]&-&&-|+1!-£W$31 ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY El Bosque Seco Tropical (Bs-T) es un ecosistema amenazado en Colombia, con distribución actual aproximada al 2% de su cobertura original. En el marco de un plan de rehabilitación de hábitat para la fauna, debido a la construcción y llenado de la {փdփTT ID t ABSTRACT t represa del Quimbo en el alto Magdalena (Huila, Colombia), se realizó un análisis de la ecología funcional de ensamblajes de aves asociados a un gradiente de coberturas vegetales (pastos limpios a relictos de Bs-T). Se evalúo la calidad de hábitat de cada una de las coberturas y se determinó grupos funcionales de aves con análisis de agrupamiento y distancias de Goward, usando diferentes rasgos funcionales (masa, dieta, sensibilidad ecológica, dispersión) recolectados con transectos y redes de niebla entre septiembre de 2014 y abril de 2015. Los grupos funcionales presentan diferencias VLJQLĆFDWLYDVHQODFRPSRVLFLµQ\SDWURQHVGHDEXQGDQFLDFRQ una menor redundancia funcional en los bosques y con mayor diversidad funcional en arbustales. Las tendencias observadas indican que la composición de grupos funcionales varía en el gradiente de coberturas y los variables que explican mejor sus abundancias estan relacionados con factores bióticos (biomasa de insectos y cobertura arbórea) en especial para insectívoros \IUXJ¯YRURV(VWDHYDOXDFLµQ\FXDQWLĆFDFLµQGHODGLYHUVLGDG funcional permitió realizar una aproximación a las causas y factores que mejor explican la presencia y abundancia de grupos funcionales en un gradiente de complejidad vegetal. 514 Bird songs in the shelf: temporal patterns of songs and vocal output are lost in sound archives Oscar Laverde1*, Paula Caycedo2, Paulo Pulgarin1, Carlos Daniel Cadena1 ID t ABSTRACT t Table of Contents in behavioral ecology. However, information on the vocal output is lacking for most species. In this study, we asked whether the number of recordings of avian vocalizations in three different sound archives and the times when such UHFRUGLQJVZHUHREWDLQHGUHćHFWHVWLPDWHVRIYRFDORXWSXWDQG temporal patterns of vocal activity obtained through systematic monitoring of wild bird populations in three tropical forest sites. %DVHGRQDVDPSOHRIPRQWDQHVSHFLHVZHIRXQGVLJQLĆFDQW relationships between the number of recordings of species detected through continuous monitoring over several months and the number of recordings archived in sound collections. In addition, daily activity patterns based on data collected through continuous monitoring over several days did not differ from those based on recordings archived in sound collections in 12 of 15 species of lowland birds. Annual patterns in vocal activity of two species estimated based on recordings in collections closely resembled previously published patterns. We conclude that recordings in sound collections contain valuable information about the vocal output and temporal patterns in vocal activity of birds. This opens the possibility of using sound collections to assess vocal output and to consider it as a variable of interest in studies on the ecology and evolution of birds and other animals that use acoustic signals for communication. We make UHFRPPHQGDWLRQVIRUĆHOGZRUNHUVFRQWULEXWLQJWRVRXQG archives to maximize the potential usefulness of their material. ǢW2-='89-&!&&'£392&'9TǣW29ধ;<;3£'?!2&'8=32<1#3£&; r3,!8!$3|+1!-£W$31 ORAL PRESENTATION SESSION 12: BIOACOUSTICS II Understanding the frequency with which birds sing (vocal output) is critical to address a variety of research questions !+'S8!¡8'9'2;!ࣅ329 {փdփTT ID t ABSTRACT t 532 Capacidade de dispersão das aves de ambientes ribeirinhos no baixo Rio Branco, Roraima Bruna Costa1*, Gisiane Lima1, Daniele Mariz1, Heverly Menezes1, Yuri Raia1, Santiago Claramunt2, Luciano Naka1 ID t ABSTRACT t Table of Contents resposta das aves ao experimento propôs que a capacidade de dispersão não é homogênea, apresentando diferenças no alcance do vôo, acreditando que o padrão de suas asas seja um dos fatores para essa variação na dispersão. ǢW2-='89-&!&' '&'8!£&''82!1#<$3TǣW1'8-$!2<9'<13(!;<8!£-9;[email protected] r#8<2!1-8'£@Ǣӑ|+1!-£W$31 ORAL PRESENTATION SESSION 6: ECOMORPHOLOGY I As aves são consideradas boas dispersoras, mas existe variação na capacidade de voar. Esta variação pode estar relacionada como o formato das asas, mas existem poucos estudos que relacionem o vôo e a morfologia alar. Este estudo avaliou a capacidade de dispersão das aves em habitats ribeirinhos da Amazônia, testando se variáveis morfométricas explicam o sucesso ou fracasso das aves em atravessar um corpo dágua. Para realizar os experimentos, capturamos aves e estas foram transportadas a 100, 200, e 300 m da margem, onde eram soltas para que retornassem a margem. Realizamos 495 experimentos em 86 espécies diferentes, de 21 famílias. Para correlacionar o resultado dos experimentos com variáveis morfométricas, mediu-se as aves, em campo e espécimes taxidermizados. Estas medidas foram aplicadas em três equações (Índice de Kipp, Razão do Aspecto, Capacidade de Transporte). Cerca de 67% das aves obtiveram sucesso em atravessar a distância testada (36 spp. tiveram 100 % de sucesso), e 15 spp. (6%) não atravessaram. Duas famílias (Troglodytidae e Thamnophilidae) tiveram sucesso em menos de 50 % dos experimentos, sugerindo uma baixa capacidade de dispersão. O índice de Kipp foi o melhor preditor de resposta aos experimentos, sugerindo que ele seja importante para prever a capacidade de dispersão. A !+'S8!¡8'9'2;!ࣅ329 542 6 SHFLHVVSHFLĆFGLIIHUHQFHVLQUHODWLYHH\HVL]H are related to patterns of edge avoidance in an Amazonian rainforest bird community Diego Gil1*, Cristina Martínez Ortega1, Eduardo S.A. Santos2 ǢWTǣW2-='89-&!&'&'!3!<£3 r&-'+3W+-£|$9-$W'9 ORAL PRESENTATION SESSION 6: ECOMORPHOLOGY I Eye size shows a large degree of variation among species, even after correcting for body size. In birds, relatively larger eyes have been linked to predation risk, capture of mobile prey, and nocturnal habits. Relatively larger eyes enhance visual acuity and also allow birds to forage and communicate in lowlight situations. Complex habitats such as tropical rain forests provide a mosaic of diverse lighting conditions, including differences among forest strata and at different distances from the forest edge. We examined in an Amazonian forest ELUGFRPPXQLW\ZKHWKHUPLFURKDELWDWRFFXSDQF\GHĆQHGE\ edge avoidance and forest stratum) was a predictor of relative eye size. We found that relative eye size increased with edge avoidance, but did not differ according to forest stratum. Nevertheless, the relationship between edge avoidance and UHODWLYHH\HVL]HVKRZHGDQRQVLJQLĆFDQWSRVLWLYHWUHQGIRU species that inhabit lower forest strata. Our analysis shows that birds that avoid forest edges have larger eyes than those living in lighter parts. We expect that this adaptation may {փdփTT ID t ABSTRACT t allow birds to increase their active daily period in dim areas of the forest. The pattern that we found raises the question of what factors may limit the evolution of large eyes. 551 Ectoparasites increase bacterial load on avian eggshells Gustavo Tomás1*, David Martín-Gálvez2, Magdalena Ruiz-Rodríguez3, Juan M. Peralta-Sánchez4, Manuel Martín-Vivaldi4, Juan J. Soler3 ǢW2-='89-&!&Ì$2-$!!8ধ$<£!8&'3/!lmTǣW<836'!23£'$<£!8 -3£[email protected]!#38!;[email protected]<836'!2-3-2(381!ধ$929ধ;<;'TǤW9;!$-Õ2 ?6'8-1'2;!£&' 32!98-&!9l fmTǥW2-='89-&!&&'8!2!&! r+;31!9|''A!W$9-$W'9 ORAL PRESENTATION SESSION 18: AVIAN DISEASES While direct detrimental effects of parasites on hosts are relatively well documented, other more subtle but potentially important effects of parasitism are yet unexplored. Biological activity of ectoparasites, apart from skin injuries and blood feeding, often results in blood remains, or parasite faeces that accumulate and modify the host environment. In this way, ectoparasite activities and remains may increase nutrient availability that may favor colonization and growth of microorganisms including potential pathogens. Here, by WKHH[SHULPHQWDODGGLWLRQRIKHPDWRSKDJRXVćLHVCarnus hemapterus, a common ectoparasite of birds) to nests of spotless starlings Sturnus unicolor during incubation, we explore this posible side-effect of parasitism which has rarely, if ever, been investigated. Results show that faeces and blood UHPDLQVIURPSDUDVLWLFćLHVRQVSRWOHVVVWDUOLQJHJJVKHOOVDW the end of incubation were more abundant in experimental than in control nests. Moreover, eggshell bacterial loads of different groups of bacteria including potential pathogens !+'S8!¡8'9'2;!ࣅ329 ID t ABSTRACT t Table of Contents were also higher in experimental nests. Finally, we also found evidence of a link between eggshell bacterial loads and increased embryo mortality, which suggests a bacterialmediated negative effect of ectoparasitism on host offspring. Trans-shell bacterial infection might be one of the main causes of embryo death and, consequently, this hitherto unnoticed effect of ectoparasitism may be widespread in nature and can profoundly affect our understanding of ecology and evolution of host-parasite interactions. 569 The usefulness of beta diversity of wild bird communities for conservation policies and sustainable urban planning in La Paz city Jackeline Campos Pastén1*, Álvaro Garitano-Zavala1 ǢW29ধ;<;3&'$3£3+Ð!f2-='89-&!&[email protected]&'!22&8Ì9 r/!$0'£-2'W$!16396|+1!-£W$31 ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II When the conservation of Protected Areas is planned, alpha diversity is used as the main biological indicator, while beta diversity is frequently ignored. In La Paz city (Bolivia) 27 periurban and urban areas were declared as protected, but most of them have no management plans or conservation actions and currently several are being lost because of urban growth. We calculated alpha and beta diversity of wild bird communities in 18 Municipal Protected Areas (MPAs), in order to compare with the diversity values of three types of urban environments: “hard urban” (HU), “functional green areas” (FA) and “wild fragments” (WF). Beta diversity for each MPA was the average of the distance values of all the combinations of point-count {փdփTT ID t ABSTRACT t pairs; as distance measure we used the quantitative Morisita index. The alpha diversity was measured with the total richness (S) and average exp-Shannon index (expH). Alpha diversity of each of the MPAs (range of S: 46 to 8; range of expH: 7.30 to 4.51) did not exceed the alpha diversity of FAs (S = 42; expH = 6.66) nor WFs (S = 45; expH d = 6.63), but the beta diversity RI03$VUDQJHWRZDVVLJQLĆFDQWO\KLJKHUWKDQWKH beta diversity values of FA and WF (0.39 and 0.53). Results show that the biological value of MPAs is underestimated when alpha diversity is used to describe bird communities. Consideration of beta diversity of bird communities would LPSURYHXUEDQGHYHORSPHQWSROLFLHV,QWKHVSHFLĆFFDVH of the La Paz city results suggest that the better way for biological conservation is to protect all the MPAs and their total area, in order to maintain their habitat heterogeneity. 576 Deslocamento altitudinal de aves na Serra do Mar do Estado de São Paulo, Sudeste do Brasil Fabio Schunck1*, Luis Fabio Silveira1 ID t ABSTRACT t Table of Contents de campo. Foram usadas 20 redes de neblina e as aves foram PDUFDGDVFRPDQLOKDVGR&(0$9(,&0%LR)RUDPDQLOKDGRV 2.684 indivíduos, pertencentes a 98 espécies. Foram feitas 555 recapturas (45 espécies), sendo que 40 indivíduos (14 espécies) foram recapturados em cotas altitudinais distintas das quais eles foram capturados e anilhados originalmente. A família mais representativa foi Dendrocolaptidae, com 4 espécies. Oito tipos de deslocamentos foram detectados, sendo 5 de 200 m e 3 de 400 m de altitude, além de alguns indivíduos que se deslocaram por mais de uma cota, como Rhopias gularis. Estes deslocamentos foram realizados em períodos distintos ao longo do estudo, sem um padrão temporal evidente, indicando a princípio uma aleatoriedade entre os mesmos, porém novas análises serão realizadas comparando estes dados com as informações obtidas de maneira simultânea através do método quantitativo de pontos de escuta. Mesmo não detectando padrões claros de migração altitudinal, estas informações sugerem que pelo menos outras 9 espécies ainda não citadas na literatura realizam algum tipo de deslocamento vertical na Serra do Mar. ǢW<9'<&' 33£3+-!&! r(!#-3i9$,<2$0|@!,33W$31W#8 ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR Os movimentos altitudinais de aves na Mata Atlântica e da Serra do Mar ainda são pouco conhecidos. Para compreender melhor este padrão, foram selecionados quatro pontos de estudo situados em um gradiente localizado entre 30 e 800 m de altitude a.n.m. no Núcleo Curucutu do P.E. da Serra do Mar, São Paulo, Brasil (23°59 ‘S, 46° 44’W). Entre maio de 2007 e junho de 2011, cada ponto foi amostrado por três dias consecutivos por estação do ano, totalizando 142 dias !+'S8!¡8'9'2;!ࣅ329 577 Habitat use and home ranges for focal avian species in a highly fragmented Andean landscape Carolina Montealegre-Talero1*, Luis Miguel Renjifo1 ǢW32ধ)$-!2-='89-&!&!='8-!2! r#-3$!83|+1!-£W$31 ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY /DQGVFDSHPRGLĆFDWLRQDQGIUDJPHQWDWLRQDUHZLGHVSUHDG processes across the world and, as a consequence, ecosystem connectivity is lost and local extinction of species occurs. This {փdփTT ID t ABSTRACT t ID t trend is particularly critical in the tropics, which harbor the vast majority of earth’s biological diversity. Restoration of corridors to enhance habitat connectivity has been proposed as a valuable tool for increasing diversity at regional scales. To evaluate the functionality of restored corridors, we studied six bird species in a gradient of response to habitat fragmentation. We placed radio-transmitters and followed overall 13 individuals (from the six species) and evaluated their home ranges and habitat use, using VHF radio telemetry, across a landscape composed by pastures for cattle, remnants of riparian forest, restored corridors, isolated trees, roads and country houses. We found that all species mostly used riparian forests and restored corridors over other type of habitat to move across the landscape, regardless their habitat association. None of the marked birds used isolated trees. Calculated home ranges varied from 0.57 to 14.04 ha. Some marked individuals were nesting and this might have affected WKHYDOXHRIKRPHUDQJHV7KLVLVWKHĆUVWVWXG\WRHYDOXDWH the importance of restored corridors for the movement and habitat use of bird populations in a highly fragmented but biodiverse location in the Central Colombian Andes. 578 Bioacoustics monitoring techniques to determine dpatial and !+'S8!¡8'9'2;!ࣅ329 ABSTRACT t Table of Contents temporal activity of forest birds on Socorro island, Mexico Eduardo Iñigo-Elias1*, David Coso Muriel2, Antonio Ortiz Alcaraz2, Alfonso Aguirre Muñoz2 ǢW382'££!#3(82-;,3£[email protected]ǣW8<63&'$3£[email protected]'8=!$-32&'9£!9 r''-ǣ|$382'££W'&< ORAL PRESENTATION SESSION 12: BIOACOUSTICS II )RUHVWELUGFRPPXQLWLHVLQWKH3DFLĆFLVODQGVRI0H[LFRDUH SRRUO\VWXGLHGDQGbIHZELRDFRXVWLFVGDWDKDVEHHQUHFRUGHG (e.g., calls, songs). Yet many avian taxa are threatened DQGbVRPHSHUKDSVDOUHDG\H[WLQFW:HWHVWZKHWKHUDFRXVWLF surveys are an effective tool for monitoring species in remote DQGbKDUGWRDFFHVVVLWHV+HUHZHSUHVHQWSUHOLPLQDU\UHVXOWV IURPERWKPDQQHGDFRXVWLFUHFRUGLQJVDQGbDXWRQRPRXV UHFRUGLQJVWRPRQLWRUODQGbELUGVSHFLHVRQIRXUKDELWDWRQ 6RFRUUR,VODQGbRIWKH5HYLOODJLJHGR$UFKLSHODJRRI0H[LFR:H compare call rates for eight target bird species at different WLPHRIWKHGD\DQGbREWDLQHGVSHFLHVSUHVHQFHGHWHFWLRQ index. Multiple acoustic recordings were obtained from eight WDUJHWODQGbVSHFLHVDQGbYRXFKHUHGDFRXVWLFVSHFLPHQVZHUH VHFXUHIURP0DUFKDQGbDQDO\]HG,QDGGLWLRQ four automatic recording units Song Meter SM2+ Recorder ZHUHGHSOR\HGRQHSHUHDFKVSHFLĆFKDELWDWDQGbUHFRUGHG DXWRQRPRXVO\HYHU\PLQDWWKHEHJLQQLQJRIHDFKKRXU KUEHWZHHQb$SULO$WRWDORIPLQRIDXWRQRPRXV recordings were analyzed. Our preliminary results suggest that acoustic sensors could contribute to long-term monitoring efforts of active vocal avian species in low diverse avian DVVHPEODJHVDQGbZLWKUHODWLYHORZQRLVHVRXQGVFDSHV {փdփTT ID t ABSTRACT t 587 Female-biased sex ratio in the globally endangered Lears Macaw (Anodorhynchus leari) (ULFD3DF¯ĆFR1*, Thiago Filadelfo2, Tiago Ribeiro3, Francisco V. Denés1, Cristina Miyaki3, José Tella1 ǢW3Ó!2!-3£3+-$!£;!ধ32TTǣW'6!8;1'2;3( 33£[email protected] 2-='89-&!&'&'8!9У-!TǤW2-='89-&!&'&'È3!<£3 ID t ABSTRACT t Table of Contents the macaws principal food item. Rainfall from all four periods IDLOHGWRVLJQLĆFDQWO\SUHGLFWWKH65DQGQRUDLQIDOOPRGHOKDG a better rank than the null model. Further research is needed to understand the causes of the female-biased SR in Lears Macaw nestlings and to assess the SR in the adult population. r'8-$!6!$-)$3ӑǢ|+1!-£W$31 ORAL PRESENTATION SESSION 13: PARROT ECOLOGY There is evidence for maternal control of the sex ratio (SR) of offspring of birds modulated by food availability. In order WRRSWLPL]HWKHLUĆWQHVVZHOOIHGIHPDOHVPD\SURGXFH more offspring of the sex that is larger and more costly to rear, or of the sex where reproductive variance is larger. We assessed the SR of nestlings of the monogamous Lears Macaw (Anodorhynchus leari), to test for correlation with rainfall, a proxy of food availability. We collected blood samples from 63 nestlings (35 broods) at the Canudos Biological Station in Canudos, Bahia, over four breeding seasons (2009-2012). Sexing was performed by PCR with primers P2 and P8. They were sexed as 39 females and 24 males, resulting in a primary 65IHPDOHVPDOHRI7KHVHFRQGDU\65FRQVLGHULQJ RQO\ćHGJHGQHVWOLQJVZDV:HXVHGELQRPLDO*/0V to test if rainfall in the Canudos area predicts the primary SR for the 2009-2012 period. Because precipitation can be locally irregular in this biome (Caatinga), we used four different time periods as alternative explanatory variables: three, six and twelve months prior to January (the average peak of egg-laying activity), and also the previous OctoberNovember accrue, omitting December to account for the WLPHODJEHWZHHQUDLQIDOODQGIUXFWLĆFDWLRQRI/LFXULSDOPV !+'¢S8!¡8'9'2;!ࣅ329 {փdփTT POSTERS ,3;3#@29'¡13&wø329'$! ID t ABSTRACT t ID t Posters 4 Impactos da fragmentao de habitat nas comunidades de aves de Cerrado sensu stricto Renata D. Alquezar1*, Ricardo B. Machado1 ǢW2-='89-&!&'&'8!9£-! r8'2!;!£7<'A!8|192W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS 6 A fragmentação é um processo que envolve perdas de habitat e isolamento de manchas de vegetação nativa, e tem afetado negativamente muitos biomas em todo o mundo. Neste trabalho investigamos os impactos da fragmentação de habitat sobre a avifauna em duas regiões com distintos níveis de fragmentação no Cerrado. Amostramos duas unidades de conservação e três fragmentos do entorno de cada UC. Durante os meses de abril, junho, agosto e outubro de 2013, amostramos 64 pontos com técnicas de bioacústica para caracterizar as comunidades de aves das regiões estudadas. 8WLOL]DPRVJUDYDGRUHVDXWRP£WLFRVHSRVWHULRULGHQWLĆFD©¥RGDV espécies gravadas, enquanto a paisagem das regiões estudadas IRLFODVVLĆFDGDSDUDLGHQWLĆFD©¥RGRJUDXGHIUDJPHQWD©¥RGD região. Registramos 168 espécies de aves, distribuídas em 18 ordens e 44 famílias. A região mais fragmentada apresentou 54% de áreas antrópicas no entorno dos fragmentos, além de uma maior proporção de espécies onívoras e granívoras dentro dos fragmentos e maior proporção de espécies carnívoras dentro da UC. A região menos fragmentada apresentou Page 98, Posters ABSTRACT t Table of Contents 18% de áreas antrópicas e nenhuma resposta em relação à composição de guildas. As variáveis ‘tamanho da área’, ‘composição do entorno’ e ‘região’ foram importantes para explicar os padrões de riqueza encontrados. Neste estudo encontramos que as áreas abertas do Cerrado não possuem espécies de aves altamente sensíveis à fragmentação, muito provavelmente devido à estruturação natural da vegetação. Concluímos, entretanto, que a fragmentação no Cerrado DEHUWRFDXVDXPLPSDFWRPDLVVLJQLĆFDWLYRQDDOWHUD©¥RGD composição das espécies de aves do que na riqueza de espécies. Vocal variation of three species of antbirds (birds: Thamnophilidae) associated to a riverine barrier in the Rio Branco basin, Amazônia Rassa Sales1*, Luciano Naka1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3 r8!-+<'88!i|,3;1!-£W$31 POSTER SESSION: BIOACOUSTICS %LUGSRSXODWLRQVFDQGHYHORSSKHQRW\SLFDQGRUJHQHWLF differentiation when isolated on opposite sides of a geographic barrier. It remains unclear, however, whether vocal changes develop before or after other phenotypic characters (such as plumage), and whether changes in vocal characters precede genetic isolation. Changes in bird vocalizations are important because they can be linked to the speciation process as pre-zygotic isolation barriers. We studied morphological, genetic and vocal variation in three bird species from the family Thamnophilidae (Thamnophilus amazonicus, T. murinus, and Herpsilochmus dorsimaculatus) across the Rio Branco, a well-known biogeographic barrier located in the Brazilian {փdփTT ID t ABSTRACT t ID t state of Roraima. Two different subspecies of Thamnophilus amazonicus (cinereiceps and divaricatus) replace one another on opposite sides of this river and they show marked phenotypic (plumage) and genetic differentiation (~4%). Populations of H. dorsimaculatus across the Rio Branco represent a single taxon, but they are genetically differentiated (~2%) and reciprocally monophyletic, but show no consistent morphological differentiation. Finally, T. murinus lacks any genotypic or phenotypic variation across the river. None of the three species shows consistent variation across the river in the 15 vocal parameters measured. These results suggest that different selective pressures may be acting upon morphological, genetic and vocal characters, and that vocal differentiation may develop in isolated populations only after a considerable amount of time has passed, and after morphological changes have already been established in the populations. 22 Daniela Gomez1*, Roman Ruggera1, Luis Rivera1, Yanina Tejerina, Ever Tallei1, Marisel Morales, Rodrigo1, Natalia Politi1 r1!&!2-'£!+31'A|+1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY La captura con redes de niebla es una herramienta útil para el muestreo de aves de sotobosque y la tasa de captura es un índice que informa sobre su efectividad. En las Yungas del noroeste de Argentina la información disponible de las especies de aves obtenida a través de esta metodología es Page 99, Posters Table of Contents escasa. El objetivo de este trabajo es conocer las variaciones en las tasas de captura en 19 sitios de los distintos pisos altitudinales: Selva Pedemontana, Selva Montana y Bosque Montano (Yungas) y Pastizal de Altura. Dado que el esfuerzo de muestreo fue diferente en cada piso altitudinal, estandarizamos dicho esfuerzo calculando la tasa de FDSWXUDQ¼PHURGHFDSWXUDVKUHGKUHG UHG abierta durante 1 hora). En cada sitio colocamos entre 8 y 12 redes de niebla durante las temporadas reproductiva y no reproductiva, entre los años 2008 y 2015. Calculamos la frecuencia de captura de las especies para cada piso y temporada. En un total de 13856 h-red capturamos un total de 1930 individuos correspondientes a 123 especies de aves. $UUHPRQćDYLURVWULV\7XUGXVUXĆYHQWULVIXHURQHQJHQHUDO las especies más frecuentemente capturadas en todos los pisos altitudinales. La mayor tasa de captura fue de 44,8 LQGLYLGXRVKUHG\VHUHJLVWUµHQOD6HOYD3HGHPRQWDQD para la temporada reproductiva; la tasa más baja fue para la Selva Pedemontana en la temporada no reproductiva (7,68 LQGLYLGXRVKUHG/DVWDVDVGHFDSWXUDYDULDURQHQWUH los distintos pisos y temporadas probablemente debido a la dinámica temporal y espacial de las aves de sotobosque. Variaciones en las tasas de captura de aves a lo largo del gradiente altitudinal de las Yungas Australes de Argentina ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!&' </<@TT<T</<@T8+'2ধ2! ABSTRACT t 27 Rynchops nigeris affected by human disturbance in resting sites Bianca P. Vieira 2-='89-;@3(£!9+3> #-!2$!#-3<(9$|+1!-£W$31 POSTER SESSION: BEHAVIOUR 7KHćLJKWLQLWLDWLRQGLVWDQFHLVDXVHIXOPHDVXUHRIWKH susceptibility of birds to disturbance. Migratory species expend {փdփTT ID t ABSTRACT t high level of energy travelling from one place to another and human approaching may affect refuel in resting sites. Here the appropriate buffer distances to avoid disturbance during the Rynchops niger wintering period in coastal areas ZHUHHYDOXDWHG2QHSHUVRQDSSURDFKHGćRFNVLQWKUHH coastal areas in southern Brazil between 2011 and 2015. &RUUHODWLRQRIEXIIHU]RQHVZDVWHVWHGDFFRUGLQJWRćRFN size and composition, distance of beginning disturbance, EHKDYLRXUDQGHQYLURQPHQWDOIDFWRUV7KLUW\QLQHćRFNVXSWR 500 individuals in homogeneous or mixed with less numbers of gulls and terns were tested. Flight initiation distances had a mean of 15 m (max. of 45 m). Buffer zones were not related to HQYLURQPHQWDOIDFWRUVRUćRFNVL]HDQGFRPSRVLWLRQ,QFUHDVLQJ RIćLJKWLQLWLDWLRQGLVWDQFHVZDVFRUUHODWHGWRWKHGLVWDQFHRI beginning disturbance and with tide, showing that disturbance can affect birds even when beginning from long distances. Also, Rynchops niger do not wait for humans getting closer when there is not enough available area to stay. Rynchops niger landing distance was negatively correlated to wind, probably because it is harder escaping against wind. Results indicate that installing walkways and fenced observatories limited to a FRQVHUYDWLYHEXIIHU]RQHRIDWOHDVWPDZD\IURPWKHćRFNV preferred zones should prevent people crossing resting areas DQGGLVWXUELQJELUGV$VDQDGGLWLRQDOEHQHĆWSODWIRUPVRI observation are also educational, leisure and tourism attractive. Page 100, Posters ID t ABSTRACT t 32 Primeros reportes de piojos (Phthiraptera) en cazamoscas de Chile (Passeriformes, Tyrannidae) Table of Contents Danny Fuentes1*, Armando Cicchino2, Daniel Gonzlez-Acua1 ǢW !$<£;!&&'-'2$-!9';'8-2!8-!9T2-='89-&!&&'32$'6$-2T ǣW2-='89-&!&!$-32!£&'!8&'££!;!T8+'2ধ2!W r&[email protected](<'2;'91=|+1!-£W$31 POSTER SESSION: PARASITISM & AVIAN DESEASES Los piojos (Insecta: Phthiraptera) son parásitos comunes en aves que se relacionan estrechamente con sus hospedadores. En aves cazamoscas, a pesar de su abundancia en el Neotrópico, el estudio de sus piojos ha sido escaso; ésto es aún más marcado en Chile. Este trabajo pretende contribuir al conocimiento de la Phithirapterofauna en aves de la familia Tyrannidae en Chile. Para esto se buscaron piojos en aves depositadas en la colección del Museo Nacional de Historia Natural, aves capturadas mediante redes niebla y en necropsias de aves encontradas muertas. Los Phthiraptera fueron preservados en DOFRKRODOSDUDVXSRVWHULRUPRQWDMHHLGHQWLĆFDFLµQ(Q Muscisaxicola albilora se encontraron los piojos Machaerilaemus maestus y Picicola sp.; en Muscisaxicola cinereus se colectó Picicola sp.; en Muscisaxicola maculirostris se encontró Picicola sp.; en Muscisaxicola maclovianus se colectó Myrsidea sp. y Picicola sp.; en0XVFLVD[LFRODćDYLQXFKD la especie Picicola pseudofoedus; en Xolmis pyrope se aisló Picicola foedus, P. pseudofoedus y Menacanthus sp.; en Elaenia albiceps los piojos Tyranniphilopterus delicatulus, Menacanthus cfr. distinctus y Ricinus cfr. invadens; en Agriornis montanus se encontró P. pseudofoedus; en Agriornis lividus las especies P. pseudofoedus y Quadraceps sp.; en Tachuris rubrigastra se colectó a Philopterus titicacae, en Anairetes parulus a Machaerilaemus laticorpus y {փdփTT ID t ABSTRACT t ID t Ricinus sp. y en Colorhamphus parvirostris a Machaerilaemus sp. Con excepción de los piojos colectados en E. albiceps, todos representan nuevos registros para cazamoscas chilenos y nuevos representantes para la biodiversidad de Chile. (VWXGLRĆQDQFLDGRSRUSUR\HFWR)21'(&<7 36 ABSTRACT t Table of Contents in all years. These overstaying birds could be juveniles or adults not ready to breed. The species constant presence could DOVREHUHODWHGWRDFRQVWDQWćX[RIPLJUDQWVIURPGLIIHUHQW colonies using the same site. Inter-annual changes showed a VLJQLĆFDQWGHFUHDVHLQSRSXODWLRQRFFXS\LQJWKH5(6([7KH RESEx surroundings suffered great changes with the Southern ([SUHVVZD\ODQGĆOODIIHFWLQJWKHPDULQHELUGDVVHPEODJH 'LVSHUVLRQLQWKLVSRSXODWLRQFRXOGEHUHODWHGWRORVVRIĆVK stocks and also to loss of habitat due to beaches shifting for PDQJURYHIRUHVWV'LUHFWPDQDJHPHQWRIPXGćDWVDQGĆVKLQJ activities could help recovering population at the RESEx. Population of Rynchops niger in the Reserva Extrativista Marinha do Pirajubaé, southern Brazil Ceclia G. Pereira1*, Bianca P. Vieira2 ǢW '&'8!£2-='89-;@3(!2;!!;!8-2!TǣW2-='89-;@3(£!9+3> r$'$-+!#8-'£!6#|@!,33W$31W#8 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Rynchops niger LVDPLJUDWRU\ELUGGHSHQGHQWRQĆVKVWRFNV in calm waters. This species occurs along Santa Catarina FRDVWOLQHLQFOXGLQJEHDFKHVDQGPXGćDWVDWWKHZHVWED\V of the Island of Santa Catarina, southern Brazil. In one of the bays is the Reserva Extrativista Marinha do Pirajubaé (RESEx), a 1,712 ha protected area with mangrove forests and 953 ha RIPXGćDWVXVHGE\R. niger+HUHZHYHULĆHGVHDVRQDODQG inter-annual changes in population abundance from 2000 to 2012 in the RESEx. We gathered data from different monitoring and analyzed abundance per month over the years. The maximums were between December and May, except in 2009 when the species were present only in December and -DQXDU\0D[LPXPVDURXQGELUGVLQĆUVW\HDUVGURSSHG to 213 individuals in 2012. Minimums occurred from June to November with species present in all months. Minimums stayed around 50-100 individuals in all years. Most birds used the RESEx during non-breeding periods, yet overstaying occurred Page 101, Posters 37 Ecologia alimentaria de psittacidos en la selva pedemontana de las yungas australes, Jujuy, Argentina Anala Benavdez1*, Luis Rivera1, Natalia Politi1 ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!&'</<@ r!2!£-!#ӑǧ|+1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS Existe poca información sobre la dieta y patrones de alimentación de psittácidos de las Yungas Australes. Conocer este aspecto es necesario para diseñar estrategias de manejo y conservación adecuadas. Nuestro objetivo es entender los patrones de alimentación espaciales y temporales de siete especies de psittácidos de la selva pedemontana de las Yungas Australes. Entre enero del 2014 y marzo 2015, en tres sitios de selva pedemontana realizamos 1227 transectas de observación directa de 300 metros de longitud, en estación húmeda y seca. En total se obtuvieron 254 registros de alimentación de seis de los siete psittácidos citados para la zona de estudio forrajeando sobre 22 especies de árboles. En la estación seca consumieron {փdփTT ID t ABSTRACT t principalmente semillas (47,63%) y en la húmeda frutos \ćRUHV6HUHJLVWUµD3\UUKXUDPROLQDH alimentándose (n=98 puntos de alimentación) de 17 especies de árboles durante todo el año. Solo se registró en la estación seca a Amazona aestiva (n= 80) alimentándose de nueve especies y a Primolius auricollis (n=11) de tres especies. En la estación húmeda, Psittacara mitratus (n=17) y Psittacara leucopthalmus (n=7) se alimentaron de tres especies. Las principales especies consumidas fueron: Anadenanthera colubrina (26,38%) en la estación seca y Juglans australis (13,38%) en la húmeda, siendo en general la familia Fabaceae la más importante en la dieta de los loros de la selva pedemontana. Los resultados sugieren que los patrones de alimentación de los loros varían a lo largo del año probablemente relacionado con la disponibilidad de recursos alimenticios en la selva pedemontana. 38 (GDSKLFSK\VLRJQRPLFDQGćRULVWLFGHWHUPLQDQWV of Amazonian avian biodiversity Nargila Gomes de Moura1*, Jos Barlow2, Erika Berenguer2, Joice Ferreira3, Toby Gardner4, Ima Vieira1, Alexander Charles Lees1 ǢW<9'<!8!'29'1-£-33'£&-TǣW!2$!9;'82-='89-;@TǤW1#8!6! 1!A32-!8-'2;!£TǥW;3$0,3£12=-8321'2;29ধ;<;' ID t ABSTRACT t Table of Contents of undisturbed and degraded primary forest in two regions of the Brazilian Amazon. We collected data from 171 300m transects where, in addition to bird community composition, we measured live and dead wood biomass, tree species composition, understorey density, canopy openness, and soil content of aluminium, calcium, potassium and phosphorus, VLOWDQGFOD\:HXVHGWKHGHFLVLRQWUHHFODVVLĆFDWLRQPHWKRG Random Forests to uncover associations between forest VWUXFWXUDODQGHGDSKLFGHWHUPLQDQWVDQGERWKVSHFLHVVSHFLĆF and community wide patterns of occurrence. We found that tree biomass, richness of plants and calcium were the most important community-wide variables in both landscapes but that this generalisation hides extremely idiosyncratic and VSHFLHVVSHFLĆFUHVSRQVHVWRRXUHQYLURQPHQWDOGHWHUPLQDQWV 7KHEHVWPRGHOOHGELUGVSHFLHV5t!ZHUHPlatyrinchus platyrhynchos, Myiornis ecaudatus and Lipaugus vociferans in Paragominas and Chiroxiphia pareola, Lipaugus vociferans and Pteroglossus aracari in Santarém. Our results highlight WKHQHDULPSRVVLELOLW\RIĆQGLQJDçVLOYHUEXOOHWèYDULDEOHWKDW neatly captures environmental variation at the community level and highlights the need for more nuanced analyses to DLGWKHIRUPXODWLRQRIPRUHHIĆFLHQWFRQVHUYDWLRQSODQV r2!8+-£!13<8!|@!,33W$31W#8 POSTER SESSION: COMMUNITY ECOLOGY Amazonia is far from homogenous and for avian communities the relationship between vegetative structure and edaphic characteristics is likely to be a key determinant of the organization and structure of these assemblages. Here we aimed to understand what forest structural characteristics and soil variables dictate the occurrence of bird species in areas Page 102, Posters {փdփTT ID t ABSTRACT t 40 Distributional correlates, population sizes and conservation status of endemic bird taxa from an isolated coastal mountain in northern South America ID t ABSTRACT t Table of Contents Species also varied in their tolerance to habitat loss, while population densities varied with elevation in some taxa. Despite the fact that not all of the species studied are currently OLVWHGDVWKUHDWHQHGRXUJDSDQDO\VHVVXJJHVWWKDWVSHFLĆF conservation actions are required to avoid deterioration in their population status, given their limited distribution. Esteban Botero-Delgadillo1,2*, Nicholas Bayly1, Camila Gmez1, Sandra Escudero-Pez1, Paulo C. Pulgarn-R.1, Mara Isabel Moreno1 ǢWV'9'!8$,(38$329'8=!ধ32-2;,''3;836-$9TǣW2-='89-&!&&',-£' r'#3;'83&|+1!-£W$31 POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES The Sierra Nevada de Santa Marta (SNSM) is a coastal mountain range in northern Colombia that harbors ca. 70 endemic bird taxa, although such endemism remains relatively poorly known. This applies to many species threatened with extinction, recently split species, and taxa that have been recently reinstated as full species. Most of these rangerestricted birds are still subject to high levels of habitat loss, and there is little information regarding their habitat UHTXLUHPHQWVDQGWKHLUFRQVHUYDWLRQQHHGV:HUHSRUWWKHĆUVW results of a long-term study of the SNSM endemics focused on determining (i) the environmental factors explaining their restricted presence; (ii) their extent of occurrence (EOO), area of occupancy (AOO) and rates of habitat loss; (iii) their patterns of habitat use; (iv) their population and conservation status; and (v) their main information gaps. Combining point locality data and information on population density and habitat XVHZHIRXQGWKDWWKH$22VRIWKHĆYHVSHFLHVDQDO\]HGWR date are more restricted than previously described, despite having included more geographic data in our analyses than any previous study. We also found that each species presence was limited by distinct climatic factors, but all were correlated with the seasonality of precipitation and temperature. Page 103, Posters 46 Population dynamics of waterbirds in a tailings dam in Central Chile Mauricio Pez1*, Cristian Estades1 ǢWT2-='89-&!&&',-£' r16!'A|@1!-£W$31 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY Mining waste materials resulting from processing of mineral resources are usually stored in tailings dams. These reservoirs may act as ecological traps as they attract many watebird species that may be exposed to high concentrations of heavy PHWDOV8VLQJVHDVRQDOFHQVXVGDWDIRXUFHQVXVHV\HDU we studied the changes in the waterbird populations that colonized the Ovejería tailings dam (North of Santiago de Chile), from its creation in 1999 through the winter of 2012. In order to explain the changes observed in the abundance of the recorded species we used Generalized Linear Models, including an autoregressive term, and different predictors (i.e. time since creation, season, precipitation, temperature, size of the reservoir, introduction of the carp Cyprinus carpio in 2005). 7RWDOELUGDEXQGDQFHVKRZHGDVWURQJLQFUHDVHGXULQJWKHĆUVW ĆYH\HDUVRIWKHVWXG\EXWDIWHUDGHFOLQHZDVREVHUYHG in both , total abundance and species richness. Carp presence {փdփTT ID t ABSTRACT t ID t in the reservoir was the best predictor of the bird community composition, since the populations of over 50% of the species VLJQLĆFDQWO\FKDQJHGWKHLUDEXQGDQFHDIWHUWKHLQWURGXFWLRQ RIWKLVH[RWLFĆVK%HVLGHVPRVWRIWKHODWWHUFKDQJHVZHUH highly consistent, with many populations of piscivorous species LQFUHDVLQJWKHLUQXPEHUVZKLOHDOOKHUELYRURXVDQGĆOWHULQJ species populations decreased. Although our study cannot rule out an impact of the site’s toxicity on the analyzed populations, the trends observed during 14 years of continuous monitoring GRQRWVKRZDQ\HYLGHQWVLJQVRISRSXODWLRQFRPPXQLW\ disfunctionality that could be attributed to such an effect. 55 Pedro T. S. M. Moura1*, Leonardo F. F. Frana1 r6'&83;'3)£313<8!|+1!-£W$31 Table of Contents a uma única guilda alimentar (36 insetívoros, 17 onívoros, 6 carnívoros, 6 granivoros, 2 necrófagos, 2 nectarívoros e 1 frugivoro), 34 espécies que incluíam itens secundários na dieta (ins.+sec. = 21, gran.+sec.= 11, rug.+sec.= 2) e 30 espécies com dieta mista (carn.+ins.= 6, nect.+ins.= 3, ins.+frug.= 2, frug.+gran.= 1 e ect.+ins.+frug.= 1). Para três espécies não encontramos informações. A predominância de insetívoros parece ser comum em ambientes da Caatinga. O número de espécies generalistas foi maior mesmo entre as restritas a uma única guilda como os insetívoros, a maioria oportunistas. Diferente do encontrado na Floresta Atlântica, onde a estabilidade ambiental permite especializações. A GLVWULEXL©¥RQDVJXLOGDVWUµĆFDVGDFRPXQLGDGHSRGHVHU resultante de adaptações à condição de sazonalidade climática da Caatinga que age sobre os padrões de uso do recurso. (VWUXWXUDWUµĆFDGHXPDFRPXQLGDGHGHDYHV da Depressão Sertaneja Setentrional ǢW2-='89-&!&' '&'8!£<8!£&3'1-f8-&3 ABSTRACT t 57 Get acquainted with your enemy POSTER SESSION: DIET & TROPHIC INTERACTIONS Ricardo C. Meireles1*, Filipe C. R. Cunha2, Julio, C. R. Fontenelle3 2WLSRGHK£ELWRDOLPHQWDUFRPXPHQWHLQćXHQFLDSURFHVVRV ELROµJLFRVPXGDGHSHQDVHUHSURGX©¥RHGHPRJU£ĆFRV (sobrevivência e abundância) das aves. Nosso objetivo foi UHDOL]DUPRVXPDFDUDFWHUL]D©¥RWUµĆFDGHXPDFRPXQLGDGH de aves. Desenvolvemos este estudo em uma área ao norte da Caatinga. A listagem das espécies foi obtida através de capturas por redes de neblina e observações de rotina QD£UHDGHHVWXGRQ|GHRFDVL·HV HQWUHVHWH DJR$YDOLDPRVDSUHIHU¬QFLDDOLPHQWDUGDFRPXQLGDGH FRQVXOWDQGRELEOLRJUDĆDVHVSHFLDOL]DGDVGHGLHWD(QFRQWUDPRV 121 espécies, cerca de 46% das espécies listadas para o 5LR*UDQGHGR1RUWH,GHQWLĆFDPRVHVS«FLHVUHVWULWD ǢW2-='89-&!&' '&'8!£&'-39!TǣW2-='89-;@3( <8-$,TǤW29ধ;<;3 '&'8!£&'-2!9'8!-9 Page 104, Posters r8$1'-8'£'9|,3;1!-£W$31 POSTER SESSION: BEHAVIOUR Birds, in general, can recognize their predators and can adopt different strategies to avoid the predation. In order to explore the bird`s discrimination ability in such predator recognizing, VHYHUDOĆHOGH[SHULPHQWVZHUHGHYHORSHGLQ6RXWKHDVWHUQ %UD]LO7RDFFHVVWKLVLQIRUPDWLRQPRGHOVDQGRUYRFDOL]DWLRQV of closely related owl species were presented to the local bird community, meaning different levels of danger and familiarity. Then, composition and intensity of mobbing was measured. {փdփTT ID t ABSTRACT t We found that birds were not able to discriminate owl species within the same genus (Asio and Glaucidium), whether they were familiar or not (sympatric or allopatric). Nevertheless, in a different threat level, when birds were presented to diurnal owl species (less closely related and with distinct diets), the mobbing against the dangerous predator was less intense but in larger groups, compared to non-dangerous predator. This result suggests that birds can access general information about familiar predators and extrapolate when in front of unfamiliar predators. We also provided evidences that birds may recognize distinct predators and the threats they might represent, and choose strategies accordingly to its degree of risk. We highlight that birds exhibit complex predator recognition systems, allowing them to respond in two different ways: detailed discrimination among familiar situations, and generalization while in unfamiliar situations. 58 Primeros reportes de parásitos deSporagra barbata (Aves: Fringillidae) en distintas regiones ecológicas de Chile Danny Fuentes1*, Armando Cicchino2, Sergey Mironov3, Daniel Gonzlez-Acua1 ǢW !$<£;!&&'-'2$-!9';'8-2!8-!9T2-='89-&!&&'32$'6$-2TǣW 2-='89-&!&!$-32!£&'!8&'££!;!T8+'2ধ2!WTǤW 33£3+-$!£29ধ;<;'T <99-!2$!&'[email protected]($-'2$'9T2-='89-;';[email protected]!1#!201'2;Ǣ ID t ABSTRACT t Table of Contents aves del neotrópico, el presente trabajo pretende determinar la fauna parasitaria de S. barbata, y además establecer si existen variaciones en la prevalencia e intensidad del parasitismo en siete regiones ecológicas de Chile. Se analizaron 125 ejemplares capturados con redes niebla y 22 que se les practicó necropsia parasitaria. Las muestras extraídas fueron conservadas en alcohol al 70% para su posterior montaje e LGHQWLĆFDFLµQ(QMLOJXHURVGHODVDYHVDQDOL]DGDV se encontraron ectoparásitos, 48 de ellos (33%) tenían 770 £FDURVLGHQWLĆFDGRVFRPRStrelkoviacarus critesi Spory, 1965; 680 como Proctophyllodes spini Atyeo & Braasch 1966; 67 como Knemidocoptes jamaicensis Turk, 1950; uno como Analges passerinus Linnaeus, 1758 y tres ácaros pertenecientes a la tribu Schoengastiini. En 21 aves (14%) se encontraron 54 piojos, IXHURQLGHQWLĆFDGRVFRPRMyrsidea serini Seguy, 1944; 21 como Philopterus roehreri Eichler, 1956 y 15 como Ricinus carolynae Nelson, 1972. No se encontraron endoparásitos en los individuos necropsiados. Existieron diferencias VLJQLĆFDWLYDVHQODSUHYDOHQFLDHLQWHQVLGDGGHSDU£VLWRVHQODV distintas regiones ecológicas. Todos los parásitos encontrados constituyen nuevos reportes parasitológicos para la especie Sporagra barbata, por lo que el presente estudio entrega nueva información sobre parásitos de aves presentes en Chile, lo cual aumenta el conocimiento de la biodiversidad del país. r&[email protected](<'2;'91=|+1!-£W$31 POSTER SESSION: PARASITISM & AVIAN DESEASES El fringílido Sporagra barbata Molina, 1782, a pesar de ser un ave abundante y de extensa distribución en el cono sur de Sudamérica, no presenta estudios referidos a sus parásitos. Con el objetivo de aumentar el conocimiento del parasitismo en Page 105, Posters {փdփTT ID t ABSTRACT t 62 Towards a cohesive and critical socioornithology for the Neotropics ID t ǢW32ধ)$-!2-='89-&!&!;£-$!&',-£'ǣW2-='89-;@3(8-ধ9,3£<1#-!T ǤW2-='89-;@3(!;'8£33TǥW2-='89-;@3('38+-!T ǦW2-='89-;!;&'!8$'£32!TӐW'2;83&'9;<&-391#-'2;!£'9&'£ 38;'&',-£'TǧW2-='89-&!&!$-32!£&'<'239-8'9 r/ধ#!88!|<$W$£ POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES Page 106, Posters Table of Contents social sciences and the humanities (e.g. ecology, history, environmental education, ethnosciences, ontology, political ecology, arts). We provide cases from Argentina, Chile, Costa Rica, Ecuador, Panama and Latin American immigrants in North America, to illustrate how the analysis of the interwoven nature of bird-human relationships informs about multi-scale and multi-dimensional drivers impacting bird-people systems. We suggest that ornithologists working on conservation initiatives in the Neotropics require an interdisciplinary training with local relevance because of the reciprocal links between regional environmental and social problems. Jos Toms Ibarra1,2*, J. Cristbal Pizarro3, Antonia Barreau2, Fausto O. Sarmiento4, Mnica Martnez Mauri5, Csar Piones Caete6, Celeste Medrano7 Bird-human relationships represent the complex linkage between biological and cultural diversity, and thus integrative but also critical approaches are needed for their effective conservation. The Neotropics is a vast ecozone including Mexico, Central America, South America and the Caribbean, with the world’s greatest bird diversity and nearly 1,000 human languages. Neotropical languages and other cultural dimensions (e.g. ontology, medicine, food, politics, art) are inextricably linked to birds. This link is evident in the way that HQYLURQPHQWDOGHIRUHVWDWLRQGHVHUWLĆFDWLRQXUEDQVSUDZO and social (poverty, inequalities, cultural erosion) problems synergistically impact avian and human communities. However, increasing academic ultra-specialization narrowly treats causes of environmental problems, and isolates their impacts over either bird or human communities within the ecozone. We propose a cohesive and critical ‘socio-ornithology’ that aims to (i) understand bird-human relationships as units comprising interconnected systems, and (ii) examine environmental problems drawing on critical stands from natural sciences, ABSTRACT t 63 Invasive exotic birds in Brazil: implications on biodiversity of local populations and plans of management. Gabriela Franzoi1*, Isadora Fluck Essig1, Amanda Simes Souza2 ǢW2-='89-&!&' '&'8!£&'!2;!!8-!TǣW2-='89-&!&'&'8!9£-! r+!#8-'£!(&8-|+3;1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION The invasion of natural environments by alien species is considered the second leading cause of biodiversity loss. About 400 invasive bird species have been catalogued worldwide. In Brazil, there are four alien bird species that have come from other continents: Columba livia, Passer domesticus, Estrilda astrild and Bubulcus ibis. This study aimed to analyze the ecological changes that these species cause to native communities, and possible ways to control and prevent its spread. The occupation maps found in the literature pointed out the main problems related to these four species of birds in Brazil. C. livia, P. domesticus and E. astrild species, whose introductions ZHUHDUWLĆFLDOHDVLO\VHWWOHGLQ%UD]LOFDXVLQJJUHDWGDPDJH {փdփTT ID t ABSTRACT t ID t to native populations. For example, C. livia is a viral disease vector able to infect other birds; P. domesticus is an aggressive competitor for nesting space, while E. astrild is a disperser of exotic seeds. The species B. ibisZDVĆUVWUHFRUGHGLQ%UD]LO in 1960s, but there is still a contest if the introduction was QDWXUDORUDUWLĆFLDO+RZHYHULWLVXQGHQLDEOHWKDWWKHSUHVHQFH of B. ibis negatively affects the native fauna, by competition with other egrets and predation of the endemic lizard Euprepis atlanticus in Fernando de Noronha Island, among other animals. In a future study, species colonization models will be performed in order to analyze their distribution potential, and predict the possible spread of invasive species. Thus, this tool can be used to control these species in an attempt to reduce the imbalance that they cause in the ecosystem. 66 Mariana L. Campagnoli1*, Alexsander Z. Antunes2 ǢW29ধ;<;3&'-3-Í2$-!9fTǣW29ধ;<;3 £38'9;!£ POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Biological invasion is a more and more common process in natural environments around the world, being a much GLVFXVVHGVXEMHFWLQWKHVFLHQWLĆFFRPPXQLW\,QDQLQYDGHG habitat, the function of the invasive species needs to be evaluated. The State Parks Alberto Löfgren and Cantareira, São Paulo southeastern Brazil, are suffering from varying degrees of invasion by three species of invasive exotic palms (IEPs). To help managers in their decision making process, the present Page 107, Posters Table of Contents VWXG\LQWHQGHGWRYHULI\KRZWKH,(3VGHQVLW\LQćXHQFHV the understory bird assemblages in these parks. Both point counts and mist nets were used together to avian survey and the point-centered quarter sampling, allied with the counting of IEPs individuals, characterized the vegetation structure. Three treatments with IEPs density’s low, medium and high were compared concerning richness, diversity, abundance and trophic structure of the avifauna. IEPs density and bird richness DQGDEXQGDQFHGLIIHUHGVLJQLĆFDQWO\EHWZHHQWKHWUHDWPHQWV A negative relation was encountered between IEPs density and bird richness, abundance and diversity. Therefore, an environment can suffer reduction of bird species when there is an invasion. However, the palm cutting in the areas with high density of IEPs could result in a very sudden change in the vegetation, leading to the loss of the birds’ habitat. We suggest then, the cut of the individuals used in landscaping present near the buildings of both parks and constant monitoring of the Cantareira region, in order that invasion does not spread. Impact of density of invasive exotic palms on forest understory birds in Southeastern Brazil r1!8-!2!$!16!+23£-|+1!-£W$31 ABSTRACT t 68 Divergencia genética y morfométrica de dos XQLGDGHVJHRJU£ĆFDV\PRUIROµJLFDVGHQWUR de(XSKRQLDDIĆQLV(Aves: Fringillidae) A. Melisa Vázquez-López1*, Blanca Estela Hernández Baos2 ǢW39+8!&3'2-'2$-!9-3£+-$!9TǣW<9'3&' 33£3+!T !$<£;!& &'-'2$-!9T2-='89-&!&!$-32!£<;231!&'Ì?-$3 r!£1!1'£-9!|@!,33W$31W1? POSTER SESSION: SYSTEMATICS & TAXONOMY Dentro de (XSKRQLDDIĆQLV se reconocen dos subespecies donde FDGDXQDUHSUHVHQWDXQDXQLGDGJHRJU£ĆFD\PRUIROµJLFD {փdփTT ID t ABSTRACT t a) godmani distribuida en el Oeste de México, con las plumas cobertoras de la cola color blanco y b)DIĆQLVdistribuida desde el Este de México hasta el Noreste de Costa Rica, con las plumas cobertoras de la cola color amarillo. El objetivo de este trabajo fue determinar las unidades evolutivas dentro de (DIĆQLVutilizando caracteres genéticos (mitocondriales y nucleares) y morfométricos. Con los datos genéticos se obtuvo XQDĆORJHQLD\UHGHVGHKDSORWLSRVUHFRQRFLHQGRGRVJUXSRV FRQJUXHQWHVFRQODVXQLGDGHVJHRJU£ĆFDV\PRUIROµJLFDV descritas. Respecto a los análisis morfométricos se realizaron en forma separada para ambos sexos, debido a que los machos presentan medias mayores en las variables tomadas. En la prueba de ANOVA se observa que los individuos del linaje godmani, presentan mayores dimensiones en el ala y base del pico respecto a DIĆQLV Mientras que los individuos del linaje DIĆQLVWLHQHQODFROD\HOSLFRP£VODUJR(QHO$Q£OLVLVGH Componentes Principales los individuos de Centroamérica, forman un grupo con menores dimensiones en el ala y base del pico. Nuestros resultados son congruentes con los de otros estudios, donde se demuestra que existen linajes recientes en las tierras bajas de Mesoamérica, donde generalmente el Oeste de México contiene linajes endémicos respecto al Este de México y Centroamérica. Recomendamos reconsiderar el estatus taxonómico de ambos linajes, elevándolos a especies, ya que, representan dos unidades evolutivas independientes. Page 108, Posters ID t ABSTRACT t 70 Ninho, ovos e ninhegos de Rhopias gularis (Passeriformes: Thamnophilidae) no Sudeste do Brasil Table of Contents Daniel F. Perrella1*, Carlos H. Biagolini-Jr.1, Lais RibeiroSilva1, Paulo V. Q. Zima1, Mercival R. Francisco1 ǢW !8f2-='89-&!&' '&'8!£&'3!8£39 r&(6'88'££!|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Rhopias gularis, espécie endêmica da Mata Atlântica e pertencente ao complexo Myrmotherula, recentemente tem sido alvo de discussões acerca de sua taxonomia. O presente estudo compreende a descrição do ninho, ovos e ninhegos associada à possível posição taxonômica da espécie. Entre outubro de 2013 e janeiro de 2014, foram encontrados 12 ninhos ativos da espécie no Parque Estadual Carlos Botelho, um dos UHPDQHVFHQWHVGH0DWD$WO¤QWLFDPDLVVLJQLĆFDWLYRVGRHVWDGR de São Paulo. Os ninhos tinham formato de taça profunda, Ć[DGDVSRUVXDVERUGDVHPJDOKRVKRUL]RQWDLVHPIRUTXLOKDH construídas entre 34 e 70 cm de altura nas margens ou sobre riachos na mata. O material dos ninhos consistia principalmente HPUD¯]HVĆQDVĆODPHQWRVGHIXQJRQHJURHIROKDVVHFDVGH samambaia. Em dois ninhos observou-se um ponto de costura passando por uma folha, que foi trazida sobre a câmara incubatória formando um telhado. As medidas dos ninhos foram 73,6 ± 9,8 mm de diâmetro externo, 58,6 ± 7,5 mm de diâmetro interno, 58,5 ± 8,1 mm de altura interna e 68,4 ± 12,0 mm de altura externa. Todos continham dois ovos brancos com machas e pintas marrom-escuras e avermelhadas. Os ovos (n = 18) mediram 19,0 ± 0,8 mm de comprimento, 14,5 ± 0,4 mm de largura e pesaram 2,2 ± 0,2 g. Recém-nascidos eram rosados e desprovidos de plumas. A arquitetura dos ninhos, {փdփTT ID t ABSTRACT t ID t ovos e ninhegos foi similar aos de outras espécies pertencentes ao complexo Myrmotherula, sugerindo que tais características Q¥RV¥RLQIRUPDWLYDVRVXĆFLHQWHSDUDUHFRQVWUXLUDVĆORJHQLDV baseadas em DNA que validaram o gênero monotípico Rhopias. 72 ABSTRACT t Table of Contents megacephalum e 97 para R. fuscicauda. As espécies utilizam com frequência o bambu para procurar e capturar presas, porém R. megacephalum demonstrou ser mais especializado nos substratos do bambu. Foram encontradas diferenças VLJQLĆFDWLYDVQDVYDUL£YHLVVXEVWUDWRGHDWDTXHPDQLSXOD©¥R do alimento, comportamento pós-ataque, altura do forrageio, altura do ataque, distância percorrida no ataque, número de poleiros e tempo médio de procura por poleiro. As diferenças encontradas entre as duas espécies possivelmente explicam a coexistência das mesmas em um mesmo local e habitat. (VWUDW«JLDVGHIRUUDJHLRSUHIHU¬QFLDGHKDELWDWHFRH[LVW¬QFLD de Ramphotrigon fuscicauda e R. megacephalum no leste do Acre Tomaz Melo 2-='89-&!&' '&'8!£&3$8' ;31!A21'£3|,3;1!-£W$31 POSTER SESSION: HABITAT USE O sudoeste da Amazônia possui uma grande diversidade de aves e dentre elas destacam-se as aves especializadas HPćRUHVWDVFRPEDPEXV1HVVDUHJL¥RREDPEXSRGHVHU considerado um elemento chave da paisagem. O objetivo deste trabalho foi investigar a coexistência, preferência de habitat e comportamento de forrageio das espécies Ramphotrigon megacephalum e R. fuscicauda, ambas consideradas especialistas de bambus e que são simpátricas nessa região. O estudo foi conduzido de novembro de 2013 a setembro de 2014 em dois fragmentos no leste do estado do Acre: Fazenda Experimental Catuaba, em Senador Guiomard e Reserva Florestal Humaita, em Porto Acre. Para a coleta dos dados foram utilizadas parcelas permanentes do Programa de Pesquisa em Biodiversidade-PPBio. O modelo nulo revelou que a distribuição das duas espécies nas áreas de estudo «DRDFDVRVHPXPDLQćXHQFLDUDRFRUU¬QFLDGDRXWUD Ambas espécies demonstraram preferência pelo habitat GHEDPEXFRPUHOD©¥RVLJQLĆFDWLYDFRPDGHQVLGDGHGH colmos. Foram registrados 109 eventos de forrageio para R. Page 109, Posters 74 Breeding territory of the Great-billed SeedFinch Sporophila maximiliani Fálvio Ubaid1*, Cesar Augusto Bronzatto Medolago2, Mercival Roberto Francisco2, Luís Fábio Silveira3 ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&' 9;!&<!£!<£-9;!TǣW2-='89-&!&' '&'8!£&'3!8£39TǤW <9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3 r*!=-3<#!-&|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION %UHHGLQJWHUULWRU\LVGHĆQHGDVDVSDFHH[WHQVLRQDQG time-duration occupied by a species. Many Passerine birds establish territories during the breeding season when males sing to attract females and aggressively confront neighboring FRQVSHFLĆFVWRGHIHQGWKHLUVSDFH,QPRVW1HRWURSLFDO birds the breeding territory area is unknown, impeding the developmemnt of conservation strategies. The Great-billed Seed-Finch, Sporophila maximiliani, is critically endangered, ZLWKIHZUHFHQWUHFRUGVLQWKHĆHOG&DSWLYHEUHHGLQJLVZHOO known, but no information is available about the breeding {փdփTT ID t ABSTRACT t biology in the wild. On December 2014 we found a pair in the ĆUVWGD\RIQHVWEXLOGLQJRQ0DWR*URVVR6WDWH0DOHWHUULWRU\ was spot-mapped using a gps considering singing-perches and feeding points. Two observers carried out the notes from Dec 2014 to Jan 2015, from sunrise until about 11am, and sometimes in the afternoon until dusk. More than 85% of the territory defended by the male was in an area of 0.313ha. The male sang from the highest perches, although lower perches were also used. The territory was established especially in view of strategic feeding points of sawgrass bushes (Scleria VS%HVLGHVWKHVRQJWKHWHUULWRU\GHIHQVHLQYROYHGćLJKWV toward possible predators near the nest. Sometimes the female accompanied the male and attacked other bird species (e.g. Pitangus sulphuratus). Local residents reported that the species still suffers great hunting pressure in the region. Historically, the illegal capture is certainly the main factor of decline of wild populations. These new data should be used in future FRQVHUYDWLRQSURMHFWVVSHFLĆFDOO\LQUHLQWURGXFWLRQSURSRVDOV 75 Respostas comportamentais de aves a vocalizações de potenciais predadores no Pantanal Matogrossense Sandro Gonalves Moreira1,2*, Vitor Campos1 ǢW2-='89-&!&'&'8!9£-!TǣW'2;832-='89-;8-3&'!;39&'-2!9 r9!2&83'$,3!=-9|,3;1!-£W$31 POSTER SESSION: BEHAVIOUR Aves formam um grupo de vertebrados em que as interações LQWHUHVSHF¯ĆFDVV¥RIUHTXHQWHVPHUHFHQGRGHVWDTXHD predação, que corresponde a uma importante pressão ambiental, sendo um dos principais elementos da seleção Page 110, Posters ID t ABSTRACT t Table of Contents natural, de maneira que a detecção de um predador pode ser determinante para a sobrevivência de um indivíduo. O objetivo deste trabalho foi averiguar a capacidade de aves em reconhecer potenciais predadores por suas vocalizações. Foram emitidos playbacks com vocalizações de Rostrhamus sociabilis, Accipiter bicolor e )DOFRUXĆJXODULV em seis diferentes áreas da RPPN do Sesc Pantanal,Mato Grosso, no período de 26 a 30 de maio de 2014, registrando-se, logo após cada playback, as respostas comportamentais das aves locais. As aves mostraram-se indiferentes às vocalizações de Rostrhamus sociabilis, mas apresentaram, na maioria das vezes, respostas defensivas às vocalizações Accipiter bicolor e )DOFRUXĆJXODULV, o que indica a capacidade de reconhecimento de potenciais predadores locais, corroborando a existência de um processo coevolutivo entre as espécies. 76 (YLGHQFLDGHDOWDHVWUXFWXUDĆORJHRJU£ĆFDGHQWUR de la especie Habia rubica (Aves: Cardinalidae) Sandra Marisol Ramírez Barrera1*, Blanca Estela Hernández Baos1, John Klicka2 ǢW2-='89-&!&!$-32!£<;231!&'Ì?-$3TǣW<80'<9'<1 3(!;<8!£-9;[email protected]!2&<£;<8'T2-='89-;@3(!9,-2+;32 r1!8-A3£ǦǡӐ|@!,33W$31W1? POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS Las especies neotropicales poseen una compleja historia de GLYHUVLĆFDFLµQSURGXFWRGHODLQćXHQFLDTXHHMHUFHQGLYHUVRV IDFWRUHVJHRJU£ĆFRVHFROµJLFRVFOLP£WLFRV\JHROµJLFRV sobre los linajes que determinan los patrones de distribución GHVXVSREODFLRQHV/DĆORJHRJUDI¯DDQDOL]DGLFKRVSDWURQHV {փdփTT ID t ABSTRACT t GHYDULDFLµQJHRJU£ĆFDDQLYHOJHQ«WLFR(QHVWHWUDEDMR exploramos la estructura genética de las poblaciones de Habia rubica con el objetivo de proponer una hipótesis acerca de VXKLVWRULDHYROXWLYD\SURFHVRVGHGLYHUVLĆFDFLµQ3DUDHOOR realizamos un análisis multilocus utilizando secuencias de cinco marcadores moleculares, cubriendo el área de distribución de la especie, desde México hasta Sudamérica. Con estos datos se obtuvo una hipótesis acerca de la historia evolutiva (utilizando Mr. Bayes), una red de haplotipos y un análisis de tiempos de divergencia. Nuestros resultados muestran que la especie Habia rubica se encuentra conformada por dos clados principales, uno que incluye las poblaciones de México y Centroamérica y otro que incluye las poblaciones de Sudamérica. Dentro de cada uno de éstos clados se reconocen ocho haplogrupos cuyos límites tienen una correspondencia FODUDFRQDOJXQDVGLVFRQWLQXLGDGHVJHRJU£ĆFDVLPSRUWDQWHV como el Istmo de Tehuantepec en México, la Cordillera de Talamanca e Istmo de Panamá en Centroamérica y la meseta Brasileña en Sudamérica. La coincidencia entre la estructura genética de estos haplogrupos y la compleja HVWUXFWXUDĆVLRJU£ĆFDGHODUHJLµQ0HVRDPHULFDQD GHVFULEHXQDKLVWRULDGHGLYHUVLĆFDFLµQPXFKRP£VDFWLYD\ compleja hacia el norte de la distribución de esta especie. Page 111, Posters ID t ABSTRACT t 77 Caracterización conductual en Geranoaetus melanoleucus y su utilidad para la determinación de zonas reproductivas. Table of Contents 8-9ধ!2 £38'9ǢrT!8$-!£'£;8!1ÐǢ ǢW2-='89-&!&';8363£-;!2!&'-'2$-!9&'£!&<$!$-Õ2 r$32;!$;3|<1$'W$£ POSTER SESSION: BEHAVIOUR El plano regulador de la Región Metropolitana de Santiago de &KLOHHVSHFLĆFDTXHVHSXHGHQGHVDUUROODUFRQVWUXFFLRQHV KDVWDORVPVQP/DH[SORVLµQGHPRJU£ĆFDTXHKDVXIULGR la ciudad ha obligado a reinterpretar los usos de los suelos para que adquieran la categoría de aptos para la construcción, lo que provoca pérdida de biodiversidad del sector. Una de las especies que se ha visto afectada por esta situación es él acitrípido Geranoaetus melanoleucus, quien cumple un importante rol en la regulación de especies vectores de enfermedades, debido a que HVXQGHSUHGDGRUWRSHHQODWUDPDWUµĆFD Considerando estos antecedentes, se quiso determinar la importancia ecológica para el ave de una quebrada sometida a un incipiente proceso de urbanización, ubicada en el sector de San Carlos de Apoquindo (33° 24’ S, 70° 28’ O). Se utilizo el método animal focal para caracterizar la frecuencia y duración de las conductas realizadas por las aves durante los períodos UHSURGXFWLYR\QRUHSURGXFWLYR6HGHĆQLHURQGLIHUHQWHVWLSRV de vuelo, conductas reproductivas y aperchado. Los vuelos con mayor frecuencia durante ambos períodos fueron vuelo planeado rectilíneo (VPR) y vuelo circular ascendente (VCA). El rango horario de mayor actividad se estableció entre las 12:00-13:00 y 15:00-16:00. Las conductas reproductivas y los vuelos de caza aumentaron en el periodo reproductivo. En base {փdփTT ID t ABSTRACT t ID t a estos resultados se puede concluir que esta quebrada cumple un rol ecológico importante para la reproducción de esta ave. 80 Aspectos ecológicos das assembleias de aves em áreas com dinâmica de morte massiva do bambu (Guadua sp.) no Acre, Brasil ABSTRACT t Table of Contents Curtis foi de 92,7%. Houve uma correlação entre as duas áreas em relação ao número de espécies por guilda. Áreas de Floresta Aberta com Bambus madura diferem daquelas em que o bambu morreu apenas com relação à composição de espécies de aves. 2-='89-&!&' '&'8!£&3$8' Determinants of tree species preference for foraging by insectivorous birds in a woodland dominated by alien tree species in Puerto Rico ;31!A21'£3|,3;1!-£W$31 William Beltrn1*, Joseph M. Wunderle2 POSTER SESSION: COMMUNITY ECOLOGY ǢW'6;W3(!;<8!£$-'2$'9T2-='89-;@3(;,'!$-)$TǣW2;£W 29ধ;<;'3(836-$!£ 38'9;[email protected] 38'9;'8=-$' Tomaz Melo Os bambus do gênero GuaduaWHPXPDLQćX¬QFLDPXLWR forte nos ambientes que ocorrem no sudoeste da Amazônia, podendo ser considerados elementos-chave desses sistemas. Bambus do gênero Guadua morrem após eventos de IUXWLĆFD©¥RHPPDVVD1HVWHFRQWH[WRRREMHWLYRGHVWHWUDEDOKR IRLRGHFRPSDUDUDULTXH]DFRPSRVL©¥RHVWUDWLĆFD©¥RH guildas alimentares de aves em uma área com a presença do bambu e outra que o bambu morreu em anos recentes no Parque Estadual Chandless, município de Manoel Urbano, Acre, Brasil. Os dados foram coletados percorrendo as trilhas em cada uma das áreas através de busca ativa entre 22 de novembro e 03 de dezembro de 2014. Foram comparadas DULTXH]DGHHVS«FLHVFRPSRVL©¥RHVWUDWLĆFD©¥RYHUWLFDOH guildas alimentares entre as áreas. Um total de 201 espécies foi registrado e a riqueza de espécies na área 1 foi de 145 espécies e a da área 2 foi de 142 espécies. O índice de Jaccard para a similaridade na composição de espécies entre as áreas foi de 42,8%. A comparação da distribuição de frequências das espécies por estrato não diferiu entre as áreas. A semelhança na composição de guildas entre as áreas pela análise de Bray- Page 112, Posters 81 r>-££-!1#'£;8!2ǣǡǡǦ|+1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS We tested the foliage palatability hypothesis that predicts avian insectivores will preferentially forage in tree species with the greatest abundance of their arthropod prey, which in turn are associated with the tree?s foliage nutrition and palatability. The hypothesis was tested in a novel Prosopis-Leucaena woodland LQ3XHUWR5LFRE\GHWHUPLQLQJIRUDJLQJSUHIHUHQFHVRIĆYH LQVHFWLYRURXVELUGVSHFLHVIRUVL[WUHHVSHFLHVĆYHDOLHQRQH native) and relating preferences to foliage arthropod biomass and leaf chemistry. The most frequently preferred tree species for foraging were the alien 3URVRSLVMXOLćRUD (preferred by ĆYHELUGVSHFLHVDQGDOLHQPithecellobium dulce (preferred by four bird species). Both species had high arthropod biomass, KLJK1FRQWHQWORZOLJQLQ1UDWLRVDQGORZKHPLFHOOXORVH content. Compounds, previously known to affect herbivore responses to Albizia lebbeck and Leucaena leucocephala, may explain low arthropod biomass despite high N content in Albizia and avoidance of Leucaena by 4 bird species despite its {փdփTT ID t ABSTRACT t ID t high arthropod biomass. The native Bucida buceras had tough leaves with low N content, low arthropod biomass, and only 1 bird species showed a weak preference for foraging in it. Some alien tree species had highly palatable foliage with high arthropod biomass and hence were preferred for foraging by avian insectivores as predicted. High foliage palatability of some alien tree species may weaken the effect of enemy release (i.e., alien species escape their specialized predators and parasites in a new environment) in novel plant communities. 82 ABSTRACT t Table of Contents com teia de aranha. Uma câmara incubatória rudimentar foi confeccionada com material mais delicado. As medidas dos ninhos foram: diâmetro externo - 85,0 e 93,0mm; diâmetro interno - 55,0 e 60,0mm; altura - 75,0 e 83,0mm e profundidade - 40,0 e 45,0mm. Apenas a fêmea construiu os ninhos. O SULPHLURQLQKRIRLĆ[DGRHPWU¬VUDPRVGHAcilepdopsis echitifolia, acima de uma poça rasa com 40cm de profundidade, distante 40cm da superfície da água. O segundo foi construído em um arbusto de Curatella sp., distante 2m do chão. Em cada ninho foram colocados dois ovos, com intervalo de um dia entre as posturas. Os ovos são branco-acinzentados, com manchas marrons e pretas, mais concentradas no polo maior. As medidas dos ovos (n = 2) foram: 20 x 16,9mm e 2,4g) e 21,1 x 16,6mm e 2,9g). Os ovos são semelhantes aos das demais espécies de Sporophila. O ninho possui características intermediárias aos dos caboclinhos, que são construídos com PDWHULDOĆQRHEDVWDQWHHQWUHOD©DGRFRPF¤PDUDLQFXEDWµULD evidente e dos coleirinhos e patativas, que fazem ninhos com paredes menos espessas e acabamento mais grosseiro. Biologia reprodutiva deSporophila maximiliani: descrição do ninho e ovos Cesar A. B. Medolago1*, Flvio Kulaif Ubaid1, Mercival Roberto Francisco2, Lus Fbio Silveira3 ǢW83+8!1!&'Õ9f+8!&<!3'1$3£3+-!''$<8939!;<8!-9T 2-='89-&!&' '&'8!£&'3!8£39TǣW'6;3&'-Í2$-!91#-'2;!-9 f2-='89-&!&' '&'8!£&'3!8£39f!16<9383$!#!TǤW'3&' 82-;3£3+-!T<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3 r$'9!81'&3£!+3|@!,33W$31W#8 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Muitas espécies do gênero Sporohila estão ameaçadas de H[WLQ©¥RHPYLUWXGHGDGHVWUXL©¥RGRK£ELWDWHGRWU£ĆFR O bicudo, Sporophila maximiliani, é a espécie do gênero mais ameaçada, com pouquíssimos registros recentes na natureza. Descrevemos aqui dois ninhos da espécie, provavelmente do mesmo casal, encontrados em dezembro de 2014 e janeiro de 2015 em uma área inundável no Estado do Mato Grosso, Brasil. Os ninhos possuíam forma de taça e foram construídos SULQFLSDOPHQWHFRPFDXOHVĆQRVHJDYLQKDVGHCassytha ĆOLIRUPHVDO«PGHIROKDVHLQćRUHVF¬QFLDVGHJUDP¯QHDVXQLGRV Page 113, Posters 83 Interactions network between frugivorous birds and plants in an Atlantic Forest area in southeastern Brazil Suelen B. M. Rodrigues1*, Bruna L. Gagetti1, Augusto J. Piratelli1 ǢW !8f!16<9383$!#! r9<'£'2#&'138!'9|,3;1!-£W$31 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS Studies on interaction networks are an important tool to understand ecological patterns and processes driving the complexity of a community. Some of these patterns are related {փdփTT ID t ABSTRACT t to the stability and suggest a key role played by generalist species having many interactions. This study aims to analyze a network of interactions between plants and frugivorous birds in different environments of Atlantic Forest in southeastern Brazil stressing the importance of generalist species in such a mosaic. The research was carried out in Carlos Botelho State Park (SP) in three areas (open area, initial and late successional stages), and records of interactions were performed by direct observation by transects, focal and camera traps. The network was represented by 52 species of birds and 13 species of plants, with a nested pattern (NODF = 38, p <0.001), with a low connectance (18%) and low average degree of species (9.38 and 2.35, plants and birds, respectively). The plant species having higher amount of interaction and frequency of visits were Miconia tristis and Myrsine guianensis, while Dacnis cayana, Camptostoma obsoletum, Ramphastos dicolorus and Tangara sayaca were the most interacting bird species. These VSHFLHVFRQWULEXWHGVLJQLĆFDQWO\WRWKHQHVWLQJRIWKHQHWZRUN showing their importance for the stability of the community. 84 Histórico do recebimento de Tyto furcatapela Polícia Militar Ambiental de Mossoró, RN Pedro T. S. M. Moura1*, Maxson C. A. S. Souza1, Liana M. P. C. Cavalcanti1, Leonardo F. F. Frana1 ǢW2-='89-&!&' '&'8!£<8!£&3'1-f8-&3 ID t ABSTRACT t Table of Contents em torno da espécie Tyto furcata é bastante conhecida devido aos inúmeros encontros com pessoas em áreas urbanas e semiurbanas. O objetivo aqui foi elucidar as principais causas do recebimento de indivíduos de T. furcata na Sede do 3º Pelotão de Proteção Ambiental de Mossoró-RN. Foram recebidos 11 exemplares da espécie entre abril e dezembro de 2014. Destes, seis eram ninhegos retirados dos ninhos em habitações, quatro foram vítimas de arma de fogo e um de envenenamento. Com H[FH©¥RGHXPGRVĆOKRWHVTXHIRLUHVJDWDGRHPORFRGHYLGRR estrutura do teto em que estava o ninho ter desabado, todos os outros foram entregues pela população no 3º PPAM. A espécie é responsável por cerca de 70% das ocorrências locais envolvendo aves de rapina. Nossos dados mostraram a remoção GHĆOKRWHVGRVVHXVQLQKRVHPHVWUXWXUDVDUTXLWHW¶QLFDV humanas como sendo a principal causa de entrada da espécies na instituição. Uma consequência do característico barulho SURYRFDGRSHORVĆOKRWHVHPEXVFDGRDOLPHQWRWUD]LGRSHORV pais. O preconceito com a espécie, principalmente devido ao mito da rasga-mortalha (nome local da espécie), deve ser a motivação para o segundo maior tipo de registro, sendo os adultos atacados com arma de fogo por serem mais esquivos à captura manual. Como é comum na relação entre o ser humano e aves de rapina, a falta de compreensão da biologia das espécies, de programas de educação ambiental e a ausência de planejamento das estruturas urbanas JHUDPFRQćLWRVIDWDLVSDUDRVLQGLY¯GXRVGHT. furcata. r6'&83;'3)£313<8!|+1!-£W$31 POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES 6¥RPXLWRVHDQWLJRVRVFRQćLWRVH[LVWHQWHVHQWUHDQLPDLV silvestres e humanos. Dentre eles, a problemática que gira Page 114, Posters {փdփTT ID t ABSTRACT t 85 Feeding habits of Harpia harpyja in the 1RUWKHUQ3DQWDQDOvVćRRGSODLQV%UD]LO ID t ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&'9;!&<!£ !<£-9;!TǣW2-='89-&!&'6!8!3'9'2=3£=-1'2;3&39;!&3'&! '+-3&3!2;!2!£TǤW29ধ;<;3 '&'8!£&'!;383993T$!16<9<-!#f '£!-9;!TǥW29ধ;<;3&'-3-Í2$-!9T2-='89-&!&' '&'8!£&'!;3 83993TǦW2-='89-&!&'&'<-!#TTӐW 329<£;38-! POSTER SESSION: DIET & TROPHIC INTERACTIONS The Harpy Eagle Harpia harpyja is a canopy predator of neotropical rainforests. The species diet has been described for the Amazon forest, the Brazilian Atlantic forest and the forest enclaves in the Cerrado. It’s presence was only recently FRQĆUPHGIRUWKH3DQWDQDO7ZRQHVWVLQWKH3DQWDQDOZHUH VWXGLHGIURPWRDQGWKHLGHQWLĆHGIHHGLQJLWHPVDUH presented herein. All prey remains and pellets were collected in the nest or bellow from Sep-Oct 2009, Jul and Oct-Nov 2010, Jan 2011, and Nov 2013. Skulls, mandibles, teeth, squeletons, claws, feathers, hair, beak and feet were used to identify prey to the lowest taxonomic level possible. Direct observation of preys that were carried to the nests were also source of information. Most of the collected material (80%) has been already LGHQWLĆHG3ULPDWHVUHSUHVHQWHGRIWKHLQGLYLGXDOV consumed. The most frequent prey was Alouatta caraya with 37% of all specimens (n = 50). Birds represented 16.3% of this sample, however only Ramphastos tocoKDVEHHQLGHQWLĆHG Other prey species were Sapajus cay, Coendou prehensilis, Page 115, Posters Table of Contents Caluromys philander, a young deer (Mazama sp.), rodents, as ZHOODVSULPDWHVDQGELUGVUHPDLQVQRW\HWLGHQWLĆHG'LUHFW observations showed Dasyprocta azarae brought alive to the nest. Male once used an Crypturellus undulatus or medium-size rail in pre-copulation courtship feeding. Most prey (90.7%) are arboreal species. Apparently, scarcity of food resources is not the main reason Harpy Eagle lack records in the Pantanal. Our results provide new information about the diet of the Harpy Eagle in a region where this top predator is poorly known. Flávio Ubaid1*, Luciana Ferreira2, Samuel Borges Oliveira Jr.3, Thiago Borges Fernandes Semedo4, Tafnys Hadassa da Cunha Ferreira5, Paulo de Tarso Zuquim Antas6 r*!=-3<#!-&|+1!-£W$31 ABSTRACT t 90 Límite de especies en el complejo Catharus occidentalis utilizando genes mitocondriales y nucleares. J. Santiago-García1*, B. E Hernndez-Baos1 ǢW<9'3&' 33£3+!£(3293W'88'8!T'6!8;!1'2;3 &'-3£3+!=3£<ধ=!T !$<£;!&&'-'2$-!9T2-='89-&!& !$-32!£<;231!&'Ì?-$3TÌ?-$3W TÌ?-$3W r+!8$-!i/'9<9(Ǣ|@!,33W$31W1? POSTER SESSION: SYSTEMATICS & TAXONOMY El principal objetivo de la delimitación de especies es el conocimiento de la diversidad biológica, por lo que en la última década los estudios basados con secuencias de DNA se han incrementado. Dichos estudios se están utilizando para explorar diferentes niveles taxonómicos, entre ellos a nivel HVSHF¯ĆFR%DMRHVWDVSUHPLVDVHQHVWHWUDEDMRXWLOL]DPRV secuencias de genes mitocondriales (ND2) y nucleares (ACOI-I9 y Ornitidina descorboxilasa) para explorar los límites de especies, en el zorzal endémico mexicano (Catharus occidentalis), e investigar el grado de estructuración genética poblacional, para así poder documentar la presencia de más de un linaje {փdփTT ID t ABSTRACT t evolutivamente independiente, ya que esta especie presenta dos poblaciones distribuidas alopátricamente a lo largo de los principales sistemas montañosos del país. Los resultados demuestran que la diferenciación genética es baja entre las poblaciones de la especie Catharus occidentalis, concluyendo que es posible que esta especie se encuentre por un proceso de estructuración poblacional, en vez de un proceso de especiación. En otros trabajos se ha encontrado el mismo patrón , por lo que especies que habitan en bosques templados presentan inicios de estructuración genética, sin embargo, existen otros trabajos en donde la diferenciación genética es alta y por lo tanto se han llegado a considerar que las especies estudiadas representan más de una especie diferente. 91 Aspectos reprodutivos do galo-da-serra (Rupicola rupicola, Linnaeus, 1766, Aves) no complexo do Maroaga e Iracema Falls, Presidente Figueiredo – AM Francisco N. Franco1*, Obed, G. Barros1, Rodrigo Giro1, Juliana, N. Moraes1 ǢW'2;832-='89-;8-3&338;'f r-1<;!#-£-9;!|@!,33W$31W#8 ID t ABSTRACT t Table of Contents ninhos ativos nos paredões, grutas e cavernas do Complexo Maroaga e de Iracema Falls. Os dados sobre comportamento foram obtidos a partir de observação direta realizado entre Junho e Outubro de 2010, neste intervalo foram realizadas varreduras para contagem e observação de ninhos ativos. Foram encontrados 19 ninhos no Complexo Maroaga e 4 ninhos em Iracema Falls e um total de 6 arenas para as duas áreas. Os ninhos encontravam-se tanto em fendas, em algumas cavidades dos paredões, assim como em cavernas e grutas e quase sempre associados à presença de um corpo d’água nas proximidades. Nas arenas, foi registrada um variação de 2 a 9 machos, estes apresentaram comportamentos de agressividade, denotando um alto grau de competitividade pelo domínio da arena, com o uso de asas, bicos, voos rápidos e vocalizações características para expulsar o competidor. As fêmeas quase não foram visualizadas nas arenas, mas foram observadas com maior frequência nos ninhos em períodos noturnos. Os aspectos descritos contribuem para o conhecimento do processo reprodutivo da espécie indicando uma forte seleção de fatores como paredões rochosos e presença de corpos d’água, indicando que estes ambientes devem ser protegidos para a manutenção da espécie. POSTER SESSION: NESTING BIOLOGY & REPRODUCTION O Galo-da-Serra (Rupicola rupicola Linnaeus,1766) é uma ave endêmica da Amazônia, que apresenta comportamento reprodutivo em sistema de “Lek” onde machos cortejam I¬PHDVXVDQGRDUHQDVHPćRUHVWDVGHFDPSLQDHGH FDPSLQDUDQDFRPVXEERVTXHPDLVDEHUWR$HVS«FLHQLGLĆFD em paredões rochosos ou em cavernas. Sendo assim, o objetivo deste estudo foi descrever o comportamento e a frequência GHVWDVDYHVHPDUHQDVDO«PGHYHULĆFDUDRFRUU¬QFLDGH Page 116, Posters {փdփTT ID t ABSTRACT t 97 3ULPHUUHJLVWURGHQLGLĆFDFLµQ\FDPELRVHQ la abundancia de Amazona aestivaen la Selva Pedemontana del Noroeste Argentino ID t r9$,!(W!£'/!2&83|+1!-£W$31 POSTER SESSION: HABITAT USE El loro hablador (Amazona aestiva) es una especie con amplia GLVWULEXFLµQHQ6XGDP«ULFD(Q$UJHQWLQDODHVSHFLHQLGLĆFD en huecos de árboles en bosques de la Región Chaqueña, mientras que en otoño e invierno se desplaza hacia la Selva Pedemontana de las Yungas Australes. En este estudio describimos un nido de Loro hablador y los cambios en abundancia en la Selva Pedemontana, en la provincia de Jujuy. Se estimó la abundancia en la estación seca y en la húmeda a través de transectas lineales y se inspeccionaron huecos en árboles en 100 ha con una minicámara adosada a un palo extensible de 15 m. El 14 de Noviembre del 2014 se encontró un nido de loro hablador en un hueco excavado por Campephilus leucopogon en un cebil colorado (Anadenanthera colubrina) con un adulto incubando huevos. El 2 de Diciembre en el nido encontrado se registraron dos pichones. El mayor número de individuos de loro hablador se registró en el mes de Agosto (n=321) y desde Octubre a Marzo disminuyeron las abundancias (x=10,33 - SD=11,18). La mayor abundancia registrada coincide con la época que la especie visita cultivos para alimentarse en la Selva Pedemontana. La menor abundancia en la estación húmeda coincide con los Page 117, Posters Table of Contents desplazamientos que la especie realiza hacia la ecoregión del Chaco para reproducirse. Sin embargo, nuestro estudio sugiere TXHWDPEL«QQLGLĆFDHQOD6HOYD3HGHPRQWDQD(VWHHVHOSULPHU nido documentado para esta especie en este tipo de bosque. Alejandro A. Schaaf1*, Analia Benavidez2, Luis Osvaldo Rivera2, Natalia Politi2 ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!&'</<@T329'/3 !$-32!£&'2='9ধ+!$-32'9-'2)[email protected]$2-$!9lm ABSTRACT t 99 Características de las cavidades en árboles y redes de interacciones aves-árboles en la selva Pedemontana de las Yungas Australes £'/!2&83W$,!!(ǢrT31!2<++'8!ǢT329;!2A!-=!2$3ǢT ='8!££'-ǢT<-99=!£&3-='8!ǢT!;!£-!3£-ধǢ ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!&'</<@T329'/3 !$-32!£&'2='9ধ+!$-32'9-'2)[email protected]Ì$2-$!9lm r9$,!(W!£'/!2&83|+1!-£W$31 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS Muchas aves de ecosistemas boscosos usan cavidades en £UEROHVSDUDQLGLĆFDUUHIXJLDUVHRDOLPHQWDUVH/DVSREODFLRQHV de estas aves suelen estar limitadas por la disponibilidad de cavidades y resultan sensibles ante cambios en la composición y estructura de los bosques provocados por actividades antrópicas. El objetivo de este trabajo es describir las características de las cavidades originadas por descomposición de la madera , de las excavadas por carpinteros y de la red de aves usuarias de huecos en árboles en un sector de selva Pedemontana de Jujuy, Argentina. En 100 ha encontramos 196 cavidades de descomposición en 163 árboles de 14 especies con un diámetro a la altura del pecho (DAP) de 44,2 ± 18,7 cm. Estas se encontraron mayormente en &DO\FRSK\OOXPPXOWLćRUXP (40,5%) y Phyllostylom rhamnoides (32,5%). Encontramos 50 cavidades excavadas en 40 árboles de 9 especies con un DAP de 52,90 ± 20,4 cm. La mayoría de las cavidades {փdփTT ID t ABSTRACT t excavadas se encontraron en Anadenanthera colubrina (34%) y &DO\FRSK\OOXPPXOWLćRUXP (20%). En total se registraron 103 interacciones entre 15 especies de aves y 12 árboles diferentes. &DO\FRSK\OOXPPXOWLćRUXP y los árboles muertos en pie presentaron la mayor cantidad de interacciones. Entender el rol que tienen ciertas especies arbóreas y los árboles muertos permitirá mejorar los lineamientos de manejo forestal y DVHJXUDUODFRQVHUYDFLµQGHODVDYHVTXHQLGLĆFDQHQKXHFRV Comentario del revisor: Precisa de una edicion mas adequada. 100 ,GHQWLĆFDWLRQRIGLVWLQFWJHQHWLFOLQHDJHVLQWKHFDSWLYH population of the endangered Crax blumembachii provide guidelines for ex-situ conservation Mariellen C. Costa1*, Crisley Camargo2, Luís Fábio Silveira3, Mercival R Francisco4 ǢW2-='89-&!&' '&'8!£&'3!8£39TǣW29ধ;<;3&'-3-Í2$-!9&' 3;<$!;<T2-='89-&!&'9;!&<!£!<£-9;!£-3&''97<-;! -£,3T 3;<$!;<TT8!A-£TǤW<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3T T3!<£3TT8!A-£TǥW'6!8;!1'2;3&'-Í2$-!91#-'2;!-9T 2-='89-&!&' '&'8!£&'3!8£39T!16<9383$!#!T383$!#!TT8!A-£ r1!8-'££'2W$39;!|+1!-£W$31 ID t ABSTRACT t Table of Contents programs were started independently during the 70s, and more than 220 animals have been released into the wild so far. In this study we analyzed 121 adult birds from four breeding facilities, using 8 microsatellite loci and Bayesian clustering methods. The results revealed two distinct groups that were in Hardy-Weinberg equilibrium and did not present VLJQLĆFDQWHYLGHQFHVRILQEUHHGLQJ+RZHYHURQO\RQHOLQHDJH has been successfully reproduced in captivity. The observed VWUXFWXULQJPD\UHćHFWIRXQGLQJHIIHFWEXWZHDOVRFDQQRW exclude the possibility that these populations were structured in the wild. We suggest that a combination of individuals from the two lineages, or admixted animals with high levels of heterozigosity should be used in future reintroductions. We also recommend animals not to be released in areas where the species still occurs naturally, in order to avoid disrupting potential genetic adaptive complexes. Importantly, the conservation of Crax blumenbachii depends on the preservation of Brazilian Atlantic Forest and coordinated efforts between breeding facilities, researchers and governmental authorities. 101 Key factors in nest-site selection in burrowing POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES parrot: implications for conservation Captive populations of endangered species are often small, isolated, and founded by a limited number of individuals, which makes them more susceptible to genetic drift and inbreeding effects. Thus, understanding the levels of population structuring and genetic variability is important for developing management strategies. The Crax blumenbachii is endemic to the Brazilian lowland Atlantic Forests and is considered extinct in most of its original distribution. Two captive breeding Myriam Ramírez Herranz1*, Renzo Vargas-Rodríguez1, Rodrigo Ros1, Enrique Novoa1, Francisco A. Squeo1 Page 118, Posters ǢW2-='89-;@3(!'8'2!T!'8'2!T,-£' [email protected],'88!2A|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Nest site selection is one of the main behaviors that affects the ĆWQHVVRIDQRUJDQLVPDQGbWKHSRSXODWLRQG\QDPLFV7KHUHIRUH {փdփTT ID t ABSTRACT t it is expected that birds rigorously evaluate the nesting site, GLUHFWLQJWKHLUFKRLFHVEDVHGRIELRWLFDQGbDELRWLFFRPSRQHQWV of the environment. Identifying these variables on endangered species such as Cyanoliseus patagonus bloxami, a subspecies of the Burrowing Parrot endemic to Chile, could help restore degraded reproductive habitats. The objective of the present study was to determine patterns of selection of reproductive UDYLQHVDQGbLGHQWLI\YDULDEOHVPRVWVWURQJO\UHODWHGWRWKLV selection. We characterize all ravines present at Los Choros´s creek, Region of Coquimbo (Chile), where we evaluated HQYLURQPHQWDOPRUSKRORJLFDODQGbELRORJLFDOYDULDEOHV The results indicated that reporductive ravines have south RULHQWDWLRQbPHDQ rsrFGV5 S ,Q DGGLWLRQUHSURGXFWLYHUDYLQHVKDGPRUHDUHDDPRUHVSHFLĆF VXEVWUDWHDQGbZHUHIDUWKHVWIURPDQWKURSRJHQLFGLVWXUEDQFHV than non-reproductive ravines,especially in ravines with higest QXPEHURIQHVWb7KHbUHSURGXFWLYHUDYLQHbVHOHFWLRQbSDWWHUQ can be an important tool, in possible habitat disturbance scenarios of the burrowing parrots, to mitigate the effect of productive activities in their breeding areas. 103 Banding and Recovering of Scarlet Ibis Eudocimus ruber in Babitonga Bay, North Coast of Santa Catarina State, Brazil ID t ABSTRACT t Table of Contents the estuary of Babitonga Bay, north coast of Santa Catarina state. The species built their nests in a mixed colony. This study aimed to tag chicks of Scarlet ibis using color bands and get information about distribution through visual recoveries. For three breeding seasons we captured manually the chicks: FDWFKHVLQFDWFKHVLQDQG FDWFKHVLQ:HWDJJHGFKLFNVDQGFRQGXFWHG surveys along the estuary to detect the individuals. We recorded 30 visual recoveries in this period. Twenty seven records of young birds (between 10 days and 9 months old) were made near the colony. Three records were made by collaborators on the coast of São Paulo state. One individual with nine months old was recorded in Cananéia city, 180 km (straight line) from the colony. Other two records were made in Praia Grande city, 350 km (straight line) from the colony. These animals were one young with 11 months, and another with 10 months old. Banding average was 36 per year, and the recovery rate 29% on period. The majority (80%) of the recoveries were near the colony, where they probably stay the ĆUVWPRQWKVRIWKHLUOLIH/RQJGLVWDQFHUHFRYHULHVGHPRQVWUDWH that the species conducts large displacements. This behavior, combined with continued population growth, contribute with the restocking of this species, including southern Brazil. Alexandre V. Grose1*, Marta J. Cremer2, Nei Moreira1 ǢW TǣW r!£'W+839'|,3;1!-£W$31 POSTER SESSION: DIVERSITY & DISTRIBUTION Scarlet-Ibis (Eudocimus ruber) occurred along the coast of Brazil, but remained extinct for about 150 years in Santa Catarina state. In 2011, the species was observed again in Page 119, Posters {փdփTT ID t ABSTRACT t 105 Latitudinal variation in life history strategies of Tyrannus savana: The relationship between reproduction and migration ID t ABSTRACT t Table of Contents 107 Cartilagines membranose in Furnariida (Tyranni, Passeriformes): a new feature for the Tracheophone syrinx Vanesa Bejarano1*, Alex Jahn1, Diego Tuero2 Ana Galvo1*, Luiz P. Gonzaga1 ǢW'6!8;!1'2;3&' 33£3+-!T2-='89-&!&'9;!&<!£!<£-9;!-3£!83TǣW '6!8;!1'2;3&'$3£3+!T'2ধ[email protected]=3£<$-2T2-='89-&!&&'<'239-8'9' 29ধ;<;3&'$3£3+!T'2ধ[email protected]=3£<$-2&'<'239-8'9lmT ǢW2-='89-&!&' '&'8!£&3-3&'!2'-83 r=!2'9!W#'/!8!23|+1!-£W$31 POSTER SESSION: MIGRATION Understanding the mechanisms that drive the geographic variation in reproductive investment and success of migratory birds at tropical and south-temperate latitudes could generate new knowledge about life history theory in general and a better understanding of the risks different bird populations face across the planet. We are studying population-level variation in life history strategies of migratory Fork-tailed Flycatchers (Tyrannus savana) at different latitudes, in Argentina and Bolivia and in the state of São Paulo, Brazil. Our objective is to determine the mechanisms that determine reproductive success between latitudes, testing whether time of arrival in spring at the breeding site affects reproductive investment and success more than local factors such as food availability and nest microhabitat. Through daily monitoring of nests, census of nest predators and sampling of arthropods, we found higher FOXWFKVL]HVDWKLJKODWLWXGHVEXWQRVLJQLĆFDQWGLIIHUHQFHLQ reproductive success between latitudes, even though food availability is higher at higher latitudes. Food availability may explain most of the latitudinal variation in clutch size. The next phase of this research includes incorporating spring migration timing, as well as life history data and nest site characteristics, to explain variation in reproductive success and investment. Page 120, Posters r!+!£=!3|#-3£3+-!W<(8/W#8 POSTER SESSION: MORPHOLOGY The Cartilagines membranose are two paired thin cartilages, embedded in the ventral and dorsal regions of the left and right syringeal Membranae tympaniformes mediales. Despite known for many passerine taxa (both oscines and suboscines), these small structures remain unreported from the Furnariida, which is recognized for its distinctive Tracheophone syrinx. Our aim was to report the occurrence and describe the morphological variation of these cartilages among the Furnariida. We analysed 128 syringes, including 55 species representing the 10 families, 12 subfamilies and seven tribes of this parvorder. The Cart. membranosa dorsalis is present in all taxa except Formicarius. Its shape varies, being found as a straight stripe, a falciform bar or an ellipse (the last being typical to Melanopareia). This cartilage shows different degrees of development, varying both in extent and in thickness, from a thin and small stain (eg. Thamnophilus) to a protuberant and widely spread nodule (eg. Furnarius). On the other hand, the Cart. membranosa ventralis is not so widely distributed among taxa neither so variable: it is restricted to some taxa within Melanopareiidae, Thamnophilidae, Grallariidae, Dendrocolaptidae and Furnariidae, and its shape is always a tiny elongated ellipse. Both cartilages may be fused together, in association with the Ligamentum interbronchiale, as observed in some species of Dendrocolaptidae and Furnariidae. The discovery of {փdփTT ID t ABSTRACT t these structures in the relatively well known Tracheophone syrinx reveals a promising source of potentially informative phylogenetic characters, and highlights that even a traditionally studied bird organ can still conceal unknown features. 109 Estimación de supervivencia aparente para Manacus vitellinus(Pipridae) en Campo Chagres, Parque Nacional Chagres, Panamá ID t ABSTRACT t Table of Contents con el único estudio previo realizado en el Parque Nacional Soberanía en Panamá para M. vitellinus de ~0.47 (sin corrección de transitorios). Al igual que otros estudios, nuestros resultados concluyen que las primeras estimaciones de supervivencia que produjeron valores muy altos (>80%), no son representativas para todas las especies tropicales, ya que éstas estimaciones varían entre especies y sitios. Nuestros resultados contribuyen al conocimiento sobre las estimaciones de la tasa supervivencia SDUDVDOWDULQHVGHWLHUUDĆUPH\HQHVSHFLDOSDUD3DQDP£ Katherine Araz-Ponce1*, Viviana Ruiz-Gutierrez2, Karla Aparicio ǢW9$<'£!&'-3£3+!T2-='89-&!&<;231!&',-8-7<T ǣ[email protected]<2;!-2-8	'8=!;[email protected] r!8!<A01|+1!-£W$31 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY /DVHVWLPDFLRQHVGHWDVDVGHPRJU£ĆFDVSDUDDYHV 1HRWURSLFDOHVVRQSRFDV\VHHQFXHQWUDQJHRJU£ĆFDPHQWH y taxonómicamente limitadas. Se estimó la tasa de supervivencia para Manacus vitellinus en un bosque caducifolio y semicaducifolio de 12 hectáreas en Campo Chagres, Parque Nacional Chagres en Panamá. Generamos historiales de captura-recaptura utilizando datos del 2007 al 2011 de una estación del programa de Monitoreo de Supervivencia Invernal 0R6,$QDOL]DPRVORVGDWRVXWLOL]DQGRODPRGLĆFDFLµQGH tiempo desde marcamiento (TSM) del modelo general de Cormark-Jolly-Seber en el Programa MARK. El modelo TSM se acopla bien a datos de anillamiento de aves en el trópico, ya que corrige el efecto de individuos transitorios, para que las probabilidades de supervivencia no sean subestimadas. Analizamos 53 individuos anillados en Diciembre para cuatro ocasiones de captura. La probabilidad estimada de supervivencia para M. vitellinus fue de ~0.46. Este valor coincide Page 121, Posters 111 New and noteworthy bird records for Rondonia state, southwestern Brazilian Amazonia, with comments on range extensions of some species Fernando, A. Valerio1*, Marcelo, F. Vasconcelos2, Rodrigo Morais2, Luiz, G. Mazzoni2, Eduardo, J.c Gazzinelli2, Alyne Perillo2, Augusto Alves2, Leticia, F. Pedroso2 ǢW'6!8;!1'2;3&'-3£3+-!2-1!£T2-='89-&!&' '&'8!£&'-39!TǣW<9'< &'-'2$-!9!;<8!-9T32ধ($-!2-='89-&!&'!;3£-$!&'-2!9'8!-9 r(W=!£'8-3$!8=!£,3|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS The hydrographic basin of the Madeira River is one of the richest ornithological regions in the world, however knowledge on distribution of several species is still scarce even with inventories already performed. We present new and noteworthy bird records for this state, which were documented by recording of vocalizations, photographs and specimens (deposited in the Ornithological Collection of the Museum of Natural Sciences of PUC Minas). The studies were carried out in the municipality of Porto Velho, {փdփTT ID t ABSTRACT t between September 2012 and June 2014. New and rare ornithological records were present for both banks of the Madeira River: Micrastur buckleyi, Clytoctantes atrogularis, Hylopezus whittakeri, Chamaeza nobilis, Automolus melanopezus, Synallaxis albigularis and Periporphyrus erythromelas. We also comment on range extensions of each species. 112 The overlooked Ornithological Collection of the Museum of Natural Sciences of PUC Minas Marcelo F. Vasconcelos1*, Fernando, A. Valerio2, Luiz, G. Mazzoni1, Alyne Perillo1, Rodrigo Morais1, Leticia F. Pedroso1, Paula Rodrigues1, Filipe, A. Aramuni1 ǢW<9'<&'-'2$-!9!;<8!-9T32ধ)$-!2-='89-&!&'!;3£-$!&'-2!9 '8!-9TǣW'6!8;!1'2;3&'-3£3+-!2-1!£T2-='89-&!&' '&'8!£&'-39! r1(=!9$32$'£39|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY The Ornithological Collection of the Museum of Natural Sciences of PUC Minas (MCNA) is one of the least known in the country, never mentioned in any review of the Brazilian collections of birds. Nevertheless, MCNA holds 4,328 VSHFLPHQVRIWD[DRIZKLFKDUHLGHQWLĆHGDWVSHFLHV OHYHO7KLVFROOHFWLRQSUHVHQWHGDVLJQLĆFDQWLQFUHDVHLQ specimens during the last four years, when 2,479 specimens (more than 55% of the total) were included. The collection has the largest geographical representation of the Brazilian states of Minas Gerais (MG), Rondonia (RO) and Para (PA). The MCNA has the largest osteological collection of MG and is one of the most important in Brazil, holding skeletons of rare species that are not represented in any other collection in the world. The entire collection is data digitalized, based on Page 122, Posters ID t ABSTRACT t Table of Contents the last nomenclatural revision of the Brazilian Committee of Ornithological Records. Recently, the collection has been visited by Brazilian and foreign researchers. 113 Implicâncias e ameaças na riqueza e distribuição de aves do Chaco paraguaio Romina Cardozo1*, Ricardo B. Machado1 ǢW2-='89-&!&'&'8!9£-! r2!&-!831-2|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION O Chaco paraguaio, que faz parte da diagonal de formações abertas de América do Sul, é dividido em cinco ecorregiões: Chaco húmido, Chaco seco, Pantanal, Médanos e Cerrado. Essa variedade de ambientes permite a existência de uma grande diversidade de aves na região. A expansão do cultivo GDVRMDHLQWHQVLĆFD©¥RGDSHFX£ULDW¬PSURYRFDGRXPD grande ameaça à biodiversidade local. O objetivo da pesquisa foi gerar mapas de riqueza de aves para as ecorregiões Alto Chaco, Matogrosense e Bajo Chaco e avaliar as pressões causadas pelos desmatamentos. Os mapas de riqueza foram baseados em pontos de ocorrência das espécies disponíveis em bases de dados online, na literatura e em instituições DPELHQWDLVGR3DUDJXDL$VSODQLOKDVIRUDPĆOWUDGDVH ordenadas utilizando o software R e os pontos e mapas foram trabalhados no software ArcGis 10.2.1. Das 715 espécies de aves que ocorrem no Paraguai, 501 habitam o Chaco paraguaio. Os resultados sugerem uma alta riqueza de aves em cada UHJL¥RRUQLWRJHRJUDĆFDRTXHHYLGHQFLDDLPSRUW¤QFLDGD conservação do Chaco para conservação das aves do corredor de savana de América do Sul. As mudanças da cobertura da {փdփTT ID t ABSTRACT t terra e principalmente o aumento do desmatamento no Chaco paraguaio são as principais ameaças de perda de hábitat e que LQćXHQFLDPQDGLVWULEXL©¥RHULTXH]DGDVDYHV5HFRPHQGDVH realizar pesquisas de campo para atualizar as bases de dados de aves do Paraguai e promover novos sítios de amostragem. 115 Modulariy in plants-frugivore birds network associated to sequential fruiting of congeneric species Adriano Marcos Silva1*, Pietro Kiyoshi Maruyama2, Lus Pedro Mendes Paniago1, Celine Melo1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-!TǣW2-='89-&!&'9;!&<!£&'!16-2!9 r!&8-!23W#-3£3+-!|@!,33W$31W#8 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS (FRORJLFDODQGHYROXWLRQDU\IDFWRUVLQćXHQFHWKHSUHVHQFH of modules in species interaction networks. Although modules might be expected at different hierarchical levels, evidences of modularity in plant-frugivore networks are still lacking. We tested whether the interaction networks formed by frugivorous birds and Miconia plants are modular and evaluated how modules were divided. To do so, we used four networks of Miconia and their frugivorous birds (three from Brazilian Cerrado and one from a rainforest in Panama). We TXDQWLĆHGPRGXODULW\XVLQJELQDU\DQGZHLJKWHGDOJRULWKPV and also tested the relationship between bird traits (body mass, frugivory level, migratory behavior and phylogeny) in relation to within and among-module connectivity indices. If considering only binary information, networks did not present distinct modular structure. Nevertheless, by including interaction strength, modules can be detected in all four Miconia - birds networks. None of the bird traits, however, Page 123, Posters ID t ABSTRACT t Table of Contents were related with the connectivity indices. The possible ćXFWXDWLRQRIIUXJLYRURXVELUGVDEXQGDQFHVFRXSOHGZLWKWKH DV\QFKURQLFIUXFWLĆFDWLRQRIMiconia might favor the formation of temporal modules comprising birds and plant species with phenological overlap, ensuring the seed dispersal and facilitating the coexistence in sympatry. Bird traits had little effect in the role that each species play within the modular network, probably because the frugivorous assemblages were dominated by small-bodied and opportunistic species, with small trait variation. Support: FAPEMIG, CAPES. 118 The puzzling call repertoires of Neotropical and Neartic Jays Gabriel L. M. Rosa1*, Luiz dos Anjos1 ǢW2-='89-&!&'9;!&<!£&'32&8-2! r+W839!W#-3|+1!-£W$31 POSTER SESSION: BIOACOUSTICS Social in essence, corvid call repertoires provide useful information about several aspects of their sociality. Unlike typical passerines, which commonly have simple call repertoires and complex songs, corvids usually have complex call repertoires and a very low intensity, although extremely complex song. Among corvids, there are 37 spp. endemic to the American continent, those are called the New World Jays (NWJ). Call repertoire descriptions are available for only 12 of these species, and for the remaining 25 information is scarce or absent. Since Hardy (1969, The Condor 71) no attempts of wide comparison among corvids were made. Therefore, we present here the known call repertoires of the NWJ, except for Aphelocoma, and propose a preliminary assessment on function and acoustic structure variation of {փdփTT ID t ABSTRACT t the non-described call repertoires. We revised the available literature and examined 1383 recordings (31h) containing calling sequences of NWJ, mostly obtained from sound collections. We listed all distinguishable call types by visual LQVSHFWLRQDVVLVWHGE\VSHFWUDOFURVVFRUUHODWLRQĆHOG observations, and behavioral notes provided by the authors of most recordings, estimating the most likely functions of nondescribed calls. We described the basic repertoire structure for most species, although more sampling is necessary for a more complete assessment of the NWJ call repertoires. We found that several classes of calls are shared among groups of species and address potential questions to be answered. We make here a call for collaboration among Neotropical ornithologists to pursue an even more detailed review on the puzzling NWJ acoustic communication and sociality. 120 Diet Composition of Cerulean Warbler (Setophaga cerulea) Nestlings Sasha A. Auer1*, Jennifer R Wagner2, Kevin W Barnes1, Kamal Islam1 ǢW!££;!;'2-='89-;@TǣW-8+-2-!3£@;'$,2-$29ধ;<;'!2&;!;'2-='89-;@ ID t ABSTRACT t Table of Contents decade, Cerulean Warbler offspring diet has not been studied. We determined the prey types (insects and arachnids) that Cerulean Warbler parents fed their young over the 20112013 breeding seasons and compared the proportions of GLIIHUHQWSUH\W\SHVWRSUH\DYDLODELOLW\:HLGHQWLĆHGD total of 351 prey items (n =34 in 2011, n =17 in 2012, and n =300 in 2013) at 24 nests. Although the proportion of Lepidoptera larvae (caterpillars) deliveries varied annually and seasonally, caterpillars were the most frequently delivered prey item. Caterpillar availability decreased and noncaterpillar prey deliveries increased proportionally during the latter part of the breeding season. Non-caterpillar prey items included Orthoptera, Diptera, Neuroptera, Arachnida, Coleoptera, Hemiptera and Phasmida. Many songbirds rely on an abundant supply of caterpillars to raise their young, and their nesting phenology has evolved to coincide with peaks in abundance of caterpillars. These species may be particularly prone to the effects that changes in vegetation composition and climate likely have on the life cycle and abundance of their food source and these effects may QHJDWLYHO\LQćXHQFHWKRVHVRQJELUGVèUHSURGXFWLYHVXFFHVV r9!9,!!<'8|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION The Cerulean Warbler (Setophaga cerulea) is one of the fastest declining Nearctic-Neotropical wood warblers, decreasing at a rate of approximately 3% per year. It is listed as a species of concern in the United States and as endangered in Canada. Population declines are primarily due to habitat loss in the eastern U.S. and on the wintering grounds in South America. Despite a substantial increase in research during the past Page 124, Posters {փdփTT ID t ABSTRACT t 122 Desplazamientos del Mirlo de Agua (Cinclus schulzi) en Yala, Jujuy, Argentina Rodrigo Aroz1*, Pedro G. Blendinger2, Natalia Potili1, Luis O. Rivera1 ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!9</<@lmW TǣW29ধ;<;3&'$3£3+!'+-32!£W ID t ABSTRACT t Table of Contents GHHOORVĆHOHVDOVLWLRGHLQYLHUQR3DWURQHVGHGHVSOD]DPLHQWRV similares han sido descripto para otras especies del género en las que sólo se desplaza parte de la población. 123 Fenología de cría de un nido de Águila Poma r83&8-+3i!8!3AӑǤ|,3;1!-£W$31 (Spizaetus isidori) en Argentina POSTER SESSION: MIGRATION Rodrigo Aroz1*, Juan Manuel Grande2, Joaqun Cereghetti2, Carmen Lopez2 Cinclus schulzi es una especie categorizada como Vulnerable, endémica de los bosques montanos de las Yungas Australes de Argentina y Bolivia, asociada a ríos de montaña y la menos conocida de la familia Cinclidae. La investigación sobre los desplazamientos y territorialidad de esta especie es importante para formular estrategias de conservación. Estudiamos sus movimientos en el río Yala, Jujuy, Argentina entre los 1500 y 1900 msnm. Desde Julio de 2013 a Octubre de 2014, capturamos individuos con redes de niebla y los marcamos con un código de anillos de colores. Luego se regresó al lugar para registrar la posición de los individuos marcados. Se capturaron 12 individuos en 2013 y 10 en 2014 y se registraron 97 recapturas visuales cada una fue georeferenciada. Cuatro individuos que crían en el sitio de estudio permanecieron en sus territorios todo el año (de 3-11 recapturas) mientras 8 individuos en 2013 y 10 en 2014 sólo fueron observados entre mayo y septiembre (1-10). Dos invernantes recapturados por última vez en septiembre de 2013 fueron recapturados en junio y agosto de 2014. A partir de mayo de 2014 aparecieron nuevos individuos en el área de estudio que dejaron de detectarse a partir de septiembre. Llegamos a la conclusión de que Cinclus schulzi es una especie que tiene individuos residentes, otros invernantes con algunos Page 125, Posters ǢW'2;83&'2='9ধ+!$-32'[email protected]!29('8'2$-!9</<@lmWTǣW'2;83 6!8!'£9;<&[email protected]'8=!$-2&'£!9='9!6!$'9'28+'2ধ2!T !$<£;!& &'-'2$-!9?!$;[email protected]!;<8!£'9T2-='89-&!&!$-32!£&'!!16! r83&8-+3i!8!3AӑǤ|,3;1!-£W$31 POSTER SESSION: BEHAVIOUR El águila poma es una de las rapaces neotropicales menos conocidas. Esta categorizada como amenazada y se distribuye desde el noroeste argentino hasta Colombia y Venezuela. Se conoce poco de su fenología en el norte de su distribución y prácticamente nada en el sur. La puesta en Colombia es en abril y la eclosión en mayo, aunque esto parece variar. En Bolivia un nido tenía un huevo en Mayo de 1936. El 17 de febrero de 2014 encontramos el primer nido de Águila Poma para Argentina. Realizamos 65 horas de observación y se colocó una cámara trampa en el nido. El 11 de febrero de 2014 el pichón del año anterior permanecía con los padres que ya suministraban material al nido para el siguiente evento reproductivo. El acondicionamiento del nido fue más intenso DPHGLDGRVGHDEULO$ĆQHVGHDEULOSULQFLSLRVGHPD\RVH observaron 4 cópulas en 7 horas de observación. La puesta fue entre el 27 de Mayo y el 4 de Junio y la eclosión el 9 de julio. Una vez eclosionado los adultos rellenan el nido con material, {փdփTT ID t ABSTRACT t formando una plataforma que terminan cuando el pichón tiene poco más de un mes. Los adultos aportaron material fresco desde Febrero hasta los primeros días de Noviembre. El pichón está en condiciones de volar a mediados de octubre, pero permanece cerca del nido, y es alimentado por sus padres GHQWURGHOPLVPRKDVWDĆQHVGHQRYLHPEUH)LQDOPHQWHHO pichón permanece con los padres hasta mediados de febrero. 124 Conservation status of diurnal raptors in Venezuela Adrián Naveda-Rodríguez ID t ABSTRACT t Table of Contents of strict protected (SPA) areas in the conservation of birds of prey. EOO ranged from 10,423 km2 to 907,223 km2, AOO values ranged from 6,566 km2 to 903,193 km2; four VSHFLHVPHWWKH%FULWHULRQDQGZHUHUHFODVVLĆHG7KHJDS analysis revealed that the representation of species EOO and AOO within SPA had mean values of 20% and 24%, respectively. In theory, SPA are assuming an effective role in the protection of species geographic distribution. Raptor conservation in Venezuela must be thoroughly planned, territorial re-ordering to enhance the connectivity among SPA would improve the protection of birds of prey. !>03<2;!-2!2$;<[email protected],''8'+8-2' <2& !&8-!2W2!='&!|+1!-£W$31 POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES Natural history data are crucial for extinction risk assessment. This information is non-existent for almost all species of raptors in the Neotropics. Here, I evaluate the conservation status of 64 species of diurnal raptors in Venezuela based on extent of occurrence (EOO) and area of occupancy (AOO) derived from geomatic-based geographic distribution modeling and gap analysis. I modeled the geographic distribution of raptors species to quantify distribution areas using the maximum entropy modeling techniques with 6271 presence records (3988 from Venezuela, 2283 from Brazil, Colombia, Ecuador, French Guyana, Guyana, Panama), nine environmental YDULDEOHVWKDWZHUHEHOLHYHGWRLQćXHQFHWKHJHRJUDSKLF distribution of raptors. EOO and AOO were used to re-evaluate the conservation status of diurnal raptors in Venezuela, applying Criteria B of the IUCN Red List. Furthermore, a gap analysis was performed to evaluate the effectiveness Page 126, Posters 125 Geographic patterns of species richness of diurnal raptors in Venezuela Adrián Naveda-Rodríguez1,2*, Keith L. Bildstein1, F. Hernn Vargas2 ǢW!>03<2;!-2!2$;<[email protected]ǣW,''8'+8-2' <2& r!&8-!2W2!='&!|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS Knowledge of a species’ geographic distribution is crucial to assessing its vulnerability. It is also important to know if protected areas provide effective protection for raptor species. Here, we examine the species richness (S) patterns, factors predicting S and the effectiveness of protected areas (EPA) in the conservation of diurnal raptos in Venezuela. We modeled geographic distributions (SDM) of 64 raptor species using ENM. Nine climatic and seven landscape metrics were used as environmental predictors. SDM were stacked to examine S and predictors of S were investigated using regression models. This study evaluated S patterns in the 13 bioregions {փdփTT ID t ABSTRACT t GHĆQHGIRU9HQH]XHOD$JDSDQDO\VLVZDVSHUIRUPHGWR evaluate the EPA in the conservation of raptor diversity. 40 species showed a continuous distribution, whereas as disjunct distributions were observed in 24 species. S differed among bioregions; six pairwise compared bioregions did not show differences. Highest S values were located in the Guayana Massif and the mountains of northern Venezuela. 6ZDVH[SODLQHGPDLQO\E\ODQGVFDSHIHDWXUHVVSHFLĆFDOO\ canopy height, land cover and terrain slope. Environmental heterogeneity affected the distribution of S and is therefore important in conservation planning for Neotropical raptors. Responses from environmental variables used to predict S were scale-dependent; it is necessary to standardize PHWKRGVH[SHULPHQWDOGHVLJQWRVWXG\WKHELRJHRJUDSK\ of raptors. Priority-setting for the conservation of raptor in Venezuela must consider restricted range species, even if they are not threatened. A territorial re-ordering is urgent to improve the protection of this group of birds. 127 Effect of human disturbance on two waterbird species in an estuary of Central Chile Mara Anglica Vukasovic1*, Cristin F. Estades1 ǢW2-='89-&!&&',-£' ID t ABSTRACT t Table of Contents migratory species. However, the very same factors that favor birds, also attract many humans that come to these ecosystems ORRNLQJIRUĆVKDQGUHFUHDWLRQDPRQJRWKHUXVHV6LQFH 2010 we have been monitoring populations of the American Oystercatcher (Haematopus palliatus) and the Black Skimmer (Rynchops niger) at the estuary of the Itata river, Central Chile FDPSDLJQV\HDUFHQVXVHVRQFRQVHFXWLYHGD\VFDPSDLJQ On the same dates we also have recorded different variables related to the level of human activity (number of: people RQWKHEHDFKGXQHVSHRSOHLQWKHZDWHURIIURDGYHKLFOHV FDWWOHKRUVHVDQGGRJV$GGLWLRQDOO\GXULQJWKHEUHHGLQJ seasons of 2013 and 2014 we monitored the Oystercatcher nests (and banded some nestlings) located in the dune area south of the river. There was an important increase in the KXPDQDFWLYLW\GXULQJWKHĆYH\HDUVRIVWXG\8VLQJD*/0 (accounting for seasonality and temporal autocorrelation) we found that the abundance of Black Skimmers was negatively associated to the number people in the water (bathers and ĆVKHUPHQ+RZHYHUZHGLGQRWĆQGDQ\VXFKHIIHFWRQ the numbers of Oystercatchers. The fact that we observed very little recruitment of the later species (most nests were destroyed by off-road vehicles and cattle) suggests that this population may be acting as a sink. Our results highlight the need to regulate the human use of estuaries in Chile. r1=<0!93=-$|<$,-£'W$£ POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Estuaries are key habitats for many waterbirds because of their high productivity and strategic location along coasts, which makes them particularly important as stopover sites for Page 127, Posters {փdփTT ID t ABSTRACT t 133 Nest architecture, patterns of nestling growth and parental behavior in the Fire-eyed Diucon (Xolmis pyrope) in north-central Chile Rodrigo A. Vsquez1*, Esteban Botero-Delgadillo1 ǢW2-='89-&!&&',-£' r8=!97<'A|<$,-£'W$£ POSTER SESSION: BEHAVIOUR Although a recent work in central Chile provided detailed descriptions of the breeding phenology and patterns of nestling growth in the Fire-eyed Diucon (Xolmis pyrope), the available information on its breeding ecology is still geographically limited, being mostly localized on the south-central part of its distributional range, thus limiting the possibility to generalize if such breeding patterns are common to its HQWLUHUDQJH%DVHGRQĆYHQHVWVIRXQGGXULQJ at the Fray Jorge National Park, Chile, at the northernmost limit of its distribution, we present new ecological data to compare with information from previously studied localities. Most nests showed a similar architecture and construction materials as nests reported in central populations, but we found some structural differences related with the local nesting habitat, suggesting that nest variation could be caused by availability of local materials and not by population differences. Nestling growth rates showed that at least during 2014, nestling development was slower in Fray Jorge than in central Chile, but further study are necessary to FRQĆUPLIWKLVLVDFRQVHTXHQFHRIDJURZWKUDWHODWLWXGLQDO gradient or local effects causing retarded development. Video recording of the entire nestling period showed that both parents attend the nest and that the number of visits, and the Page 128, Posters ID t ABSTRACT t Table of Contents rates of feeding and fecal sacs removal tended to increase as the nestlings grew. We also found that parents can feed ćHGJOLQJVGXULQJWZRZHHNVRUPRUHDIWHUćHGJLQJDQGWKDW a family can cover an area of ca. 2.3 ha during daily foraging. 135 Community of birds visiting salt licks at the lower Purus River in the Brazilian Central Amazon Carolina Bertsch1*, Marina A. R. M. Vieira1 ǢW29ধ;<;3-!+!< r&!<#'2;32-|+1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY Salt licks are spatially limited sites where animals may go to ingest soil (geophagy), drink water or hunt. Geophagy has EHHQGRFXPHQWHGIRUELUGVPDLQO\IRUKHUELYRUHVIUXJLYRUHV species such as parrots, pigeons, cracids and grouses), and its function is thought to be detoxication, cytoprotection, digestion facilitator and as a dietary source of additional vitamins and minerals. Documenting the diversity of species at salt licks gives an indication of their importance within the area, which could help focus future land management decisions. Salt licks are also key areas of special management by local hunters, as it has been previously documented in the SDR Piagaçu-Purus. Here we describe avian community (species richness and visitation rates) visiting two types of salt licks: natural (hereafter “NSL”) DQGDUWLĆFLDOPDQPDGHZLWKUHĆQHGVDOWLQSXWRUê$6/ëRQHV A camera-trap survey was conducted in 15 active hunting salt licks (7 ASL and 8 NSL) between April 2014-March 2015. Sampling effort was of 1033 camera trap*days (646 in ASL and 387 in NSL). Twelve salt licks had a total of 81 independent avian records, being the vast majority of them (80%) in natural {փdփTT ID t ABSTRACT t salt licks. Avian capture success was almost 9 times higher in QDWXUDOWKDQLQDUWLĆFLDOVDOWOLFNVZKLFKFRXOGEHH[SODLQHGE\ differences in mineral composition and habitat characteristics in both types of salt licks. Cameras recorded at least 15 species of birds, being the most frequent: Mitu tuberosa, Aramides cajanea, Leptotila rufaxilla and Psophia leucoptera. This diversity of avian species using salt licks, probably for mineral ingestion, highlights the importance of those areas for birds as well. 138 Habitat Fragmentation and Species Richness of Wetland Birds: at a Local and Landscape Scale Carol Cerda-Pea1*, Jaime R. Rau2 ǢW2-='89-&!&&'39!+39TǣW!#38!;38-3&'$3£3+!T'6!8;!1'2;3&' -'2$-!9-3£+-$!9{-3&-='89-&!&T2-='89-&!&&'39!+39T!16<993823 ID t ABSTRACT t Table of Contents the total studies undertaken (n= 37). Also, it was found that larger areas contain more species, according to the theory of Island Biogeography. The mechanism underlying this pattern has not been totally determined, but the area per se K\SRWKHVLVKDELWDWKHWHURJHQHLW\DQGELUGVSHFLHVVSHFLĆF UHTXLUHPHQWVZRXOGEHWKHPRVWVLJQLĆFDQWPHFKDQLVPV where area-dependent species would be responsible for this pattern. Community structure is one of the least studied features; despite this, it seems that there is a nested structure of the composition of waterbird species associated with this type of environment, where the smaller fragments are poor fractions of the large ones. This phenomenon can be extended at both local and landscape scale, which would allow us to identify important colonization areas, therefore of conservation interest according to the theory of Island Biogeography. r$!83£$'8&!W6'!|!£<1239W<£!+39W$£ POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES The area is considered one of the most important factors determining the presence and species richness in wetland fragments, including waterbirds, but do not know how accepted is this. So the aim of this review was to assess the area-species richness relationship of birds in wetlands at a local and landscape scale, also the existence of a nested structure between different fragment sizes. For this, studies in wetlands that tested the relationship between birds species richness (S) with habitat characteristics, were reviewed and only the studies which include the area as a variable were selected, which were from 1978-2013. According to this review, area is the best explanatory variable accounting for species richness, EHFDXVHLWLVWKHYDULDEOHPRVWIUHTXHQWO\LGHQWLĆHGLQ Page 129, Posters 139 Association between the Charadriiformes birds distribution, habitat attributes and trophic options in Lenga estuary Carol Cerda-Pea1*, Pedro F. Victoriano2, Ricardo Figueroa3 ǢW2-='89-&!&&'39!+39TǣW'6!8;!1'2;3&' 33£3+!T !$<£;!& &'-'2$-!9!;<8!£'[email protected]$'!23+8)$!9T2-='89-&!&&'32$'6$-2T 32$'6$-2T,-£'TǤW2-&!&&'9-9;'1!9!$<ধ$39T !$<£;!&&'-'2$-!9 1#-'2;!£'[email protected]'2;83f,-£'T2-='89-&!&&'32$'6$-2T,-£' r$!83£$'8&!W6'!|!£<1239W<£!+39W$£ POSTER SESSION: DIVERSITY & DISTRIBUTION Waterbirds distribution and abundance in wetlands could be explained by a series of hypothesis in which the trophic resources appear to be the main factor. However, this remains unproven for many wetlands, considering the changes in soil that may change the prey that birds feed on. We test the {փdփTT ID t ABSTRACT t ID t hypothesis that food resources (i.e macro-invertebrates) determine the abundance and spatial distribution of Numenius phaeopus, Himantopus melanurus and Vanellis chilensis more than other habitat variables. The main objective was to analyze the relationship between the three aforementioned species trophic options and other environmental factors in two spatial scales and different seasons. The study was conducted in Lenga wetland in the Bío-Bío Region of Chile from April 2013 to March 2014 and involved monthly recording of bird abundance as well as other environmental factors (e.g prey resources and abiotic characteristics of their habitat). As it was predicted, the results show that the distribution patterns associated with the abundance of birds were more correlated with the availability of their trophic resource (R= 0.194; p=0.04) rather than with the other variables; but, this may change depending on the season, being the trophic variables more closely correlated with the cold season (R=0.439; p<0.05). In addition, it is revealed that there are differences linked to use at a micro-habitat level. This study highlights the importance of food resources when it comes to birds distribution and use of wetlands such as Lenga, as well as the species intrinsic characteristics, specialization degree about their habitat use, their prey and their trophic niche. 140 Variación en la composición de la avifauna en Page 130, Posters ABSTRACT t Table of Contents XQJUDGLHQWHDOWLWXGLQDOGHOćDQFRRFFLGHQWDO de la Cordillera Occidental, Colombia Diego A. Carantn 2-='89-&!&!$-32!£&'3£31#-! $!8!2;32ǣ|+1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY Las montañas del neotrópico ofrecen un escenario apropiado para entender la organización de las comunidades‚ el recambio de especies, la disposición en gremios y grupos taxonómicos y la diversidad. Conocer la riqueza a través de gradientes altitudinales permitiría entender como un escenario de cambio climático podría afectar la distribución GHHVSHFLHVHQORV$QGHV(VWHWUDEDMREXVFDLGHQWLĆFDUHO recambio en la composición y riqueza sobre un gradiente altitudinal (800 a 3400m) entre el PNN Las Orquídeas y el Páramo de Frontino‚ (Cordillera Occidental de Colombia). Se establecieron cinco intervalos a través de una delimitación altitudinal (<1000m, 1000-1500m, 1500-2000m, 20002800m, >2800). Los resultados preliminares muestran una composición de 465 especies de aves‚ con las comunidades más diversas en los rangos de 1000-1500m (231 especies) y 1500-2000 m (221 especies) y luego decrece a mayor altitud. /DVPD\RUHVDĆQLGDGHVVHFRPSDUWHQFRQODVVHFFLRQHV DOWLWXGLQDOHVFRQWLJXDV6HLGHQWLĆFDURQVLHWHJUXSRVGHGLHWD y un aumento en la riqueza de estos en las elevaciones medias del gradiente. Los grupos de dieta más diversos muestran una disminución drástica a mayores elevaciones, debido a una menor productividad. La compleja topografía es un factor que LQćX\HHQODFRPSRVLFLµQHQXQJUDGLHQWH8QDDOWDYDULDFLµQ {փdփTT ID t ABSTRACT t en la composición concentra las especies endémicas en ciertas franjas y un alto número de especies se afectaría frente a un escenario de cambio climático. Los bosques montanos del norte de la Cordillera Occidental albergan una alta diversidad LQćXHQFLDGHODDYLIDXQDGHORV$QGHV\HO&KRFRELRJHRJUDĆFR 142 6HDVRQDOćXFWXDWLRQLQWKHXVHRIDFRPPXQDOURRVW by Diopsittaca nobilis in São Paulo city, Brazil ID t ABSTRACT t Table of Contents $WRWDORIćRFNVZHUHUHFRUGHGOHDYLQJWKHURRVW ZLWKDQDYHUDJHVL]HRILQGLYLGXDOVćRFNPLQ PD[ DQGRIWKHVHćRFNVPRYHGWRWKH1RUWKDQG Northeast, towards Butantã district, Butantan Institute and “Cidade Universitária” (USP), while 23.3% moved to southwest, towards Vila Sônia district. This communal roost is used permanently by the birds, which are considerably abundant at the roost, which attests its regional importance for the urban population of D. nobilis in the megacity. Raquel R. Colombo f-3£!83 8!7<'£$3£31#3|@!,33W$31W#8 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY The establishment of Psittacidae populations from releases and captivity escapes in urban areas occurs worldwide, but ecological studies focusing on these populations are uncommon, especially in tropical regions. Many Psittacids make use of communal roosts to overnight, whose use may vary temporally. In this study, we analyzed the seasonal ćXFWXDWLRQLQWKHQXPEHURIDiopsittaca nobilis (Linnaeus, 1758) using a communal roost - comprised by 23 individuals of Roystonea oleracea (Arecaceae) - in São Paulo city, SE Brazil. Nine morning counts were made between 2012 and WKHĆUVWZLWKRQHFRXQWDQGHLJKWZLWKWKUHHFRXQWV in subsequent days), in a total of 25 samples. The population was composed on average by 116 individuals (± 36.3), with lower numbers in October and January, and higher values in April and May (max = 213 individuals). The amplitude of the DQQXDOćXFWXDWLRQF\FOHVDYHUDJHGDERXWLQGLYLGXDOVs 21.6), and the highest amplitude occurred in 2012 (85.0 ± Page 131, Posters 145 Morphological variation and taxonomy of Sirystes sibilator (Vieillot, 1818) (Aves: Tyrannidae) Leonardo Esteves Lopes1*, Luiz Pedreira Gonzaga2 ǢW2-='89-&!&' '&'8!£&'-39!TǣW2-='89-&!&' '&'8!£&3-3&'!2'-83 r£'3W$'88!&3|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY Sirystes sibilator is a widespread species in the Neotropical region, where it inhabits the forest canopy. Five subspecies are traditionally recognized for this species, but it was recently proposed, based on vocalizations and limited morphological data, to split this monotypic genus in four species. We conducted a morphological revision of the genus based on the examination of 514 museum specimens, including all name-bearing types available. Data presented here support the recognition of four species in the genus, which can be diagnosed by vocal and morphological data: 1) S. sibilator (including atimastus, which represents the mid-point of a clinal variation), distributed across almost all Brazilian territory S of the Amazon river and E of the Tapajós river, also reaching {փdփTT ID t ABSTRACT t E Bolivia, E Paraguay and NE Argentina; 2) S. albogriseus, a Trans-Andean species distributed from Panama to W Colombia and NW Ecuador; 3) S. albocinereus, a Cis-Andean species distributed from NW Venezuela to central Bolivia, also reaching extreme W Brazil and 4) S. subcanescens, distributed from French Guyana, Surinam, Guyana and Brazil, N of the Amazon river, also reaching W Brazil, W of the Madeira river. :HLGHQWLĆHGSRVVLEOHK\EULGVEHWZHHQS. sibilator and S. albocinereus from central Bolivia, and correct the range and diagnosis of S. subcanescens, a name that has been frequently misused in the literature. We also present a redescription of all four recognized species, reviewing its range and natural history. 146 Análisis de la comunidad de aves de la Estación ID t ABSTRACT t Table of Contents 12.9% del total de aves anilladas. La mayor riqueza se obtuvo en agosto y noviembre (2012); en marzo, agosto y diciembre (2013), y en enero y agosto (2014). La mayor abundancia se obtuvo en los meses de agosto, noviembre y diciembre (2012); marzo, agosto y noviembre (2013); y en enero, julio y agosto (2014). El 20.8% del total de aves anilladas presentaron una muda activa en los meses de Junio a Agosto. En estos meses también se registró la mayor cantidad de individuos sin grasa corporal. Es posible que como Santa Eulalia tiene temporadas secas y húmedas muy marcadas, la variación estacional UHSHUFXWDHQODĆVLRORJ¯DGHODVDYHV6HUHFRPLHQGDFRQWLQXDU con las evaluaciones a nivel de gradientes altitudinales para determinar los patrones de muda y la dinámica poblacional de las aves comunes en los diferentes puntos de evaluación. Biológica Río Santa Eulalia– Huarochirí, Lima- Perú Flor Hernndez1*, Alexis Diaz1, Erica Berrocal1, Yaqueline Tenorio1, Julio Salvador1, Kevin Chumpitaz1, Tania Poma1 ǢW rù'82!2&'A|$38#-&-W38+ 150 Descrição do ninho e período reprodutivo de Crax globulosa no Rio Juruá, Amazonas, Brasil Gabriel A. Leite1*, Izeni Pires Farias2, Carlos Augusto Peres3 ǢWTǣW TǤW2-='89-;@3(!9;2+£-! POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY r+!#8-'£A33#-3|,3;1!-£W$31 A pesar de su alta diversidad, se sabe muy poco de la historia natural de las aves en Perú. El anillamiento de aves permite generar datos sobre riqueza y abundancia de las comunidades de aves. Este trabajo se desarrolló en la Estación Santa Eulalia (Huarochirí, Lima - Perú), entre junio 2012 y diciembre 2014. Se evaluó la variación de la riqueza y abundancia de especies de DYHV\VHGHWHUPLQµVXYDULDFLµQĆVLROµJLFD(QWRWDOVHDQLOODURQ 940 individuos, pertenecientes a 33 especies (15 familias), 3 de las cuales son especies endémicas. Se lograron 122 recapturas, pertenecientes a 14 especies (9 familias), y representando el POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Page 132, Posters O mutum-piuri (Crax globulosa) é uma espécie ameaçada de extinção e endêmica da bacia Amazônica, onde ocorre H[FOXVLYDPHQWHHPćRUHVWDVGHY£U]HD'DGRVVREUHD UHSURGX©¥RGDHVS«FLHV¥RHVFDVVRV$£UHDGHHVWXGRĆFDQD Reserva de Desenvolvimento Sustentável Uacari, no município de Carauari, AM. O ninho foi encontrado no dia 22 de agosto de 2014 no igarapé Marari, margem direita do rio Juruá. No dia 5 de setembro na tentativa de colocar uma câmera trap próximo ao ninho a fêmea voou e não voltou mais. O ninho {փdփTT ID t ABSTRACT t IRLYHULĆFDGRHFRQWLQKDGRLVRYRVEUDQFRVPHGLQGR[ mm, 92 x 64 mm e pesando 200 e 204 gr cada. Estava em uma forquilha cercado por cipós a 9 m do solo e 3,5 m do igarapé Marari, medindo 46 cm de largura e 24 cm de altura, composto principalmente de gravetos e forrado por folhas secas e verdes. 1RGLDGHRXWXEURIRLREVHUYDGRXPĆOKRWHGHXPDVHPDQD junto com os pais na margem direita do Marari, no mesmo dia na outra margem um jovem macho de pelo menos três meses foi observado, estava próximo ao solo, mas voou para o dossel. No dia 15 de outubro em outro local do Marari, dois machos jovens de pelo menos quatro meses foram observado junto com os pais no dossel. Na Colômbia foram observados fêmeas FRPY£ULRVĆOKRWHVMRYHQVJHUDQGRDSRVVLELOLGDGHTXHI¬PHDV tem grandes ninhadas. O período reprodutivo da espécie parece ser o mesmo encontrado na Colômbia, Peru e em Codajás no Brasil, onde dois indivíduos capturados possuíam gônadas bem desenvolvidas em julho. O auge da reprodução entre os meses de junho a outubro na região condiz com a «SRFDGDVHFDWHQGRGLVSRQLELOLGDGHGHWHUUDSDUDRĆOKRWHV andarem até conseguirem voar, antes de alagar novamente. 151 Reprodução de Bucco macrodactylus no médio rio Juruá, Amazonas, Brasil Gabriel A. Leite ID t ABSTRACT t Table of Contents de B. macrodactylus é descrito, além do cuidado parental. O ORFDOGHHVWXGRĆFDQRULR-XUX£GHQWURGD5'68DFDULQR município de Carauari, AM, Brasil. O monitoramento do ninho foi realizado por meio de observações diretas e gravações de vídeos. Foram anotados a frequência e tipo de presa que RVSDLVOHYDYDPDRVĆOKRWHV2QLQKRIRLHQFRQWUDGRQRGLD GHGH]HPEURGHĆFDYDGHQWURGHXPDFDYLGDGHHPXP cupinzeiro arborícola, estava a 2,45 m do solo, com abertura de 5 cm e profundidade de 19 cm. Durante 43 horas em seis dias ele foi monitorado. Ambos os pais levaram alimento para RVGRLVĆOKRWHVYH]HVXPDP«GLDGHSUHVDVSRUKRUD 'DVSUHVDVIRUDPLGHQWLĆFDGDVVHQGRTXHQDPDLRULD foram invertebrados da ordem Orthoptera. Foram gravadas duas tentativas de predação do ninho por um marsupial. No dia seguinte, foi observado o comportamento dos pais WHQWDQGRID]HURVĆOKRWHVDEDQGRQDUHPRQLQKR8PGRV adultos estava com alimento no bico, mas em vez de chegar HGDURDOLPHQWRHOHSRXVDYDQDHQWUDGDHTXDQGRRVĆOKRWHV iam pegar a presa ele voava. Depois de algumas tentativas os ĆOKRWHVDEDQGRQDUDPRORFDO2QLQKRGHB. macrodactylus é conhecido por um único registro no Peru, também feito em um cupinzeiro arborícola a 2,5 m do solo. A maior frequência de insetos da ordem Orthoptera pode estar relacionada ao fato do ninho estar próximo a uma área de plantação de milho, onde a abundância desse tipo de presa é alta. +!#8-'£A33#-3|,3;1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Bucco macrodactylus pertence à família Bucconidae, no qual seus representantes constroem ninhos em buracos em barrancos e cupinzeiros arborícolas. Neste trabalho, o ninho Page 133, Posters {փdփTT ID t ABSTRACT t 152 Descrição dos ninhos de Myrmotherula assimilis e Hypocnemoides maculicauda, no médio rio Juruá, Amazonas, AM Gabriel A. Leite1*, Marcelo Henrique Mello Barreiros ǢW +!#8-'£A33#-3|,3;1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION $VćRUHVWDVLQXQG£YHLVQD$PD]¶QLDSRVVXHPGRLVSHU¯RGRV muito distintos, onde esse ambiente propicia um hábitat IDYRU£YHOSDUDHVS«FLHVGHWHUUDĆUPHTXDQGRHVW£VHFR e se torna fonte de recursos para muitas espécies quando está alagado, pois nesse período diversas espécies vegetais IUXWLĆFDP(VSHFLDOPHQWHSDUDHVS«FLHVGHDYHVTXHV¥R residentes nesse ambiente, o período das cheias é época de reprodução, pois aproveitam a grande oferta de recursos para a prole. Aqui apresentamos dados inéditos sobre a reprodução de duas espécies de áreas alagadas, Myrmotherula assimilis e Hypocnemoides maculicauda, dentro do RDS Uacari, no médio rio Juruá, Amazonas, Brasil. O ninho de M. assimilis foi encontrado no dia 9 de março de 2015, medindo 6 cm de altura, 3 cm de profundidade e 5,5 cm de diâmetro na entrada. Era construído com pequenas raízes e algumas folhas secas, além de estar 38 cm do nível da água. O mesmo continha dois ovos marrom claro com manchas marrom escuras e a fêmea foi observada incubando. O ninho de H. maculicauda foi encontrado no dia 11 de março de 2015, continha um único ovo de cor roxa, construído com pequenas raízes escuras, além de folhas verdes e secas, estava a 18 cm do nível da água e o macho foi observado incubando. As suas medidas eram 17 cm de altura, 7 cm de profundidade e 5 Page 134, Posters ID t ABSTRACT t Table of Contents cm de diâmetro na entrada. Dados reprodutivos das duas espécies são escassos, com apenas registros de adultos de M. assimilisDOLPHQWDQGRĆOKRWHVHPRXWXEURHH. maculicauda em agosto. Para muitas espécies neotropicais, dados de história natural ainda permanecem obscuros, sendo que esses podem nos ajudar a compreender como essas espécies conseguem sobreviver nesse ambiente tão peculiar. 153 How does data availability bias extinction risk assessments of migratory birds? Veronica F Gama1*, Morena Mills1, Judit Szabo2, Richard A Fuller1, Simon P Blomberg1, Hugh P Possingham1 ǢW,'2-='89-;@3(<''29£!2&TǣW!8;2'89,-6(38 ;,'!9;9-!2f<9;8!£!9-!2 £@>[email protected] r='832-$!W+!1!|<7W'&<W!< POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES The availability of data on migratory birds around the world is highly heterogeneous, which affects the accuracy of their extinction risk assessments. In some countries, such as England, the USA and Australia, there are comprehensive historical data, largely collected by the birdwatching community. Compared to the world average, Australia has a higher SURSRUWLRQRIPLJUDWRU\ELUGVFODVVLĆHGDVWKUHDWHQHGDQG recent studies have shown that even more mobile species could be considered threatened if additional data were used. In contrast, Brazil is among the countries with little data on migratory birds, and this shortage may impact the number of VSHFLHVFODVVLĆHGDVWKUHDWHQHG,QWKLVSDSHUZHLQYHVWLJDWH if the addition of data to the assessment would increase the {փdփTT ID t ABSTRACT t proportion of threatened migratory birds in Brazil. We obtain geographical distribution data (area of occupancy and extent of occurrence) and reassess the extinction risk for a subset of Brazilian migratory and non-migratory birds using structured expert elicitation. This method was used in the “Action Plan for Australian Birds” in 2010, the results of which were adopted by the global IUCN Red List. In this paper we (1) quantify how the proportions of threatened and non-threatened migratory and non-migratory Brazilian birds change by the addition of new data, (2) gather and produce valuable data for migratory ELUGVLQ%UD]LODQGZHSURSRVHVSHFLĆFVWUDWHJLHVIRU extinction risk assessments in data poor environments. 154 Effects of cattle ranching on avian assemblages ID t ABSTRACT t Table of Contents same points. Taller vegetation occurred in areas with lower stocking density, as expected (F2,160 = 18.94, p < 0.001, 7XNH\+6'S1RVLJQLĆFDQWGLIIHUHQFHVZHUHIRXQG on species richness (F2,160 = 1.58, p = 0.20) or abundance (F2,160 = 1.90, p = 0.15) among stocking levels. However, some grassland dependent species were more abundant at high stocking (e.g. Anthus sp.) while others occurred only at low stocking rates (e.g. Cistothorus platensis). Preliminary results highlight the importance of maintaining a vegetation mosaic, through the management of cattle stocking rates, providing a variety of habitats available for birds. The next step is to get more information that helps to verify what is the best management techniques for the conservation of grassland specialist species, since they are more threatened. in the Pampas grasslands of South Brazil Tiago Filipe Steffen1*, Graziela Dotta1, Juliana Pestana Souza1, Carla Suertegaray Fontana1 155 Factors affecting escape distance in some Neotropical birds ǢW!#38!;8-3&'82-;3£3+-!T<9'<&'-Í2$-!9''$23£3+-!T Augusto Joo Piratelli1*, Gabriela Rodrigues Favoretto2, Marina Franco de Almeida Maximiano3 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES ǢW2-='89-&!&' '&'8!£&'3!8£39T'6;3W-Í2$-!91#-'2;!-9cTǣW 2-='89-&!&' '&'8!£&'3!8£39TǤW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-! The Pampas grasslands are represented by several ecological systems, including the Shallow Soils’ Region in the central-west SDUWRI5LR*UDQGHGR6XOVWDWH3HULRGVRIZDWHUGHĆFLWKDYH reduced the pressure of agrarian expansion in this region, that has been historically used for ranching activities, which allowed the persistence of a large percentage of native grasslands. We evaluated the effects of three levels of cattle stocking density – low, medium and high – on bird species richness and abundance by carrying out 160-point counts in eight study sites. We also measured variation in vegetation height at these r6-8!;'££-|<(9$!8W#8 Page 135, Posters POSTER SESSION: BEHAVIOUR 7KHćLJKWLQLWLDWLRQGLVWDQFHKDVEHHQXVHGHLWKHUWRXQGHUVWDQG WKHFRVWEHQHĆWWUDGHRIIVUHODWHGWRWKHULVNRISUHGDWLRQ or as an important tool for wildlife managers. Although this variable is well-discussed for temperate regions, it is still poorly known in the Neotropics. Here we analyze the escape behavior of some Neotropical birds, comparing an urban to DQRQXUEDQDUHD:HWHVWHGIRUWKHLQćXHQFHRIVLWHVXUEDQ vs. non-urban area), approaching (by one vs. two people), {փdփTT ID t ABSTRACT t daytime (morning vs. afternoon), seasons (breeding vs. nonbreeding) and body mass on the determination of the initial ),'DQGĆQDO))'ćLJKWGLVWDQFHVDFURVVGLIIHUHQWVSHFLHV We predict that FID will be greater in rural areas and under a greater threat (higher number of predators approaching) in the afternoon and in the non-breeding season. We also expect a direct relationship between body mass and FID and between FID and FFD. We sampled 11 species after measuring HVFDSHEHKDYLRUVDQGZHFRQĆUPHGRXUSUHGLFWLRQV IRUVLWHVĆYHVSHFLHVGD\WLPHRQHVSHFLHVDQGUHMHFWHG our premise about seasons for one species. Mean FID was strongly affected by body mass, and directly affected FFD. Adjustments in FID are, most likely, an important adaptive trait in urban habitats and may partially explain the predominance of species with higher ecological plasticity in cities. 158 0RGHORVGHRFRUU¬QFLDGHDYHVFRPRIHUUDPHQWD SDUDLGHQWLĆFD©¥RGHIUDJPHQWRVćRUHVWDLVXUEDQRV prioritários para a conservação em Manaus Beatriz Cirino1*, Cintia Cornelius Frische2 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!A32-!TǣW 2-='89-&!&' '&'8!£&31!A32!9 ID t ABSTRACT t Table of Contents ćRUHVWDVSUHVHUYDGDVHLQGLFDGRUDVGHDPELHQWHVDQWURSL]DGRV e modelos de ocorrência como ferramenta de seleção de áreas prioritárias para a conservação (APC). Caracterizamos quantitativamente a paisagem, obtivemos dados de qualidade ambiental e realizamos censos de aves em 30 fragmentos ćRUHVWDLV8WLOL]DPRVDDERUGDJHPGHVHOH©¥RGHPRGHORVSDUD determinar a relação entre a ocorrência das espécies e métricas de paisagem e qualidades dos fragmentos. Encontramos que fragmentos grandes e com maior área núcleo tem maior probabilidade de ocorrência de espécies indicadoras GHćRUHVWD3RU«PDPDLRULDGRVIUDJPHQWRVFRPHVWDV características encontram-se nas regiões periféricas da cidade, onde atualmente existem altas taxas de desmatamento devido a empreendimentos imobiliários ou invasões. O campus da UFAM (~600 ha) foi o único fragmento que apresentou alta prioridade para conservação no centro da cidade. Fragmentos pequenos e com menor qualidade ambiental tiveram maior probabilidade de ter espécies indicadoras de ambientes antropizados. Estes fragmentos, no entanto, tem um papel fundamental para a manutenção da conectividade entre os fragmentos com alta prioridade para conservação. Os dados desta pesquisa auxiliam na elaboração de diretrizes para gerenciamento das UCs existentes e no planejamento de novas UCs em Manaus. r#-!382-;3|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES )UDJPHQWRVćRUHVWDLVHP£UHDVXUEDQDVDMXGDPQDPHOKRULD da qualidade de vida da população humana através dos serviços ecossistêmicos que oferecem. Nosso objetivo foi LGHQWLĆFDUIUDJPHQWRVćRUHVWDLVSULRULW£ULDVSDUDFRQVHUYD©¥R em Manaus (AM). Utilizamos espécies de aves indicadoras de Page 136, Posters {փdփTT ID t ABSTRACT t 160 Reporte de nidos de Geositta peruviana y Pseudoasthenes cactorum en la Zona Reservada Lomas de Ancón (ZRLA) Lima–Perú ID t ABSTRACT t Table of Contents 161 ,GHQWLĆFDQGRDYHVHPXPVDQWX£ULRHFROµJLFRQR sul do Brasil, Florianópolis, Santa Catarina Fabrcio Almeida Jennyfer Zuiga1*, Katia Monzn2 2-='89-&!&' '&'8!£&'!2;!!;!8-2! ǢW2-='89-&!&!$-32!£[email protected]&'!2!8$39TǣW2-='89-&!&!$-32!£&'8</-££3 (!#8-$-3W#!9-£-3!£1'-&!|+1!-£W$31 r/'[email protected]/ǡǣǣǦ|+1!-£W$31 POSTER SESSION: DIVERSITY & DISTRIBUTION POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION $LGHQWLĆFD©¥RGHDYHVHPDPELHQWHVQDWXUDLVSURSRUFLRQD subsídios importantes para o monitoramento ambiental, pois elas estão presentes em todos os ecossistemas da Terra, com exceção das profundezas do oceano. Além de serem ótimas bioindicadoras, as aves proporcionam serviços ambientais importantes, tais como a dispersão de sementes, a polinização e o lazer. Nesta perspectiva, o trabalho objetivou apresentar os registros de aves mais importantes dos ecossistemas da praia do Santinho, Florianópolis, Santa Catarina, Brasil. Esta localidade pode ser considerada como um santuário ecológico, devido à alta diversidade de espécies registradas. Entretanto, a região vem passando por um processo acelerado e desordenado de expansão urbana. Visando reverter este quadro, uma unidade de conservação está sendo concebida para proteger as espécies in situ. O levantamento se fez através de observação GLUHWDHRXSRULGHQWLĆFD©¥RGDVYRFDOL]D©·HVVHQGRTXHR mesmo é fruto de mais de dez anos de monitoramento da área. O total registrado soma 162 espécies de aves, distribuídas em 55 famílias, o que representa aproximadamente 23% das aves com ocorrência no Estado de Santa Catarina e 46% das aves registradas para Florianópolis. Dentre elas, quatro espécies são citadas na lista vermelha de ameaçadas de extinção do Estado de Santa Catarina (Ramphocelus bresilius, Rallus longirostris, Geositta cunicularia e Thalasseus maximus). A localidade é um La Zona Reservada Lomas de Ancón (ZRLA) localizada en Lima, Perú, administrada por el Servicio Nacional de Áreas 1DWXUDOHV3URWHJLGDV6(51$13FRPSUHQGHXQDVXSHUĆFLH de 10 962,14 hectáreas de desierto costero, alberga hábitats de especies endémicas y formaciones vegetales singulares dentro del ecosistema Lomas costeras. Es denominada también como ?oasis de niebla?, ?cinturón fértil? o ?prados en el desierto? debido a la presencia de neblina y al desarrollo estacional de la vegetación. Entre la fauna endémica se encuentran dos especies de aves, el Minero Peruano (Geositta peruviana) y Canastero de los Cactus (Pseudoasthenes cactorum) ORVFXDOHVQLGLĆFDQHQOD=5/$(QHOSHULRGRGHDJRVWRD noviembre de 2014; durante el recorrido por los senderos establecidos en la ZRLA, reconocimos nidos de estas dos especies endémicas y caracterizamos los hábitats presentes: Loma de Herbáceas, Tillandsiales, Cactáceas Dispersas y Cactáceas Columnares. Encontramos 11 nidos en actividad del Minero Peruano en la Loma de Herbáceas y 5 nidos del Canastero de los Cactus en las Cactáceas Columnares. Estos resultados son aportes preliminares para la conservación y gestión de la Zona Reservada Lomas de Ancón. Page 137, Posters {փdփTT ID t ABSTRACT t importante sitio para descanso e alimentação de espécies migratórias, tanto as do hemisfério sul, quanto as do hemisfério norte, comprovando a importância da área para a manutenção da biodiversidade na costa atlântica do sul do Brasil. 164 &L¬QFLD&LGDG¥QR%UDVLOFRQWH¼GRGHZHEVLWHFRUURERUDFRP OLWHUDWXUDFLHQW¯ĆFDVREUHDELRORJLDUHSURGXWLYDGH3LSULGDH Sandro G. Moreira1,2*, Miguel ngelo Marini1 ǢW2-='89-&!&'&'8!9£-!TǣW'2;832-='89-;8-3&'!;39&'-2!9 ID t ABSTRACT t Table of Contents DQR,QIRUPD©·HVQ¥RGHVFULWDVQDOLWHUDWXUDFLHQW¯ĆFDIRUDP ninho de Lepidothrix nattereri, com 2 ovos sendo incubados, em Paranáíta (MT); ninho de Xenopipo atronitens, contendo 2 ovos, em Aripuanã (MT) e ninhos de Ilicura militaris em Guanhães e Nova Lima (MG), Santa Maria Madalena e Rio de Janeiro (RJ), Apiaí (SP), Blumenau e São José (SC), com informações sobre construção do ninho, incubação e cuidados parentais. O site wikiaves.com, além de divulgar a ornitologia fora do meio acadêmico, parece possuir potencial em fornecer LQIRUPD©·HVFLHQW¯ĆFDVUHIHUHQWHV¢VDYHVEUDVLOHLUDV r9!2&83'$,3!=-9|,3;1!-£W$31 POSTER SESSION: BEHAVIOUR &L¬QFLD&LGDG¥«XPDIRUPDGHJHUDUGDGRVFLHQW¯ĆFRVSHOD cooperação entre pesquisadores e cidadãos da sociedade. O site wikiaves.com divulga informações sobre aves que ocorrem no Brasil, pela participação de observadores, que inserem informações referentes às mesmas. O objetivo deste trabalho foi comparar os registros relacionados à reprodução de Pipridae no site com o conhecimento existente na literatura. Foram analisados 13.209 registros, dos quais 262 referiam-se à reprodução. O comportamento de corte foi visto em 116; 42 referiam-se ao conteúdo de ninhos, sempre com ninhada de 2, como esperado. Os comportamentos de construção do ninho, incubação e cuidado parental foram vistos em 97, em todos realizados por fêmeas, esperada estratégia antipredação. Registros de reprodução foram feitos em todos os meses, sendo abril o mês com menor número e novembro com o maior; a atividade mais precoce foi a corte de Chiroxiphia pareola, e registro mais tardio o de um ninhego de Manacus manacus, ambos feitos em maio, demonstrando que as atividades reprodutivas concentram-se na segunda metade do Page 138, Posters 167 9LQWHDQRVV¥RVXĆFLHQWHVSDUDTXHHVS«FLHVGHDYHV GHSHQGHQWHVGHćRUHVWDVUHFRORQL]HPXPD£UHDGH restinga após mineração no nordeste do Brasil? Arnaldo Vieira-Filho1*, Helder Araujo1 Maria Regina Barbosa1 ǢW2-='89-&!&' '&'8!£&!!8!Ð#! r!82!£&3,=-'-8!|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Historicamente muitas áreas de restinga localizadas no nordeste brasileiro sofreram ou sofrem forte pressão antrópica, principalmente decorrida da especulação imobiliária e de atividades industriais, acarretando na redução e fragmentação de habitats naturais. Portanto, nós objetivamos avaliar se a Q¥RFRORQL]D©¥RGHXPD£UHDUHćRUHVWDGDSRUHVS«FLHVGH DYHVGHVXEERVTXH«LQćXHQFLDGDSHODGLVW¤QFLDHQWUHD£UHD UHćRUHVWDGDHRIUDJPHQWRFRPYHJHWD©¥RQDWLYD3DUDWDQWR nós capturamos 200 indivíduos de 13 espécies de aves na área nativa e translocamos aproximadamente 60% destes SDUD£UHDUHćRUHVWDGD-£SDUDYHULĆFDURGHVORFDPHQWRGH {փdփTT ID t ABSTRACT t indivíduos na área nativa, os 40% restante dos espécimes capturados foram liberados nos locais de capturados. Os espécimes foram capturados entre Junho de 2008 e Abril de 2010 com o monitoramento estendendo-se até Setembro de 2011. Do total de indivíduos translocados, 58 foram recapturados no fragmento de restinga nativa, enquanto VRPHQWHXP1 IRLUHFDSWXUDGRQD£UHDUHćRUHVWDGD 'LDQWHGLVVRYHULĆFDPRVTXHGRVLQGLY¯GXRV retornaram a área nativa e permaneceram no mesmo. 'LDQWHGLVVRQµVFRQFOX¯PRVTXHDV£UHDVUHćRUHVWDGDV não são capazes de manter as espécies de aves estudada e que essas espécies possuem a habilidade de cruzar a matriz entre os fragmentos amostrados. A não colonização da área UHćRUHVWDGDSRGHHVWDUDVVRFLDGDDHVWUXWXUDHFRPSRVL©¥R GDYHJHWD©¥RHQFRQWUDGDQRIUDJPHQWRUHćRUHVWDGR 168 Revisão das guildas alimentares de aves brasileiras não Passeriformes do cerrado Wagner de Freitas Pereira1*, Ana Paula Moretto Arajo1, Mayara da Silva Reis1, Rosiani Ramos Lopes Brinck1, Srgio Roberto Posso1 ID t ABSTRACT t Table of Contents das aves não-passeriformes do Cerrado brasileiro por meio GHXPDUHYLV¥RELEOLRJU£ĆFDTXHVHUYLU£FRPREDVHSDUD FRQVXOWDHPDSHQDVXPD¼QLFDIRQWH$UHYLV¥RELEOLRJU£ĆFD foi realizada com o auxílio do Google Acadêmico. Uma espécie foi considerada dentro de uma categoria alimentar desde que a literatura indicasse tal categoria em pelos menos 75% das citações, caso contrário foi considerada como onívora. De 384 espécies de não-passeriformes ocorrentes no Cerrado, 30 não foram encontradas referências de estudos alimentares e, portanto, carecem de estudo. Das restantes, 96 espécies foram consideradas insetívoras, 81 carnívoras, 75 frugívoras, 57 onívoras, 35 nectarívoras, seis granívoras (Zenaida auriculata, Columbina minuta, C. talpacoti, C. picui, C. cyanopis e Scardafella squammata) e quatro detritívoras (Cathartidae). Trabalhos com itens alimentares de aves no Cerrado JHUDOPHQWHLQGLFDPXPQ¼PHURPDLRUGHHVS«FLHVLQVHW¯YRUDV carnívoras, devido à fauna rica e abundante disponível para as aves neste bioma. Esta lista proporciona uma única base de consulta que será útil para determinação rápida e segura GDVLQWHUD©·HVWUµĆFDVGDDYLIDXQDHPWUDEDOKRVGHHFRORJLD conservação e manejo dos ecossistemas do Cerrado brasileiro. ǢW r(8'-;!9>6|+1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS São raros os dados sobre a dieta das aves não-passeriformes do Cerrado e não há uma compilação de dados alimentar destas em uma única fonte. Necessita-se de várias fontes SDUDVHYHULĆFDUWDLVSUHIHU¬QFLDV$LQGDQ¥RK£SDGU¥RVRE qualquer critério em relação à determinação da predominância alimentar das aves não-passeriformes. Desse modo, o objetivo deste trabalho é obter uma lista das guildas alimentares Page 139, Posters {փdփTT ID t ABSTRACT t 173 Análise da comunicação sonora de Myiozetetes cayanensis (Aves, Tyrannidae) revela uma ampla variedade de sinais sonoros e contextos comportamentais Dnilson O. Ferraz1*, Leiliany Negro de Moura1, Amanda de Almeida Monte1, Felipe Reis Castro1, Maria Luisa da Silva1 ǢW2-='89-&!&' '&'8!£&3!8Æ r#-3i('88!A|,3;1!-£W$31 POSTER SESSION: BIOACOUSTICS A comunicação pode ser caracterizada como o comportamento em que os emissores usam sinais para alterar o comportamento do receptor. O presente estudo apresenta uma contribuição à compreensão do comportamento vocal de Passeriformes Suboscines. Descrevemos o repertório vocal de Myiozetetes cayanensis e a correspondência das vocalizações com os respectivos contextos comportamentais utilizando a técnica do playback da vocalização. A coleta de dados ocorreu na Universidade Federal do Pará em Belém-Pa e no Parque Ecológico de Gunma em Santa Bárbara do Pará-Pa. Registramos as vocalizações com o auxílio de gravador digital e microfone ultradirecional. Encontramos um repertorio constituído por 15 vocalizações. A vocalização 1, em dueto, IRLLQWHUSUHWDGDFRPRRFDQWRGHUHFRQKHFLPHQWRHVSHF¯ĆFR Esta vocalização estaria relacionada, juntamente com pelo menos outras três vocalizações, a comportamentos de defesa territorial além de representar uma forma de manutenção da coesão do casal. A vocalização 3 pode ter função de alarme pois a emissão era motivada pela presença de intrusos nas proximidades do ninho. Entretanto, a espécie não mostrou comportamento de fuga durante testes com esta vocalização. Foram observados seis sinais sonoros com Page 140, Posters ID t ABSTRACT t Table of Contents provável função de contato, pois em resposta ao playback com estas os indivíduos buscavam o local da fonte, às vezes HPLWLQGRDVPHVPDVYRFDOL]D©·HV&RQĆUPDPRVDHPLVV¥R GHXPDYRFDOL]D©¥RUHODFLRQDGDDRSHU¯RGRGHQLGLĆFD©¥R usada para comunicação do casal. Os dados obtidos neste estudo revelam uma complexidade comportamental e uma variedade de repertório inesperada para uma espécie que supostamente apresenta canto estereotipado. 176 Functional traits of birds: an approach to understand the effects of fragmentation in the Colombian Andes Maria Camila Estrada-Flrez1*, Gastn Zamora Abrego2 ǢW2-='89-&!&!$-32!£&'3£31#-! r9;'-2!$£'-;|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Fragmentation and habitat loss is a process that changes the structure of the plant and animal communities of an ecosystem, which affects not only the taxonomic diversity, but also the HFRORJLFDOIXQFWLRQVWKDWVRPHVSHFLHVPD\EHIXOĆOOLQJ6WXGLHV on Functional Diversity (FD), establish how diverse are the functional traits (ecological and morphological attributes of a species) of an ecosystem and which ones may be driving the responses of a species to the environment disturbance. We studied the andean bird assembly in vegetation fragments of different sizes and evaluate the changes in FD as a result of changes in vegetation cover. Moreover, we determined which functional traits (e.g. feeding guild, foraging strategy, wing load, ERG\VL]HQHVWLQJVLWHDUHPRUHLQćXHQWLDOLQWKHLUGLVWULEXWLRQ {փdփTT ID t ABSTRACT t in the fragment matrix. FD is higher in larger fragments, as opposed to smaller fragments that are expected to have lower values of FD. However, small fragments could possibly present higher values of taxonomic diversity, supporting our predictions that the bird assembly responds differentially to fragmentation process and environment disturbances. Our results could also help us to predict which species are more vulnerable to these processes and to identify which characteristics better explain the observe differences in FD. Finally, it would be of great interest to combine other diversity measures (phylogenetic and taxonomic) in order to improve our understanding of how the biodiversity responds to environmental constraints. 177 Capturing the Southern Lapwing (Vanellus chilensis) Ricardo A.S. Cerboncini1*, Talita V. Braga1, Luiz H. Varzinczak1, James J. Roper1, Fernando C. Passos1 ǢW83+8!1!&'Õ9f+8!&<!3'1$3£3+-!'329'8=!3T 2-='89-&!&' '&'8!£&3!8!2Æ ID t ABSTRACT t Table of Contents we placed mist-nets in their breeding territories, at least 15 m away from nests. We then walked towards the birds and directed them towards the mist-nets while they tried to distract us away from their nest site. Net locations were chosen to avoid being close to other obstacles (buildings, trees) so that ZKHQELUGVćHGWKH\GLGQRWDOVRDYRLGć\LQJWRZDUGVWKH net. Next, when nestlings were present, we set mist nets in a “V” formation. Then we captured nestlings by hand just before sunset and moved within the V of the nets, where the young birds were released. The adults, in defending the young, returned to the young and landed in the nets. Using this combination of procedures, we captured 78 adult birds during the 2012 and 2013 breeding seasons in southern Brazil. No abandonment of nest, young or territory was observed. These capture methods allowed us to color-band individuals and to study their behavior and ecology. Thus, with our capture methods, lapwings (and other shorebirds) are now possibly used in long-term population and survival studies. r8-$!8&3$'8#32$-2-|+1!-£W$31 POSTER SESSION: FIELD TECHNIQUES & TOOLS FOR CONSERVATION The Southern Lapwing (Vanellus chilensis, Charadriidae) is commonly found in agricultural and urban areas in South America, and it is interesting due to its territorial behaviors associated with its facultative cooperative breeding. Capturing the lapwing, however, is challenging and few studies to date have included the capture and individual marking of birds. +HUHZHGHVFULEHKRZZHGHYHORSHGDQHIĆFLHQWFDSWXUH method for the lapwing during the breeding season by taking advantage of their defensive behavior and using mist-nets at night. First, we located nests prior to hatching and, at night, Page 141, Posters 178 Consumo de Miconia cf. lepidota(melastomataceae) por aves em uma área em estágio médio de sucessão ecológica na Amazônia Central Jos Carlos Rodrigues Soares1*, Roberta Souza de Moura1, Rbia Pereira Ribeiro1, Juliana Soares Vieira2, Louri Klemann Junior1 ǢW2-='89-&!&'&39;!&3&31!A32!9TǣW2-='89-&!&' '&'8!£&31!A32!9 r$!8£39*38'9;!£ǣ|+1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS O gênero Miconia (Melastomataceae) possui um importante papel na dieta e manutenção de diversas espécies de aves {փdփTT ID t ABSTRACT t ID t IUXJ¯YRUDVHPćRUHVWDVWURSLFDLVSRVVXLQGRSRWHQFLDO para ser utilizada como poleiro natural na recuperação de áreas degradadas. Assim, o objetivo deste trabalho foi LGHQWLĆFDUDVHVS«FLHVGHDYHVTXHXWLOL]DUDPMiconia cf. lepidotaFRPRLWHPDOLPHQWDUHPXPDćRUHVWDHPHVW£JLR médio de sucessão ecológica localizada na rodovia AM010, no município de Itacoatiara (AM), contribuindo com informações sobre o seu uso como poleiro natural. Para isso foram utilizadas redes ornitológicas para a captura de aves entre agosto de 2013 e julho de 2014. Todas as DYHVFDSWXUDGDVIRUDPVDFULĆFDGDVWD[LGHUPL]DGDVH GHSRVLWDGDVHPFROH©¥RFLHQW¯ĆFD2VFRQWH¼GRVHVWRPDFDLV dos espécimes capturados foram retirados e as sementes FRQVXPLGDVIRUDPWULDGDVHLGHQWLĆFDGDV'DVHVS«FLHV de aves capturadas que utilizaram frutos em sua dieta oito consumiram Miconia cf. lepidota. Dentre elas encontram-se WDQWRHVS«FLHVGHDYHVćRUHVWDLVHTXHVHGHVORFDPSRXFR como Pipra aureola, quanto espécies que utilizam ambientes alterados e tem maior capacidade de deslocamento, como Cacicus cela e Ramphocelus carbo. No conteúdo estomacal das aves que consumiram Miconia cf. lepidotaIRUDPLGHQWLĆFDGDV também, sementes de outras nove espécies vegetais. Assim, considerando os resultados obtidos e o fato desta espécie vegetal se desenvolver bem em áreas alteradas, o seu uso como poleiro natural pode contribuir para a recuperação de áreas degradadas através da atração de aves frugívoras e da dispersão de sementes de diferentes espécies por ornitocoria. 179 $Q£OLVHFRPSDUDWLYDGDWD[DGHSUHGD©¥RGHQLQKRVDUWLĆFLDLV Page 142, Posters ABSTRACT t Table of Contents HPXPD£UHDGHH[SORUD©¥RćRUHVWDOQD$PD]¶QLD&HQWUDO Roberta Souza de Moura1*, Rbia Pereira Ribeiro1, Jos Carlos Rodrigues Soares1, Louri Klemann Junior1 ǢW2-='89-&!&'&39;!&3&31!A32!9 r83#'8;!13<8!,|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION A predação de ninhos naturais vem sendo sugerida como a SULQFLSDOFDXVDGRGHFO¯QLRGHSRSXOD©·HVGHDYHVLQćXHQFLDQGR a estrutura e o funcionamento das comunidades. Apesar de diversos fatores terem sido estudados e relacionados com a variação nas taxas de predação, poucos avaliaram os efeitos GRPDQHMRćRUHVWDOVXVWHQW£YHOVREUHHVWDVWD[DV$VVLP o presente trabalho teve como objetivo avaliar o efeito do PDQHMRćRUHVWDOVXVWHQW£YHOVREUHDWD[DGHSUHGD©¥RGH QLQKRVHPXPDćRUHVWDGHWHUUDĆUPHQD$PD]¶QLD&HQWUDO 3DUDLVVRIRUDPLQVWDODGRVQLQKRVDUWLĆFLDLVHPWU¬V diferentes áreas, localizadas no município de Silves (AM), sendo 20 ninhos em uma área de preservação permanente, 20 em XPD£UHDTXHVRIUHXPDQHMRćRUHVWDOQRDQRGHH em uma área que ainda será manejada. Metade dos ninhos foi instalada no solo e metade no sub-bosque, a 1.5 metros de altura. O experimento permaneceu montado por 15 dias e foi repetido duas vezes, entre dezembro de 2014 e abril de 1¥RKRXYHGLIHUHQ©DVLJQLĆFDWLYDHQWUHDSUHGD©¥R dos ninhos de solo (média 3.17 ninhos predados) e de subERVTXHP«GLD+RXYHGLIHUHQ©DVLJQLĆFDWLYDHQWUH as áreas amostradas, sendo que a área manejada, a área de reserva e a área a ser manejada tiveram, respectivamente, médias de 2.25, 3.00 e 4.75 ninhos predados. A menor {փdփTT ID t ABSTRACT t taxa de predação na área manejada pode estar relacionada FRPDDOWHUD©¥RGDHVWUXWXUDćRUHVWDOHFRQVHTXHQWH afugentamento de predadores nestas áreas exploradas. 180 Differentiated microhabitat selection by the Southern Bristle-Tyrant when in mixed-species ćRFNVDQGLPSOLFDWLRQVIRULWVFRQVHUYDWLRQ Vinicius Tonetti1*, Marco Aurlio Pizo1 ID t ABSTRACT t Table of Contents water, respectively. Results showed that P. eximius can occur in locations with different regeneration stages and that has ecological plasticity to use different microhabitats depending on the association type. Preservation of bodies of water in areas where the species occurs is an important conservation strategy. In cases of management or possible re-introduction, the presence and quality of these bodies should be considered. Conservation plans should also focus on the nuclear species of PL[HGćRFNVIROORZHGE\P. eximius, and their preferred habitats. ǢW'6!8;!1'2;3&' 33£3+-!T-3£!83 r=8;32'ষ|+1!-£W$31 POSTER SESSION: HABITAT USE Habitat selection studies have assumed an urgency to predict effects of natural environment changes on birds. Phylloscartes eximiusLVDWKUHDWHQHG$WODQWLF)RUHVWHQGHPLFć\FDWFKHU and its biology is poorly known. It can be found alone, in SDLUVRULQPL[HGVSHFLHVćRFNV7KHDLPRIWKLVVWXG\ZDV to analyze its microhabitat selection in the Cantareira State Park, SE Brazil. For this, 145 circular random plots were compared with another 54 plots centered where birds were detected foraging. The plots had a 5-m radius within which 15 environmental variables were measured. GLM were used to model the probability of a plot being random or used by the species, and a stepwise procedure was performed (using AIC) to select variables. Hierarchical partitioning analysis ZDVSHUIRUPHGZLWKWKHYDULDEOHVVHOHFWHGLQWKHĆQDO*/0 model. Seven environmental variables were associated with WKHRFFXUUHQFHRIELUGVLQPL[HGVSHFLHVćRFNVZKLOHĆYH variables were selected when they were alone or in pairs. The most important variable to determine the occurrence in and RXWRIPL[HGVSHFLHVćRFNVZDVWKHUHOLHIDQGSUR[LPLW\WR Page 143, Posters 181 Rede de interações entre aves frugívoras e plantas em UHVWLQJDVQDWLYDVHUHćRUHVWDGDVQRQRUGHVWHGR%UDVLO Arnaldo Vieira-Filho1*, Helder Araujo1, Maria Regina Barbosa1 ǢW2-='89-&!&' '&'8!£&!!8!Ð#! r!82!£&3,=-'-8!|+1!-£W$31 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS Nós comparamos redes de interação aves frugivora-plantas HQWUHXPD£UHDGHUHVWLQJDQDWLYDHXPDUHćRUHVWDGDQR 1RUGHVWHGR%UDVLODĆPGHLGHQWLĆFDUSRVV¯YHLVHVS«FLHV chave, tanto de aves como de plantas que possam auxiliar QRHQULTXHFLPHQWRHPDQXWHQ©¥RGD£UHDUHćRUHVWDGD$ LGHQWLĆFD©¥RGDVHVS«FLHVFKDYHVHGHXDSDUWLUGDDQ£OLVH de redes de interação aves frugívoras-plantas e do índice de importância de cada espécie de planta na dieta das aves (e viceYHUVDb3DUDWDQWRIRUDPUHDOL]DGDVREVHUYD©·HVGLUHWDVGH eventos de frugivoria e analisado amostras de fezes obtidas de indivíduos capturados com redes de neblina entre outubro de HVHWHPEURGH&RPRUHVXOWDGRYHULĆFDPRVTXHD área nativa apresentou uma maior riqueza de espécies, tanto {փdփTT ID t ABSTRACT t de aves como de plantas, e uma menor compartimentalização GDUHGHGHLQWHUD©·HV7DPE«PYHULĆFDPRVXPDVXEVWLWXL©¥R tanto das espécies de aves como de plantas que apresentaram os maiores índices de importância e os maiores números de interações quando comparamos as duas áreas estudadas. Diante disso, sugerimos que a maior compartimentalização GDUHGHGHLQWHUD©·HVHQFRQWUDGDSDUDRUHćRUHVWDPHQWR pode ser explicada tanto pela diferença na composição das espécies de aves e plantas como por uma menor riqueza YHJHWDOHQFRQWUDGDQD£UHDUHćRUHVWDGDDVVLPQ¥RVXSRUWDQGR espécies de aves responsáveis por manter a conectividade da rede, como observado na restinga nativa. Com base nesses resultados, indicamos o plantio de espécies de plantas chave, como Myrcia bergianaDĆPGHSURSRUFLRQDUXPD maior disponibilidade de frutos e manutenção da avifauna frugívora observada na restinga na área restaurada. 185 Assessment of species limits in Anthus hellmayri complex based on songs, morphological and mitochondrial sequence data Heraldo Norambuena1*, Pedro Victoriano1, Paul Van Els2, Victor Raimilla3 ID t ABSTRACT t Table of Contents monophyly in two subspecies (hellmayri and brasilianus) of the A. hellmayri complex, so that new information on biological aspects (i.e., songs, morphology) and a complete genetic sampling (including dabbenei) could contribute to understanding GLYHUVLĆFDWLRQLQWKHVSHFLHV:HHYDOXDWHGWKHVSHFLHVOLPLWV in A. hellmayri complex by using songs, morphological and mitochondrial sequence data (cytochrome b). There was substantial cytochrome b sequence divergence (uncorrected) EHWZHHQWD[DFXUUHQWO\WUHDWHGDVFRQVSHFLĆFhellmayri vs. brasilianus (7.6%), dabbenei vs. brasilianus (4.4%) and dabbenei vs. hellmayri (6.3%). The territorial songs of dabbenei differed IURPWKHRWKHUWZRVXEVSHFLHVLQĆYHSDUDPHWHUVOHQJWKRI song, maximum frequency, delta frequency, trill peak frequency and trill duration), while the differences between hellmayri and brasilianus were only in two parameters (maximum frequency and delta frequency). Discriminant function analysis based on songs and morphological characteristics recognized three different clusters corresponding to the three subspecies (with 87% accuracy). This study agrees with previous results on the paraphyly of A. hellmayri complex, and supports the idea that these taxa are different species. Further analysis including nuclear genes will be necessary to corroborate these results. ǢW'6!8;!1'2;3&' 33£3+!T !$<£;!&&'-'2$-!9!;<8!£'[email protected] $'!23+8)$!9T2-='89-&!&&'32$'6$-2TǣW3<-9-!2!;!;' 2-='89-;@T<9'<13(!;<8!£$-'2$'TǤW83+8!1!&'!+9;'8'2 -'[email protected]!#38!;38-3&'$3£3+!T2-='89-&!&&'39!+39 r#<;'32-9|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY Anthus hellmayri has three subspecies (hellmayri, brasilianus and dabbenei), allopatrically distributed in grasslands of southern South America. Molecular phylogenetic studies suggest non- Page 144, Posters {փdփTT ID t ABSTRACT t 186 )UXJLYRU\OHYHOLQćXHQFHVLQWKHQHVWHGUDQNDQG specialization in plant-frugivore birds network Adriano Marcos Silva1*, Celine Melo2 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-!TǣW2-='89-&!&'9;!&<!£&'!16-2!9 r!&8-!23W#-3£3+-!|@!,33W$31W#8 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS Several morphological, ecological and taxonomic traits LQćXHQFHWKHUROHWKDWELUGVSHFLHVSOD\LQSODQWIUXJLYRUH interaction networks. We tested the hypothesis that some bird WUDLWVLQćXHQFHVSHFLHVOHYHOSURSHUWLHVLQDSODQWIUXJLYRUH network. To build a weighted interaction matrix, we used fecal samples of birds captured in mist nets. Each sample with seeds was considered one interaction register. Captures ZHUHFRQGXFWHGLQDVHPLGHFLGXDOIRUHVWLQ8EHUO¤QGLD Brazil, a region in the Cerrado biome, during four campaigns between June 2013 and December 2014. As bird traits we used frugivory level (obligate, partial and opportunistic frugivore), body mass, beak width and wing length. As specieslevel metrics we measured nested rank, specialization (d’) and species strength. The relationship between species-level metrics and bird traits was evaluated separately for each variable using linear mixed effects models. We recorded 8 bird species, 16 plants and 87 interactions. Frugivory level was related with nested and specialization, being the obligate frugivores more generalist within the network. None of the morphological traits were related with the other variables. Obligate frugivorous birds consumed a large range of fruit species due to the higher dependence on this resource, while opportunistic species consume relatively few fruit species. As frugivores assemblage was dominated by small-bodied Page 145, Posters ID t ABSTRACT t Table of Contents VSHFLHVPRUSKRORJLFDOWUDLWVZHUHVLPLODUSOD\LQJQRVLJQLĆFDQW effect in network metrics. Support: FAPEMIG, CAPES 187 Variación estacional de la dieta de Bubo virginianus (Strigiforme: Strigidae) en la reserva nacional de junín, pasco-junín, Perú Karol Natalie Lavado-Solis1*, Carlos Menacho1, Katya Balta-Obadie1 ǢW!#38!;38-3&'9;<&-39&'-3&-='89-&!&T2-='89-&!& '8<[email protected]';!23'8'&-!T-1!f'8Ú r0!83£W£!=!&3Wǣǡǡǥ|+1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS La dieta de Bubo virginianus fue estudiada y analizada en cuatro estaciones (verano, otoño, invierno y primavera) en la zona de amortiguamiento de la Reserva Nacional de Junín, Perú. La metodología consistió en analizar la composición de 242 egagrópilas enteras mediante el método húmedo para disgregar luego se separó cada componente de acuerdo a, tipo de ítem alimenticio, estructura (hueso, pelo, pluma, y material quitinoso) y número mínimo de individuos de cada ¯WHPSRUHJDJUµSLODSDUDVXSRVWHULRULGHQWLĆFDFLµQ&RPR resultado la dieta está compuesta por 846 presas y 33 ítems, distribuidos en 90.9% roedores, 6.3% aves y 2.8% artrópodos. /DFRPSRVLFLµQGLHWDU¯DSUHVHQWµVLJQLĆFDWLYDYDULDELOLGDG HVWDFLRQDOFRQH[FHSFLµQGHOLQYLHUQR !\3 y consumo de diversas presas encontrando Cavia schudii, Mus musculus y Phyllotis xanthopygus en verano y otoño. Los cricétidos presentaron mayor abundancia durante el otoño, ya que en este periodo su población tienden a incrementarse numéricamente como producto del ingreso de individuos jóvenes a la población y a decaer durante la primavera y el {փdփTT ID t ABSTRACT t verano por la elevada tasa de mortalidad causada por factores climáticos, disminución de recursos y efecto de predación. La dominancia de Calomys spp. en la dieta se explicaría por el grado de perturbación del área. Considerando la abundancia y los ciclos de actividad conocidos de las especies presas consumidas B. virginianus se comporta como depredador generalista especializado en el consumo de roedores, de hábitos de caza pasivo, crepuscular y nocturno en ambientes abiertos, además puede ser considerado especie indicadora GHFDOLGDGDPELHQWDO\GHPRJU£ĆFDGHVXVHVSHFLHVSUHVD 188 Pathogens in ticks (Acari: Ixodidae) collected from wild birds in Costa Rica. Maria Ogrzewalska1*, Ivan Literk2, Miroslav Capek3, Oldrich Sychra2, Víctor Caldern4, Bernardo C. Rodríguez4, Carlos R. Prudencio5, Thiago F. Martins ǢW <2&!39>!£&38<A29ধ;<;39>!£&38<A!#38!;8-3&'!2;!=-839'9 '-$0'ħ9-39'9TǣW'6!8;1'2;3(-3£[email protected]!2&-£&£-('-9'!9'9T !$<£;@3( ';'[email protected]@+-'2'!2&$3£[email protected]='89-;@3(';'[email protected]!2&,!81!$'<ধ$!£ $-'2$'9823TǤW29ধ;<;'3('8;'#8!;'-3£[email protected]$!&'[email protected]($-'2$'93(;,' A'$,'6<#£-$TǥW'8=-$-3!$-32!£&'!£<&2-1!£TǦW29ধ;<;'&3£(3<;A r1!8-!W3+8A'>!£90!|-3$W)3$8<AW#8 POSTER SESSION: PARASITISM & AVIAN DESEASES The purpose of this work was to investigate the presence of bacteria from the genus Rickettsia in ticks parasitizing wild birds in Costa Rica. Birds were trapped at seven locations in Costa Rica during 2004, 2009, and 2010, and then visually examined IRUWKHSUHVHQFHRIWLFNV7LFNVZHUHLGHQWLĆHGDQGSDUWRIWKHP were tested individually for the presence of pathogens by PCR. A total of 1878 birds were examined, of which 163 (9%) were Page 146, Posters ID t ABSTRACT t Table of Contents infested with 388 ticks of the genera Amblyomma and Ixodes. The following species were found: Amblyomma longirostre, Amblyomma calcaratum, Amblyomma coelebs, Amblyomma sabanerae,Amblyomma varium, Amblyomma maculatum, and Amblyomma ovale, Ixodes minorDQGWZRXQFODVVLĆHG species, designated here to Ixodes sp. genotype I, and Ixodes sp. genotype II. Twelve of 24 tested A. longirostre ticks were infected with Rickettsia amblyommii and 2 of 4 A. sabanerae were infected with Rickettsia bellii. Eight of 10 larval Ixodes minor were infected with an endosymbiont, a novel Rickettsia sp. agent. We report the occurrence of I. minor in Costa Rica for WKHĆUVWWLPHDQGDQXPEHURIQHZELUGKRVW"WLFNDVVRFLDWLRQV Moreover, R. amblyommii and R.bellii were found in A. longirostre and A. sabaneraeUHVSHFWLYHO\LQ&RVWD5LFDIRUWKHĆUVWWLPH and show the importance of wild birds as host for ticks and their possible involvement in epidemiology of rickettsioses. 190 Parasitism of wild birds by ticks (Acari: Ixodidae) from Republic of Honduras Marketa Novakova1*, Ivan Literk1, Luis Chavez2, Thiago F. Martins3, Maria Ogrzewalska4, Marcelo B. Labruna3 ǢW'6!8;1'2;3(-3£[email protected]!2&-£&£-('-9'!9'9T !$<£;@3(';'[email protected]@+-'2'!2& $3£[email protected]='89-;@3(';'[email protected]!2&,!81!$'<ধ$!£$-'2$'9823TǣW29ধ;<;'3( '8;'#8!;'-3£[email protected]$!&'[email protected]($-'2$'93(;,'A'$,'6<#£-$TǤW'6!8;!1'2;3 &''&-$-2!';'8-28-!8'='2ধ=!'!Ú&'2-1!£T !$<£&!&'&''&-$-2! ';'8-28-!' 33;'$2-!T2-='89-&!&'&'3!<£3TǥW <2&!39>!£&38<A r23=!03=!1!8|=(<W$A POSTER SESSION: PARASITISM & AVIAN DESEASES Ixodid or hard ticks (Acari: Ixodida: Ixodidae) are blood-feeding ectoparasites of wild and domestic vertebrates. Ticks occur {փdփTT ID t ABSTRACT t ID t worldwide and are capable of transmitting a broad range of human and animal pathogens. Wild birds play an important role as hosts for ticks and as disseminators of potentially infected ectoparasites among distant areas. To investigate a possible role of wild birds as hosts for ectoparasites in the Republic of Honduras, wild birds were trapped by ornithological mist nets at two study locations: Jardín Botánico Lancetilla, lowland close to the Carribean coast, and on Isla de Utila, a small island in the Caribbean Sea. Trapped birds were examined for the presence of ectoparasites, including ticks. Ticks were collected during naked-eye examination using tweezers and preserved LQHWK\ODOFRKRO7LFNVDIWHUWD[RQRPLFDOLGHQWLĆFDWLRQ were individually tested for the presence of pathogens from the genera Rickettsia by PCR. In total, 280 birds were captured and, overall, 25 birds (9%) were found parasitized by ticks. Two species of ticks were found: Amblyomma longirostre and A. nodosum. These species are neotropical, the adult stages feeding primarily on porcupines in the case of A. longirostre, and on anteaters in the case of A. nodosum. Subadult stages feed primarily on birds. Additionally, ticks were found to be infected with Rickettsia amblyommii -organisms of suspected pathogenicity to humans. Further studies are crucial to verify the role of birds as hosts for ticks and their complex role in the epidemiology of tick-borne diseases. 195 ,QćXHQFHRIFRORXUDQGGLVWXUEDQFHRQ Page 147, Posters ABSTRACT t Table of Contents FRQVXPSWLRQUDWHRIDUWLĆFLDOIUXLW%UD]LO Vanessa Fonseca Gonalves1*, Flávio Roque Bernardes Camelo1, Melo Celine1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r=!2'99-2,!i(+|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Fruit consumption by birds may also be affected by human GLVWXUEDQFHDQGE\WKHHGJHHIIHFW7KHXVHRIDUWLĆFLDOIUXLWV is a useful tool to record fruit consumption by birds because it allows some variables to be controlled, such as colour and size, as well as the assessment of interactive effects between variables like environment and color. The goals were to GHWHUPLQHLIWKHFRQVXPSWLRQUDWHRIDUWLĆFLDOIUXLWLQDUHDVZLWK high levels of human disturbance is greater than less degraded areas and if there is a relationship between the consumption rate and the edge-interior gradient in the study areas. Three areas of semi-deciduous forest were selected in Brazil, which KDGDUWLĆFLDOIUXLWRIIRXUGLIIHUHQWFRORUVSODFHGDWDVSDFHRI 1.5 to 2 meters in plants without fruit in a gradient of 0-100 meters from the edge, every 10 meters. The consumption rate ZDVKLJKHUIRUWKHDUWLĆFLDOIUXLWVFRORUHGUHGLQWKHDUHDWKDW was less degraded. There was a negative linear relationship IRUWKHFRQVXPSWLRQRIDUWLĆFLDOIUXLWVLQWKHHGJHLQWHULRU gradient, from yellow in Panga, to green in Gloria and for the color purple in São José. The coloration and areas with GLIIHUHQWOHYHOVRIDQWKURSRJHQLFGLVWXUEDQFHLQćXHQFHWKH UDWHRIFRQVXPSWLRQRIDUWLĆFLDOIUXLWLQIUDJPHQWVRIVHPL deciduous forest, showing a preference for red coloration {փdփTT ID t ABSTRACT t and higher consumption in less degraded areas. In addition, there was a higher rate of consumption in an outer edge environment than in the interior of the areas studied, showing that the edge effect can affect the consumption of fruits. 199 Vocal repertoire of the blue manakin Chiroxiphia caudata Laura M. Schaedler1*, Lilian T. Manica1 ID t ABSTRACT t Table of Contents 672 to 1728 Hz, lasting from 0.22 to 0.61 seconds. Call H was SURGXFHGRQO\GXULQJćLJKWGLVSOD\VDQGFDOOV$%&DQG* were produced while birds were perched at the surroundings of the display arena. Calls D, E and F were produced in both situations. Our study provides new detailed information on blue manakin vocal display that should be used to elucidate female choice for male courtship characteristics and, ultimately, the evolutionary history of the sexual system of this species. ǢW2-='89-&!&' '&'8!£&3!8!2Æ r9$,!'&£'8W£!<8!|+1!-£W$31 POSTER SESSION: BIOACOUSTICS Many species of Pipridae have been investigated in terms RIWKHLUDFRXVWLFDQGćLJKWGLVSOD\VKRZHYHUVWXGLHVRQWKH blue manakin (Chiroxiphia caudata) remain scarce. In a lek polygyny sexual system, it is possible that females assess PDOHVèTXDOLW\WKURXJKWKHLUćLJKWDQGYRFDOFRXUWVKLSGLVSOD\V Here, our aim was to identify and describe the variety of song elements, based on bioacoustic parameters, and the behavioral contexts produced by males of blue manakins at Mananciais da Serra protected area, Piraquara, PR, Brazil. We observed and recorded vocalizations of nine individuals, DQGIXUWKHUDQDO\]HGVRXQGĆOHVZLWK5DYHQpVRIWZDUH:H LGHQWLĆHGHLJKWVRQJHOHPHQWVWKDWFDQEHGLYLGHGLQWRWZR groups of calls: those with and without frequency modulation. In the former group, notes A, B, C, D, F, G and H varied from weakly modulated with descendent patterns (B and C) to strongly modulated with one or two ascension peaks (A, D, F, G and H). Mean duration of the calls was between 0.01 and 0.35 seconds, while frequency bandwidth varied from 633 to 5455 Hz. Note E was the only note without frequency modulation and comprised by multiple harmonics varying from Page 148, Posters 200 Modelo de hábitat de Colibri coruscans en la precordillera del Norte de Chile Bojana Kuzmicic1*, Cristian C.F Estades1 ǢW2-='89-&!&&',-£' r#3/!2!W8'(|+1!-£W$31 POSTER SESSION: HABITAT USE Desde los primeros registros–hace unas tres décadas–del SLFDćRUD]XOColibri coruscans) en el extremo Norte de Chile, esta especie se ha expandido a gran parte de la precordillera. Existen evidencias que la presencia de Eucalyptus podría representar un elemento importante en la selección del hábitat GHOSLFDćRU\SRUORWDQWRHQVXH[SDQVLµQ'HVDUUROODPRV un modelo de hábitat de C. coruscans para contribuir al conocimiento del hábitat de la especie, entender su expansión de rango y comprender las consecuencias de la introducción de especies. Realizamos un muestreo de abundancia durante los otoños del 2012 y 2013 en la precordillera de la región de Arica y Parinacota. En cada uno de los puntos de muestreo describimos la vegetación en un círculo de 200 metros de radio, en aquellos que se registró C. coruscans, caracterizamos {փdփTT ID t ABSTRACT t el hábitat en un radio de 50 metros. Además, realizamos observaciones detalladas de conducta y comportamiento de forrajeo de algunos individuos durante el 2013. Para detallar el K£ELWDWGHOSLFDćRUFRPSDUDPRVODVPHGLDVHQWUHODVFREHUWXUDV a 50 y 200 metros y entre las de los datos con y sin presencia de C. coruscans. También usamos un modelo generalizado lineal (GLM) para determinar qué variables explican de mejor forma la abundancia de la especie. Detectamos presencia de C. coruscans en 7 de 70 puntos (2012) y 13 de 62 puntos (2013). El Eucalyptus resultó fundamental en todos los análisis UHDOL]DGRVVLHQGRODYDULDEOHP£VLPSRUWDQWH\VLJQLĆFDWLYD para explicar la presencia de la especie. Estos árboles son utilizados para la alimentación y territorio, lo que los transforma HQFODURVHVWUXFWXUDGRUHVGHOK£ELWDWGHOSLFDćRUD]XO 201 Censo de aves aquáticas no Parque Estadual Do Rio Doce, Minas Gerais Lucas Pagani-Passos1*, Miguel Rico, Karina Felipe Amaral1 ǢW TǣW29ধ;<;3&''97<-9!!6-3$! r£<$!9166Ǣ|@!,33W$31W#8 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION O Parque Estadual do Rio Doce (PERD), em Minas Gerais, é a terceira maior região lacustre do país, sendo considerada uma Zona Úmida de Importância Internacional, segundo a Conferência de Ramsar. As zonas úmidas são locais fundamentais nos ciclos de vida da fauna. Para as aves aquáticas são de extrema importância, sendo local de concentração para o descanso, alimentação e reprodução. O presente trabalho tem como objetivo o censo e monitoramento de aves aquáticas GR3(5'YHULĆFDQGRDLPSRUW¤QFLDGHVXDVODJRDVFRPRORFDO Page 149, Posters ID t ABSTRACT t Table of Contents de reprodução, descanso e invernada e avaliar a distribuição HGHPRJUDĆDGDVDYHVDRORQJRGRVDQRV$W«DJRUDIRUDP realizadas seis campanhas, entre os anos de 2012 a 2015. O monitoramento foi através do censo direto de aves aquáticas e de dormitórios de garças. Um total de 40 espécies de aves aquáticas, pertencentes a 16 famílias, foram registradas em 22 lagoas do PERD e região, sendo que dez espécies não estavam presentes no plano de manejo. Entre elas houve duas espécies migratórias oriundas do hemisfério norte: Tringa solitária e Sterna hirundo. De forma geral, e também por espécie, não IRUDPREVHUYDGDVGLIHUHQ©DVVD]RQDLVVLJQLĆFDWLYDVQRXVR GDVODJRDVSHODVDYHVDTX£WLFDV$EDL[DćXWXD©¥RQRVQ¯YHLV da água, a estabilidade dos diferentes ambientes lacustres do PERD, e a segurança de ser uma área protegida devem LQćXHQFLDUVREUHHVVDHVWDELOLGDGHQDFRPXQLGDGHGHDYHV aquáticas. O estudo ainda continua, visando conhecer as diferenças no uso de cada ambiente pelas diferentes espécies. 202 Censo populacional em ninhal de Mycteria americana no Rio São Francisco, Bahia, e relato de cleptoparasitismo por Caracara plancus Lucas Pagani-Passos1*, Thiago Filadelfo2, Jose Amorim Reis-Filho1 ǢW TǣW r£<$!9166Ǣ|@!,33W$31W#8 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION O cabeça-seca (Mycteria americana) é uma ave da família Ciconidae que ocorre do sul da América do Norte até a Argentina. O período reprodutivo ocorre durante a estação seca, quando grandes grupos se concentram em ninhais. {փdփTT ID t ABSTRACT t ID t ABSTRACT t Table of Contents Poucos relatos abordam a presença dessa espécie na região 203 Natural brood parasitism by Shiny Cowbird nordeste do Brasil e mais escassas são as informações sobre (Molothrus bonariensis) in Central Brazil sua reprodução. O presente estudo objetivou descrever Thiago Filadelfo1*, Miguel . Marini1 uma colônia reprodutiva de cabeça-seca, determinando seu ǢW2-='89-&!&'&'8!9£-! período reprodutivo e o tamanho populacional da colônia. r;,-!+3i#-3<ö!|@!,33W$31W#8 Oportunisticamente relatamos interações alimentares de POSTER SESSION: NESTING BIOLOGY & REPRODUCTION carcarás (Caracara plancus) no ninhal. A colônia situa-se Brood parasitism directly affects hosts? reproductive success, nas lagoas marginais do Rio São Francisco no município de by reducing clutch size, hatching success and nestling survival. Malhadas, Bahia. Cinco expedições foram realizadas em 2011 The Shiny Cowbird (Molothrus bonariensis) is an obligate com intuito de monitorar este ninhal, sendo conduzidos censos LQWHUVSHFLĆFEURRGSDUDVLWHZLWKPRUHWKDQNQRZQ mensais de adultos e juvenis. Os ninhos estavam distribuídos host’ species. Little is known about the species suffering em 11 árvores com média de altura de, aproximadamente, natural brood parasitism in Brazil and even less about how PHWURV$FRO¶QLD«PRQRHVSHF¯ĆFDHM£FRQKHFLGDSHORV these hosts respond to parasitism. The goal of this study moradores da região. Em concordância com a literatura, o ninhal was to gather natural brood parasitism records in Central se tornou ativo em maio, inicio da estação seca. Os censos Brazil, assess M. bonariensis breeding biology data and its DSRQWDUDPDSUHVHQ©DGHĆOKRWHVGHMXQKRDRXWXEURFRP effects on host’ population. Fieldwork was conducted in P£[LPRGHĆOKRWHVHPDJRVWR1 $VREVHUYD©·HVPHQVDLV the Federal District, Central Brazil, during 2012 and 2013 indicam que a população adulta da colônia seja de cerca de breeding seasons. A total of 424 nests from 45 species were 120 indivíduos. O comportamento de cleptoparasitismo por found and 61 nests (14%) of 12 species were recorded being carcará foi observado em diversas ocasiões; os mesmos foram naturally parasitized by the Shiny Cowbird. Nests with brood ćDJUDGRVSRXVDGRVSUµ[LPRDRVQLQKRVêURXEDQGRëSHL[HV parasitism were only recorded from August to January, with trazidos pelos pais que se encontravam caídos no ninho e a peak in October. Single (only one parasite egg) and multiple no seu entorno. Ninhais são ambientes frágeis e podem ser (more than one parasite egg) brood parasitism events had considerados bioindicadores de qualidade ambiental, assim similar accounts, respectively, 29 and 32 nests; with multiple o monitoramento contínuo dessa área deve ser realizado. parasitism reaching up to six eggs. A total of 132 eggs of the cowbird were found, 90 of those were lost due to predation, egg rejection or failure in incubation. 42 eggs hatched but only 33 nestlings left the nest successfully. The Chalk-browed Mockingbird (Mimus saturninus, n=23) and the Pale-breasted Thrush (Turdus leucomelas, n=11) were the most parasitized Page 150, Posters {փdփTT ID t ABSTRACT t species. Our data offer some insights into cowbird productivity and its actual impact on host population in Central Brazil. 205 First description of São Francisco Sparrow (Arremon franciscanus) females Vitor Torga (V.T.) Lombardi1*, Marcelo Ferreira de Vasconcelos2 ǢW'6!8;!1'2;3&'-3£3+-!2-1!£T2-='89-&!&' '&'8!£&' -39!TǣW32ধ($-!2-='89-&!&'!;£-$!&'-2!9'8!-9 ID t ABSTRACT t Table of Contents ćDQNVDQGVLGHVRIWKHERG\JUH\WKLJKVJUH\ZDVKHGZKLWH It appears that there are no differences in measurements and mass between the sexes. The only exception is wing chord that is longer in males. Females of A. franciscanus are very similar to those of Arremon semitorquatus and it is possible that these two species are closely related, taking into account the overall similarities of these two species and the presence of a black chin spot, a possible synapomorphy for both species. r=-;38;38+!|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY Arremon franciscanus is a restricted range species endemic to the Caatinga of north-eastern Brazil. This is a recently described species, known by only 8 specimens deposited in 3 Brazilian ornithological collections. Of them, 7 are males DQGLVXQVH[HG,QUHFHQWĆHOGZRUNVLQ&DDWLQJDRI%DKLD and Minas Gerais states, Brazil, we obtained 15 additional specimens of A. franciscanus: 6 females and 9 males. Thus, the aim of this study is to describe the plumage of females of A. franciscanus, which remained unknown. We used these new specimens and 2 other adult males collected in Minas Gerais for comparing plumage features and measurements among sexes. Plumage descriptions were based on Munsell Soil Color Charts (1975). Measurements were taken using electronic digital callipers and specimens were also weighed just after collecting, using Pesolas. The overall aspect of adult females’ plumage is very similar to that of adult males. The most striking differences are their pale yellow underparts that are white in males. Other details that differ males include: superciliary brighter white; pileum grey; bend of wings and underwingcoverts brighter yellow; wider and brighter pectoral band black; Page 151, Posters 207 Bird assemblages on areas isolated by polyculture: an alternative for conservation Thiago Moura1*, Erica C. Nolasco2, Caio G. Machado3 ǢW2-='89-&!&'9;!&<!£&' '-8!&'!2;!2!W83+8!1!&'Õ9f +8!&<!3'1 33£3+-!TǣW2-='89-&!&'9;!&<!£&' '-8!&'!2;!2!W 83+8!1!&'Õ9f+8!&<!3&'3&'£!+'1'1-Í2$-!9&!'88!' &31#-'2;'TǤW2-='89-&!&'9;!&<!£&' '-8!&'!2;!2! r13<8!ħ,-!+3|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Habitat fragmentation causes changes on biological systems. 7RXQGHUVWDQGWKHVHPRGLĆFDWLRQVZHDQDO\]HWKHVWUXFWXUH of bird assemblages in forest patches isolated by polyculture at Bahia, northeastern Brazil. We conducted the research at Fazendas Reunidas Vale da Juliana, covering 4.822 ha, where the vegetation is mainly Ombrophilous Forest isolated by polycultures of cocoa, latex and banana. We surveyed, by point count, the bird assemblages from January to November 2014 on three landscape units: Forest, Polyculture and the Border between the two. The bird assemblages were structured by diversity, forest dependency, stratum of vegetation where {փdփTT ID t ABSTRACT t the birds were observed, trophic group and abundance. There was no variation on diversity between the landscape units. However, we found differences on the medium and high stratum, and the presence of forest dependents on the Polyculture and Border. The stratum use, associated with each species ecological plasticity, indicates structural connectivity of the landscape units by the medium and high strata. The presence of forest dependent species on the Border and Polyculture reveals a larger effective area for these species, suggesting a reduction of the edge effect. Matrixes with varied plantation are able to sustain bird assemblages with wide requirements, enlarging the effective area of interior forest birds and contributing to the conservation of local community. 208 Parásitos em Nycticorax nycticoraxem Chile Daniel Gonzlez-Acua1*, Armando Cicchino2, Danny Fuentes2, Mike Kinsella3 ǢW2-='89-&!&&'32$'6$-2TǣW2-='89-&!&!$-32!£&' !8&'££!;!T8+'2ধ2!WTǤW'£1'9;!#38!;[email protected] ID t ABSTRACT t Table of Contents al centro de rescate de la Universidad de Concepción, Chile y aquellos que murieron se les realizó necropsia parasitológica. Los piojos fueron aislados y almacenados en alcohol al 70%, posteriormente fueron montados en Bálsamo de Canadá. Los nematodos fueron aclarados con lactofenol y los platelmintos teñidos con carmín para su SRVWHULRULGHQWLĆFDFLµQ(QODVY¯VFHUDVIXHURQFROHFWDGRV los helmintos Contracaecum rudolphii Hartwich, Contracaecum microcephalum Rudolphi (Nematoda: Anisakidae), Avioserpens sp. (Nematoda: Dracunculidae), Polymorphus brevis (Van Cleave) (Acantocephala: Polymorphidae), Echinostoma sp. (Trematoda: Equinostomidae). En el plumaje fueron colectados los piojos Ciconiphilus decimfasciatus (Boisduval and Lacordaire, 1835) (Phthiraptera: Menoponidae) y Ardeicola goisagi Uschida (Phthiraptera: Philopteridae). No se observó la presencia de ácaros. Todos los parásitos acá colectados corresponden a nuevas relaciones hospedador parásito y constituyen además nuevos resportes para la diversidad parasitológica de Chile. (VWXGLRĆQDQFLDGRSRUHOSUR\HFWR)RQGHF\W r&!2-+32A|<&'$W$£ POSTER SESSION: SYSTEMATICS & TAXONOMY Los parásitos pueden causar variados y extensos efectos VREUHODĆVLRORJ¯DPRUIRORJ¯D\FRPSRUWDPLHQWRGHODV aves. Pueden producir además disturbios en la habilidad termorreguladora, reducción de la masa corporal, alteración de procesos de selección sexual y abandono temprano del nido. Un ave muy común en los humedales neotropicales es el Nyctocorax nyctocorax, sin embargo el conocimiento sobre su parasitofauna es aún poco conocido. En el presente estudio, se analizó la parasitofauna de huairavos que llegaron Page 152, Posters {փdփTT ID t ABSTRACT t 209 Total concentrations of mercury and selenium in feathers of waterbirds from Babitonga Bay, south of Brazil Daniela Fink1*, Brbara Manhes2, Natlia Beloto2, Wendel Barbosa2, Marta J. Cremer1, Jos Lailson-Brito2 ǢW83+8!1!&'Õ9f8!&<!3'1!&'''-31#-'2;'W!#38!;8-3&'$3£3+-!&' $399-9;'1!939;'-839T2-='89-&!&'&!'+-3&'3-2=-££'l2-=-££'mT ǣW!#38!;8-3&'!1('8397<ধ$39'-3-2&-$!&38'9 83(!WA!#'£<8+'£lmT !$<£&!&'&'$'!23+8!)!T 2-='89-&!&'&39;!&3&3-3&'!2'-83lm ID t ABSTRACT t Table of Contents 1 in dry weight were found in the feathers, a value which is considered high and could bring some risk to the breeding of waterbirds. The differences in mercury concentrations IRXQGEHWZHHQWKHVSHFLHVFDQUHćHFWGLHWDU\KDELWV0RVW individuals presented selenium values > 1.000 ng.g-1 in dry weight; however, this concentration is not considered harmful to birds. Monitoring and environmental contamination analyses of the region due to high concentration of mercury found in feathers of N. nycticorax are recommended. r&!2-W)20|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Mercury is a non-essential, toxic and bioaccumulative trace element for living beings. Selenium is a micronutrient essential to the development of many organisms, but can become toxic at high concentrations. Waterbirds are used as indicators of contaminants in the environment due to their elevated position in the food chain. The purpose of this study was to determine mercury and selenium concentrations in feathers of waterbirds in the Babitonga Bay. Breast, wing, and tail feathers were collected from seven individuals from three species of the Ardeidae family birds: Nycticorax nycticorax (2), Nyctanassa violacea (3), and Egretta caerulea (2). These samples were found frozen at a temperature of -16°C, within the period of 2008-2011, in the Birds Collection of the Biological Collection Iperoba. The feathers have undergone a cleaning process. The total mercury determination was made in an atomic spectroscopic with cold steam generation and selenium in an atomic spectroscopic with electrothermal atomization. Total mercury concentrations of N. nycticorax > 3.000 ng.g- Page 153, Posters 210 First record breeding of Eudocimus ruber in Babitonga Bay, south of Brazil Daniela Fink1*, Marta J. Cremer1 ǢW83+8!1!&'Õ9f8!&<!3'1!&'''-31#-'2;'W!#38!;8-3&'$3£3+-! &'$399-9;'1!939;'-839T2-='89-&!&'&!'+-3&'3-2=-££'l2-=-££'m r&!2-W)20|+1!-£W$31 POSTER SESSION: DIVERSITY & DISTRIBUTION There are few records of Eudocimus ruber in the state of Santa &DWDULQDVRXWKHUQ%UD]LODQGWKLVVSHFLHVLVFODVVLĆHGDV FULWLFDOO\HQGDQJHUHGRQWKHVWDWHVRIĆFLDOOLVWRIWKUHDWHQHG VSHFLHV7KHDLPRIWKLVVWXG\ZDVWRGHVFULEHWKHĆUVWEUHHGLQJ event of the Eudocimus ruber in Santa Catarina. The species bred in a mixed colony in Jarivatuba Island, a mangrove area inside Babitonga Bay. Between August 2011 and March 2012, fortnightly samplings were made with the aid of a motor boat in order to collect basic information about the breeding HYHQWRIWKLVVSHFLHV7KHĆUVWDGXOWRI(UXEHUZDVUHFRUGHG on November 4, 2011, at the same time period in which a group of Plegladis chihi was nesting in the area. Adults in {փdփTT ID t ABSTRACT t incubation position in the nests were recorded on January 5, 7KHĆUVWFKLFNVZHUHREVHUYHGRQ-DQXDU\$WRWDO RIQHVWVZHUHUHFRUGHGGLVWULEXWHGEHWZHHQĆYHEUHHGLQJ nuclei: four in the central region and one on the coast of the island. In March 2012 few adults remained in the colony and DERXWMXYHQLOHVZHUHREVHUYHGć\LQJLQDJURXSDERYHWKH colony and its surroundings. The species produced only one breeding pulse. We believe that the individuals came from colonies in the state of São Paulo. If this is the case, they had traveled about 200 km in a straight line. Although there is no human settlement on the island, the region suffers from many anthropic disturbances. Creation of a protected area would be a suitable long-term strategy for the conservation of this species, as well as of the regional ecosystem. 213 Frugivoria por aves em Miconia albicans(sw.) Triana, em área de cerrado sensu stricto do triângulo mineiro, MG Luis Pedro Mendes Paniago1*, Adriano Marcos Silva1, Giancarlo ngelo Ferreira1, Vitor Carneiro de Magalhes Tolentino1, Celine Melo1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!TW r1'2&'96!2-!+3|,3;1!-£W$31 ID t ABSTRACT t Table of Contents Estrela do Sul-MG. Foram feitas observações focais em seis indivíduos de M. albicans (30h), para cada visita foi registrado: espécie, tempo de permanência na planta, número de frutos consumidos e estratégia de consumo (Engolir, Particular e Predar). A efetividade do frugívoro como dispersor de semente 6'(IRLPHQVXUDGDDWUDY«VGRSURGXWRQ¼PHURGHYLVLWDV KRUDGLYLGLGRSHORQ¼PHURP«GLRGHIUXWRVUHWLUDGRVYLVLWD Foram registradas 14 espécies, sendo 69 visitas com consumo de frutos de M. albicansIUXWRVsIUXWRVYLVLWD Quanto à SDE, destacaram-se 3LUDQJDćDYD (1,46), Tangara cayana (0,90) e Zonotrichia capensis (0,86). A estratégia de consumo mais utilizada foi engolir (61%) na qual o fruto é ingerido inteiro. Os frutos de M. albicans foram consumidos por aves de três guildas (Frugívora, Granívora e Insetívora) o TXHFRQWULEXLSDUDXPDGLYHUVLĆFD©¥RQDGLVSHUV¥RGHVXDV sementes, por exemplo, quanto ao modo e sítio de deposição. M. albicansSRVVXLIUXWRVSHTXHQRVFDVFDĆQDQXPHURVDVH pequenas sementes, o que a torna pouco seletiva em relação ¢VVHXVGLVSHUVRUHVDXPHQWDQGRDHĆF£FLDQDSURSDJD©¥R de sementes e recrutamento de novos indivíduos. Apoio: FAPEMIG, CNPq, CEMIG, DURATEX S.A., PPGECO-UFU. POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS $GLVSHUV¥RGHVHPHQWHVLQćXHQFLDQDGHQVLGDGHGLVWULEXL©¥R de plantas, na colonização e manutenção da diversidade de espécies. Miconia albicans (Melastomataceae) é uma espécie pioneira do Cerrado, cujos frutos são dispersos SUHGRPLQDQWHPHQWHSRUDYHV2REMHWLYRGHVWHIRLGHĆQLU a avifauna que contribui na dispersão de sementes de M. albicans em uma área de cerrado sensu stricto do Triângulo Mineiro. O estudo foi realizado na Faz. Nova Monte Carmelo, Page 154, Posters {փdփTT ID t ABSTRACT t 214 Avaliação de micronúcleos em duas espécies PLJUDWµULDVGRJ¬QHURElaenia em área de cerrado Luis Pedro Mendes Paniago1*, Camilla Queiroz Baesse1, Adriano Marcos Silva1, Vitor Carneiro de Magalhes Tolentino1, Giancarlo ngelo Ferreira1, Celine Melo1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!TW r1'2&'96!2-!+3|,3;1!-£W$31 ID t ABSTRACT t Table of Contents isolamento e melhor conservação da área propicia menor ação de agentes tóxicos, que resultou em menor formação de micronúcleos nas espécies residentes, ocorrendo o contrário em Elaenia, sugerindo que o contato com distintas áreas durante a migração as expõe a condições que favorecem a formação de micronúcleos. Apoio: FAPEMIG (CRA-APQ01654-12), &13T3(/'&(0,*33*(&28)8 POSTER SESSION: MIGRATION A análise de micronúcleos possibilita a detecção de efeitos genotóxicos provocados por agentes físicos e químicos, como SROXL©¥RHLQVXPRVDJU¯FRODVVHQGRXPDIHUUDPHQWDHĆFD] para biomonitoramento. É possível que espécies migratórias estejam mais sujeitas a estes efeitos devido à transição por diferentes ambientes. O objetivo foi detectar a presença de PLFURQ¼FOHRVHTXDQWLĆFDORVHPGXDVHVS«FLHVFRQJ¬QHUHV Elaenia mesoleuca e E. parvirostris, e comparar com a média da avifauna local, de um fragmento de mata estacional em MG. Foram realizadas três campanhas de captura com redes de QHEOLQDHPKUHGHV3DUDFDGDLQGLY¯GXR capturado foram confeccionadas duas extensões sanguíneas Ć[DGDVHP0HWDQROHFRUDGDVFRPVROX©¥RDGH*LHPVDH WDPS¥RIRVIDWR)RUDPDQDOLVDGRVHULWUµFLWRVLQGLY¯GXR em microscópio óptico. A quantidade de micronúcleos de cada espécie de Elaenia foi comparada com a média da comunidade através do Teste t para uma amostra. Foram analisadas 42 lâminas (21 indivíduos) e encontrados 69 micronúcleos. A média de micronúcleos da comunidade (obtido através de 121 indivíduos de 30 spp. residentes) foi 0,54. Ambas espécies de Elaenia apresentaram média de micronúcleos maior (xmeso.= 2,71, xparv.= 3,57; p<0,001) que a média da comunidade. O Page 155, Posters 215 A Diversidade de avifauna brasileira nas GLIHUHQWHVĆWRĆVLRQRPLDVGR&HUUDGR Carmen Dionsio1,2*, Tlio Dornas1, Marcelo de Oliveira Barbosa1, Renato Torres Pinheiro1 ǢWf T2-='89-&!&' '&'8!£&33$!2ধ29 ǣW'6!8;!1'2;3&'-3£3+-!T2-='89-&!&'&'='-83 r$!81'2£&-32-9-3|+1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY O Cerrado é constituído por um conjunto típico de ĆWRĆVLRQRPLDVTXHDSUHVHQWDXPPRVDLFRYDULDGRGHKDELWDWV conferindo-lhe uma grande diversidade de espécies. No entanto, o conhecimento sobre a avifauna deste bioma é escasso e pouco se sabe sobre a sua composição e distribuição. A principal questão a ser respondida é: existe um padrão GHELRGLYHUVLGDGHQDVĆWRĆVLRQRPLDVGR&HUUDGR"$ĆPGH responder a esta pergunta, foi feito um levantamento de aves QDVGLIHUHQWHVĆWRĆVLRQRPLDVFRPRIRQWHGHLQIRUPD©¥RGH ULTXH]DHVSHF¯ĆFDHFRPSRVL©¥RHPHVS«FLHV'LIHUHQ©DVGH SUHVHQ©DDXV¬QFLDGHHVS«FLHVHQWUHDVĆWRĆVLRQRPLDVFHUUDGR e mata foram avaliadas a nível local. Neste trabalho foram acrescentadas 52 novas espécies para a Fazenda Ecológica, Palmas (TO) e reunidos dados da avifauna de vários locais {փdփTT ID t ABSTRACT t do Brasil pertencentes ao bioma Cerrado. Foram registadas 145 espécies de aves distribuídas por 40 famílias, das quais Thraupidae e Tyrannidae com maior número de espécies presentes. Dentro destas o cerrado apresentou maior percentagem de espécies comparativamente com a mata. Os resultados na Fazenda Ecológica, revelam uma expressiva diversidade biológica com a presença de espécies amazónicas como Campephilus rubricollis e Melanerpes cruentatus,e de espécies endémicas do Cerrado como Saltatricula atricollis e Cyanocorax cristatellus. Para além disso,foram analisados padrões de biodiversidade e similaridade dos registos através da comparação com outros estudos, onde parece existir a nível global um padrão de biodiversidade das famílias UHSUHVHQWDGDVQDĆWRĆVLRQRPLDPDWD$GLFLRQDOPHQWH percepções de correspondência entre as diferentes regiões numa escala continental são aqui apresentadas. ĉ Distribuição de aves de sub-bosque em zonas ripárias e não ULS£ULDVHPXPDćRUHVWDXUEDQDQD$PD]¶QLD&HQWUDO Urnia Cavalcante Ferreira1*, Cintia Cornelius1, Welliton Wilson Mendona Martins1 ID t ABSTRACT t Table of Contents SUR[LPLGDGHGHLJDUDS«VFRPRREVHUYDGRHPćRUHVWDVQ¥R perturbadas e se o efeito de borda gerado pelo processo de urbanização afeta negativamente a distribuição da avifauna local. Caracterizamos a avifauna de sub-bosque em uma ćRUHVWDXUEDQDGH0DQDXV$0HPV¯WLRVULS£ULRVH sítios não ripários, no período de julho a novembro de 2013. Capturamos 27 espécies e um total de 118 indivíduos. O número de indivíduos e o número de espécies não variaram entre os sítios ripários e não ripários, bem como a composição quantitativa da assembleia de aves não se diferenciou nos sítios estudados. Observamos uma relação positiva entre a biomassa de aves e a distância à borda nos sítios ripários e um padrão inverso nos sítios não ripários. A similaridade aumentou entre pares de sítios ripários mais próximos à borda. Nossos resultados sugerem que o efeito de borda gerado pelo processo de urbanização é o fator determinante sobre a falta de diferenciação das aves de sub-bosque entre os sítios ripários e não ripários. Além disso, apontam para a necessidade de se considerar vários aspectos da qualidade do habitat, principalmente a manutenção da heterogeneidade QDWXUDOHLQWHJULGDGHGDV]RQDVULS£ULDVGHQWURGDćRUHVWD especialmente naquelas onde o efeito de borda é mais intenso. ǢW2-='89-&!&' '&'8!£&31!A32!9 r<8!2-!W$(|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Efeitos negativos produzidos por perturbações antrópicas interferem diretamente sobre a riqueza e abundância de DYHVHPćRUHVWDV1RVVRREMHWLYRIRLFRQKHFHUVHHPXPD ćRUHVWDFRPIRUWHLQćX¬QFLDXUEDQDDVDVVHPEOHLDVGH espécies de aves respondem à variação ambiental gerada pela Page 156, Posters {փdփTT ID t ABSTRACT t 218 $VVLPHWULDćXWXDQWHHPAntilophia galeata (Passeriformes: Pipridae) e seu uso no biomonitoramento GHIUDJPHQWRVćRUHVWDLVGRFHUUDGR Camilla Queiroz Baesse1*, Vitor Carneiro de Magalhes Tolentino1, Adriano Marcos da Silva1, Giancarlo ngelo Ferreira1, Lus Pedro Mendes Paniago1, Celine de Melo2 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W83+8!1! &'Õ9f8!&<!%È3'1$3£3+-!'329'8=!3&''$<8939!;<8!-9T ǣW2-='89-&!&' '&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W r$!1-££!#!'99'|+1!-£W$31 POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY Assimetria Flutuante (AF) é a diferença entre lados de caracteres com simetria bilateral, sendo um sensível método de biomonitoramento. Antilophia galeata é abundante em ćRUHVWDVFRPGLIHUHQWHVQ¯YHLVGHSHUWXUED©¥RSRVVLELOLWDQGRD comparação da AF entre populações. O objetivo foi determinar HFRPSDUDUD$)WDUVRVDVDVGHA. galeata entre quatro £UHDVGHćRUHVWDVVHPLGHFLGXDLVQR7UL¤QJXOR0LQHLURVHQGR GXDVPDLRUHVHDIDVWDGDVGDFLGDGHJXD)ULD*DOKHLURH GXDVPHQRUHVSUµ[LPDV¢FLGDGH*OµULD6¥R-RV«$VDYHV foram capturas com 25 redes de neblina, totalizando 1600 KRUDVUHGHV£UHD2VLQGLY¯GXRVFDSWXUDGRVIRUDPDQLOKDGRV &(0$9(,&0%LR7DUVRVHDVDVIRUDPPHGLGRVWU¬VYH]HV FRPSDTX¯PHWURGLJLWDOP«GLDDULWP«WLFD3DUDYHULĆFDU variação de AF entre áreas foram realizados testes Anova. Foi observada AF para A. galeata (69 indivíduos). Entre as áreas, houve diferença da AF para asa (p=0,001) e tarso (p=0,05). A. galeataVHGHVORFDHPWRGRRHVWUDWRYHUWLFDOUHćHWLQGRHVVDV variações na AF de acordo com o ambiente. Galheiro foi à área com maior AF, seguida por São José, Glória e Água Fria. Page 157, Posters ID t ABSTRACT t Table of Contents As características do sub-bosque podem explicar a variação da AF das aves entre as áreas, pois afeta o deslocamento destas quando mais denso. Galheiro e São José possuem sub-bosque denso devido ao estágio sucessional secundário inicial. Glória e Água Fria apresentam sub-bosque limpo, por se encontrarem em estágio sucessional avançado. A. galeata pode ser utilizada como biomonitora de ambientes ćRUHVWDLVSRLVDSUHVHQWRXUHOD©¥RQHJDWLYDHQWUHD$)HD qualidade ambiental. Apoio: FAPEMIG (CRA-APQ01157-13), &13T3(/'&(0,*33*(&28)8 219 Behind the red eyes: ontogeny of sexual dimorphism in iris color of Dixiphia pipra (Pipridae) DQGDSSOLFDWLRQWRĆHOGRUQLWKRORJ\ Joao V.C. Silva1*, Maira R. Rizzi2, Beatriz S. Conceicao2, Marina Anciaes2 ǢWf$3£3+-!T TǣWTf r/=6-'&!&'|+1!-£W$31 POSTER SESSION: BEHAVIOUR In Manakins, sexual dimorphism occurs mainly after plumage color maturation. Besides the typical variation in plumage observed in Dixiphia pipra, individuals present a range of iris colors (brown, oranges and reds) that remain undescribed as pure ontogenetic changes or sexual dimorphism. Here we tested the existence of sexual dimorphism in iris color in the species and describe its development comparing individuals at GLIIHUHQWPROWVWDJHV:HVDPSOHLULVFRORUDQGLGHQWLĆHGWKH SOXPDJHSKDVHRILQGLYLGXDOVLQWKHĆHOGDQGVH[HGWKHP XVLQJVWDQGDUGPROHFXODUWHFKQLTXHV:HREVHUYHGDVLJQLĆFDQW association between iris color, sex and molting limits. The ontogeny of iris color also varied between sexes: brown irises {փdփTT ID t ABSTRACT t appeared early in all offspring and switches from light and dark orange to light and dark red, earlier in males than females. Later development of the typical male dark red iris in female are likely due to decreasing hormonal production in older females, which leads to the expression of male characteristics in birds. Because all individuals with dark red iris in formative phase were males, irises may be used as a secondary sexual trait expressed earlier than plumage maturation. Based on RXUGDWDJUHHQSOXPDJHGELUGVLQWKHĆUVWIRUPDWLYHSKDVH ZLWKPROWOLPLWVDQGOLJKWRUGDUNUHGLULVHVFDQEHLGHQWLĆHG LQWKHĆHOGDVPDOHVZKHUHDVWKRVHZLWKRXWPROWOLPLWV presenting light red irises will have 75% probability of being females and about 80% of being males if irises are dark red. 220 Uso da condição corporal em aves no biomonitoramento GHIUDJPHQWRVćRUHVWDLVGRFHUUDGR Camilla Queiroz Baesse1*, Vitor Carneiro de Magalhes Tolentino1, Adriano Marcos da Silva1, Giancarlo ngelo Ferreira2, Lus Pedro Mendes Paniago1, Celine de Melo2 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W83+8!1! &'Õ9f8!&<!%È3'1$3£3+-!'329'8=!3&''$<8939!;<8!-9T TǣW2-='89-&!&' '&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W r$!1-££!#!'99'|+1!-£W$31 ID t ABSTRACT t Table of Contents estacionais semideciduais do Triângulo Mineiro. Água Fria e Galheiro: grandes e distantes de cidade, Glória e São José: pequenas e próximas à cidade. As aves foram capturas com UHGHVGHQHEOLQDHPGXDVFDPSDQKDV£UHDKRUDVUHGH 2VLQGLY¯GXRVFDSWXUDGRVIRUDPDQLOKDGRV&(0$9(,&0%LR medidos (tarso direito) com paquímetro digital e pesados com dinamômetro manual. O IMR foi obtido a partir de regressão OLQHDU3DUDYHULĆFDUYDULD©¥RQR,05GDVDYHVHQWUHHVS«FLHV e áreas foram realizados testes Anova. Foram analisadas 17 espécies (304 indivíduos). O IMR das aves diferiu entre espécies (p<0,01) e áreas (p=0,05), sendo as aves do Glória com maior IMR seguidas por, Água Fria, São José e Galheiro. As espécies capturadas apresentam características distintas, FRPRGLIHUHQWHVJXLOGDVK£ELWRVTXHSRGHPLQćXHQFLDUQR IMR. Glória e Água Fria possuem estágio sucessional avançado da vegetação, caracterizado por grande diversidade biológica, portanto maior quantidade e diversidade de recursos. São José e Galheiro apresentam sucessão ecológica secundária LQLFLDOSRULQćX¬QFLDGDFRQVHUYD©¥RHKLVWµULFRGHXVRGDV £UHDVUHćHWLQGRPHQRUGLVSRQLELOLGDGHGHUHFXUVRV2,05 das aves é afetado negativamente quando há perda de qualidade ambiental. Apoio: FAPEMIG (CRA-APQ01654-12), &13T3(/'&(0,*33*(&28)8 POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY Índice de Massa Relativa (IMR) avalia condição corporal através da estimativa das reservas nutricionais baseada na biomassa e no comprimento de uma medida rígida. As aves são indicadoras da qualidade ambiental por possuírem sensibilidade às mudanças ambientais. O objetivo foi determinar se IMR GDVDYHVYDULDHQWUHHVS«FLHVHTXDWUR£UHDVGHćRUHVWDV Page 158, Posters {փdփTT ID t ABSTRACT t 221 Matrix role on the bird community diversity pattern in patches of the Brazilian Atlantic Forest Fagner D. Teixeira1*, Fernando Cesar Cascelli Azevedo2 ǢW TǣW r(!+2'8&!2-|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES The Brazilian Atlantic Forest is restricted to small isolated patches in all its extension and, as a consequence, the majority of its fauna is declining and under extinction risk. This is observed due mainly to the habitat loss and other negative effects that take place on patches in a landscape, especially the edge effect. Nevertheless, it is important to be careful while JHQHUDOL]LQJVLQFHGLIIHUHQWPDWULFHVFDQLQćXHQFHSDWFKHVLQ distinct levels. For example, planted forest phytophysionomies can act as barriers to the edge effect when compared to open areas. Therefore, we hypothesize that patches in contact with a matrix mainly composed of eucalyptus would have more diverse bird community. We assessed the richness (ANOVA), abundance (Whittaker Diagram) and functional diversity (Petchey & Gaston 2002, Ecology Letters. 5) of birds present in the edge and inside patches of Atlantic Forest (Minas Gerais, Brazil) surrounded by pastures (n=4) and by eucalyptus trees (n=4). Even though all the studied patches showed low species richness and approximate values, the eucalyptus matrix seems to favor the bird community, that showed bigger richness (F=70.5, p<0.05) and evenness in the border of the fragments surrounded by eucalyptus. Furthermore the community in contact with the eucalyptus matrix had a greater functional diversity (average 1.2 higher), abundance of groups generally Page 159, Posters ID t ABSTRACT t Table of Contents sensitive to disturbances (large frugivorous) and presence of a threatened species (Pyroderus scutatus). Regarding the current state of the Brazilian Atlantic Forest, it is important to give more attention to the matrix composition where the patches are found, especially to the eucalyptus plantation. 223 Bird Functional Diversity across a forest fragmentation gradient in Atlantic Forest Gabriela M Bochio1*, Hugo R Medeiros2, Luiz dos Anjos1 ǢW2-='89-&!&'9;!&<!£&'32&8-2!TǣW2'96-3£!83 r+!#8-'£!#3$,-3|@!,33W$31W#8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Habitat fragmentation in tropical forests continues to cause loss of biodiversity and its consequences on functional diversity remains poorly understood. We investigated the patterns of functional diversity in bird communities on a set of 14 forest fragments across a gradient of size, connectivity and forest cover in a forest fragmented landscape in Southern Brazil. We evaluated three different aspects of functional diversity (FD): functional richeness, evenness, and divergence. We also compared the observed patterns of FD as measured by each FD indexes with expectations for random assemblages to infer DERXWDVVHPEO\UXOHVOLPLWLQJVLPLODULW\DQGKDELWDWĆOWHULQJ Additionally, we examined the effects of landscape variables on the measures of FD. We expected low values of FD compared WRUDQGRPFRPPXQLWLHVLQGLFDWLQJWKDWKDELWDWĆOWHULQJLVWKH dominant mechanism structuring bird communities in our fragmented landscape. Birds were censured in each forest fragment using point counts during four months in the spring {փdփTT ID t ABSTRACT t and summer. Contrary to our expectations, in most cases the REVHUYHGYDOXHVRI)'GLGQRWGLIIHUVLJQLĆFDQWO\IURPWKRVH expected by chance. For the most isolated forest fragment in our system, the functional evenness was higher than expected by chance, indicating that may be the bird community is more resilient to environmental changes. Variation in bird functional richness was explained by area, forest cover, and connectivity. Functional eveness showed no clear pattern and functional divergence was explained by forest cover and connectivity. 224 Occupancy and population estimates for the cock- of-the-rock (Rupicola rupicolaLinnaeus 1766) in APA Maroaga, Amazonas State, Brazil N. Sohn1*, M. Anciaes1 ǢWTf ID t ABSTRACT t Table of Contents information on the conservation status of the species in the target area. Habitat variables were not in the best model of VLWHRFFXSDQF\LQVSLWHRIĆHOGREVHUYDWLRQVLQGLFDWLQJWKDW the species occupied mainly Campinarana forests. Detection rates were low (0 ? 20%), even when detection was favored by weather condition and vegetation type, or within areas suitable for breeding (detection = 5.5%). The minimum population size estimated was 77915 individuals in a sampled area of 696.39 km2. Although possibly a methodological artifact, these numbers may prevent the inclusion of the species in any category of threat, but the necessity for monitoring and management of protected areas are emphasized in order to avoid that the species become vulnerable due to the strong SUHVVXUHIURPDQLPDOWUDIĆFNLQJ2XUUHVXOWVSURYLGHG population parameters that can be used to monitor the species and establish local strategies for its conservation. r2!;!$,!93,2|+1!-£W$32 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY The cock-of-the-rock (Rupicola rupicola, Cotingidae) is endemic to the Guianan shield and associated to forests with rock outcrops. In Amazonas state, it occurs locally around Presidente Figueiredo. Due to its conspicuous morphological and behavioral traits, the species suffers with animal WUDIĆFNHUVLQFUHDVLQJXUEDQL]DWLRQDQGFRQWLQXRXVYLVLWDWLRQ to nesting areas. Previous studies mapped suitable areas for its occurrence in the region. However, there are no estimates of population parameters and local habitat requirements for the species. We estimated probabilities of site occupancy and detection for different habitats, as well as population size and density of the cock-of-the-rock in APA Maroaga to provide Page 160, Posters 225 Abundance of Scarlet Ibis Eudocimus ruber in Babitonga bay, North Coast of Santa Catarina state, Brazil Alexandre V. Grose1*, Marta J. Cremer2, Nei Moreira1 ǢW TǣW r!£'W+839'|,3;1!-£W$31 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY Scarlet ibis (Eudocimus ruber) occurred in Santa Catarina state, Brazil, but was considered extinct in the last 150 years. In late 2011 the species was again observed in the estuary of Babitonga Bay, north coast of Santa Catarina state. The stablishment of a breeding colony indicated a good prospect for restocking and growth. Our objective was to estimate {փdփTT ID t ABSTRACT t population abundance by counting the number of adult individuals. Between July 2012 and March 2015 monthly scans with motorboat were conducted on the margins of the estuary to count the number of individuals. We started counts, in July (2012) with only 17 individuals. The highest number of individuals were registered always in December, 78 individuals in 2012, 282 individuals in 2013 and 563 individuals in 2014. That represents an increase of 261% in abundance between 2012 and 2013. In December 2014, 563 individuals were recorded in the bay, which represents an increase of 99% between 2013 and 2014. Along this years the highest abundance always preceded the breeding season, occurring between October and December, and reduced during the winter months, where we made the lowest counts. The dispersion of youngs and adults over a large area, searching for new feeding areas outside the breeding season, is a characteristic of the species. Despite the increasing trend, the data indicate probably stabilization DQGVKRXOGEHLQćXHQFHGE\WKHVXSSRUWFRQGLWLRQVRIWKH region. This growth brings hope for the species to become common again in the region and in southern Brazil. 226 Song structure and organization in the Saffron Finch (6LFDOLVćDYHRODSHO]HOQL) Mara Juliana Benitez Saldivar1*, Viviana Massoni1 ID t ABSTRACT t Table of Contents Adult males are golden yellow colored with olive-streaked, black upperparts and they are commonly caged as pets due to their color and pleasant, melodious song. This species is listed as being of “least concern”, but the pet trade seems to be reducing their population in Buenos Aires Province in Argentina. Even though this is a relatively common species, a complete description and function of its song is lacking to date. The aim of this study is to provide a characterization of the organization and variability of the song in this species. We present an analysis for one population of breeding males at a nest box assemblage placed at Chascomús, Buenos Aires, Argentina. We examined patterns of syllable and song diversity from 1,021 songs from 48 males (N=31 in the 2014-2015 breeding season; N= 17 in the 2013-2014 breeding season), using one recording for each male. The population syllable repertoire represents over 90 syllables with an individual repertoire of 13 ± 4.6 (mean ± SD) syllables and an average number of syllables per song of 9 ± 4.1. Finally, we found that many syllables are shared by most males, yet their placement in each song and the frequency of use is variable. This preliminary study of song structure shows that the population overall repertoire is large. Moreover, this characterization will enable assessment of potential differences between immature and mature males’ song and, consequently, whether acoustic communication has a relevant role in mate choice. ǢW2-='89-&!&&'<'239-8'9 r/#'2-;'A|'+'W($'2W<#!W!8 POSTER SESSION: BIOACOUSTICS The Saffron Finch, 6LFDOLVćDYHRODSHO]HOQL, is a South American secondary cavity-nester with delayed plumage maturation. Page 161, Posters {փdփTT ID t ABSTRACT t 227 (FRORJLFDOQLFKHPRGHOLQJLQSUDFWLFHćDJVKLS species and regional conservation planning N. Sohn1*, M. H. Fernandez2, M. Papes3, Marina Anciaes1 ǢWTfTǣWTǤW0£!,31!2-='89-;@ r2!;!$,!93,2|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Conservation of rare or endemic species is a multifaceted matter, especially whenever knowledge gaps in species’ distribution and anthropogenic pressures converge. We combined Geographic Information Systems and ecological QLFKHPRGHOLQJWRROVZLWKĆHOGGDWDWRFKDUDFWHUL]HWKH habitat types used for different behavioral activities and to identify important areas for conservation of a charismatic bird endemic to northeast South America, the Guianan cock of-the-rock (Rupicola rupicola). Using species occurrences and climatic, topographic, and remotely sensed vegetation variables, we developed potential distribution models at two scales: (1) broad geographic scale (northern South America), based on georeferenced occurrences obtained from literature and natural history museum specimens, and ORFDOVFDOHSUHFLVH*36FRRUGLQDWHVUHFRUGHGLQWKHĆHOG (Caverna do Maroaga Protected Area, Amazonas, Brazil). :HLGHQWLĆHGVL[SULRULW\DUHDVIRUWKHFRQVHUYDWLRQRIWKH species corresponding to high environmental suitability and lowest anthropogenic pressure, measured as distance from XUEDQDUHDVDQGKLJKZD\V3URWHFWLQJWKHDUHDVLGHQWLĆHGLQ this study from anthropogenic threats such as hunting and selective logging will help to preserve not only the cock-of-therock, but also the biodiversity of the whole mosaic of habitats in the region. Our results were incorporated in a regional Page 162, Posters ID t ABSTRACT t Table of Contents management plan developed by state agencies and nongovernmental organizations. Modeling techniques combined with on the ground, local surveys can be useful in species conservation efforts, for planning new inventories, prioritizing areas to be protected, and for creating ecological corridors. 228 When titans decide to play: playing behavior in young individuals of Rhea americana Linnaeus Marco Antnio P. F. Prado1*, Pedro Ubatan C. Neves1, damo C. Barros1, Elizabeth F. G. Lima1, Carlos A. C Bianchi1 ǢW2-='89-&!&' '&'8!£&'3-9 r1!8$368!&3#-3|+1!-£W$31 POSTER SESSION: BEHAVIOUR The Greater Rhea, the largest bird in South America measuring up to 160 cm, occurs in open natural areas such as grasslands, VDYDQQDKVDQGRSHQ&KDFREXWDOVRLQFXOWLYDWHGĆHOGV,Q%UD]LO it is distributed all over the territory except in the Amazon. 3OD\LQJEHKDYLRULVGHĆQHGDVWKHH[SORUDWLRQRISK\VLFDO and social environment without survival or reproduction purposes, and it is commonly observed in young animals of many species. Playing behavior can comprise several motor patterns such as locomotion, jumping, laying, etc. Here we report playing behavior for a group of young Greater Rheas REVHUYHGDW9DOHGR7DPDQGX£IDUP$UDJRL¤QLD*2%UD]LO during a pre-reintroduction monitoring program. We used focal animal method in all observational sessions, tallying approximately 100 hours of investigation. Each individual was observed for ten minutes and had all behavioral occurrences recorded. Five young Greater Rheas exhibited playing behavior (pooled duration of 54 min), mostly characterized {փdփTT ID t ABSTRACT t by locomotion. Individuals ran straight or in an irregular course. Sometimes, this behavior started with jumps follow by short runs. Usually, when one individual initiated this behavior, the others tended to imitate. Playing behavior lasted on average 10.8 minutes and happened between six and ten in the morning and four and six in the afternoon. Playing behavior comprises activities that help in the learning and practice of particular skills such as motor development. The record of this behavior is important as a contribution to improve the knowledge of the behavioral repertoire in birds. 232 The role of environmental heterogeneity on forest bird diversity in a Reserve in southern Brazil Guilherme Willrich1*, Marcos Robalinho Lima1, Luiz Anjos1 ǢW2-='89-&!&'9;!&<!£&'32&8-2! r+<-+!>-££8-$,|,3;1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY Understanding the role of environmental factors in driving species diversity and distribution is one of the main goals in ecology. In this study, we evaluated if environmental heterogeneity explained differences in bird diversity and composition in a continuous semi-deciduous forest. The study took place in “Parque Estadual Mata dos Godoy” (MG), a 650ha reserve located in the north of Paraná State, southern Brazil. We established seven trails in an upland forest (UF) - located in a 600m a.s.l. plateau, and six trails in a riparian forest (RF), which is located on a slope that ranges from 600 to 450m a.s.l. bordered by the Apertados River. Three point counts with 50m radius were placed at 200m intervals on each trail, giving a total of 39 points (3 X 13). Each point count was replicated Page 163, Posters ID t ABSTRACT t Table of Contents 4 times from September to December 2014. We used bird abundance to test if bird composition was different between the two forest types. We recorded 3118 individuals of 115 bird species, 101 species in RF (18 were exclusive) and 97 in UF (14 were exclusive). Both Cluster Analysis and NMDS (stress 8,7) showed a clear difference in avian composition between the two forest types. Fifty-four species were at least three times more abundant in one of the forest types: 38 species in RF (e.g. Psiloramphus guttatus and Philydor rufum) and 16 species in UF (e.g. Selenidera maculirostris and Dendrocincla turdina). This result shows that environmental heterogeneity plays a key role in the maintenance of forest bird diversity in MG. However, the new Brazilian Forest Code has jeopardized the preservation of riparian forests and conservation policies should give more attention to this forest type. 235 Variações no canto de Herpsilochmus longirostris PHO]HOQ7KDPQRSKLOLGDHHP£UHDVćRUHVWDLV no cerrado com diferentes níveis de ruído Vitor C. M. Tolentino1*, Camilla, Q. Baesse1, Celine Melo1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r=-;38$!82'-83Ǣǣ|@!,33W$31W#8 POSTER SESSION: BIOACOUSTICS Elevados níveis de ruído causados pela proximidade às cidades é considerado um fator que afeta diretamente a comunicação sonora das aves. Algumas espécies ajustam os sinais sonoros em resposta aos altos níveis de ruído, alterando a distribuição de energia da vocalização. Herpsilochmus longirostris é insetívora e bastante abundante em ambientes {փdփTT ID t ABSTRACT t ID t ćRUHVWDLVFRPGLIHUHQWHVQ¯YHLVGHSHUWXUED©¥R2REMHWLYR IRLYHULĆFDUH[LVW¬QFLDGHYDULD©¥RQRVSDU¤PHWURVDF¼VWLFRV de Herpsilochmus longirostris entre áreas com diferentes níveis de ruído causado principalmente por automóveis, caminhões e aviões. As gravações foram feitas com gravador Sony ICDPX312 e microfone direcional Yoga HT-81 em três áreas ćRUHVWDLVQR7UL¤QJXOR0LQHLURVHQGRGXDVFRPEDL[RQ¯YHOGH ruído distantes de áreas urbanas e uma com alto nível de ruído próxima a áreas urbanas durante o período de junho 2013 a fevereiro 2014. Foram gravadas 1107 vocalizações e analisados os parâmetros: frequência dominante, duração do canto e número de notas, utilizando os programas Audacity 2.0 e Raven Pro 1.4. O canto de Herpsilochmus longirostris possui frequência dominante média de 2,201 kHz, duração média de 1,919 s e 21,367 notas. Os cantos dos indivíduos de áreas com alto nível de ruído apresentaram maior frequência dominante, menor duração e menor número de notas em relação aos cantos de áreas com baixo nível de ruído (p < 0,05). A análise dos parâmetros acústicos H. longirostris demonstrou que a espécie pode ser utilizada no biomonitoramento da qualidade ambiental na região por apresentar sensibilidade a altos níveis de ruído. Apoio: FAPEMIG, CNPq, CAPES, CEMIG, PPGECRN-UFU. 236 $OWRVQ¯YHLVGHUX¯GROHYDPDRDXPHQWRGDIUHTX¬QFLD Page 164, Posters ABSTRACT t Table of Contents GRPLQDQWHGRFDQWRGHDYHVHP£UHDVćRUHVWDLVGRFHUUUDGR Vitor C. M. Tolentino1*, Camilla, Q. Baesse1, Celine Melo1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r=-;38$!82'-83Ǣǣ|@!,33W$31W#8 POSTER SESSION: BIOACOUSTICS O repertório vocal das aves sofre constantemente variações causadas por diversos fatores. Fatores antrópicos, como o ruído causado pelas cidades, são considerados os grandes responsáveis pelas alterações na intensidade dos sinais sonoros das aves. Uma resposta bastante comum das aves é o aumento da frequência de seus sinais, levando a um maior JDVWRHQHUJ«WLFR2REMHWLYRIRLYHULĆFDUTXDODLQćX¬QFLD de altos níveis de ruído na frequência dominante do canto de 10 espécies de aves. As gravações foram realizadas com gravador Sony ICD-PX312 e microfone direcional Yoga HTHP£UHDVćRUHVWDLVQR7UL¤QJXOR0LQHLURGXDVFRPEDL[R nível de ruído (Galheiro e Água Fria) e duas com alto nível de ruído (Glória e São José) no período de junho 2013 a fevereiro )RUDPUHDOL]DGRVê7HVWHVWëSDUDYHULĆFDUDH[LVW¬QFLD de diferença entre elas. Foram gravadas 6220 vocalizações das dez espécies. Nove espécies (Antilophia galeata, Basileuterus culicivorus, Cantorchilus leucotis, Cyclarhis gujanensis, Herpsilochmus longirostris, Leptopogon amaurocephalus, Picumnus albosquamatus, Tolmomyias sulphurescens e Venilliornis passerinus) apresentaram maior frequência dominante em áreas com menores níveis de ruído (p < 0,05). Apenas Myiothlypis ćDYHROD não apresentou diferença de frequência dominante entre as áreas (p = 0,535). A frequência do canto das aves geralmente é alterada na faixa que se sobrepõe à do ruído {փdփTT ID t ABSTRACT t SDUDHYLWDUTXHRUX¯GRLQWHUĆUDQDFRPXQLFD©¥RVRQRUD Apesar de a maioria dos estudos demonstrarem alterações na frequência mínima da vocalização, a frequência dominante se mostrou uma boa ferramenta para este tipo de análise. Apoio: FAPEMIG, CNPq, CAPES, CEMIG, PPGECRN-UFU. 237 Riqueza y abundancia de aves rapaces con riesgo potencial de electrocución y colisión con tendido eléctrico en valles cordilleranos de Santiago, Chile Francisco Santander1*, Sergio Alvarado1, Cristin Estades1, Benito Gonzlez1 ID t ABSTRACT t Table of Contents 1 /DDEXQGDQFLDUHODWLYDIXHDOWDHQ&µQGRULQGNP PLHQWUDVTXHHOUHVWRGHODVHVSHFLHVQRVXSHUµORVLQG km2. No detectamos evidencia de electrocución o colisión de aves rapaces durante el estudio pese a que las aves utilizaron ODLQIUDHVWUXFWXUDFRQGLVWLQWRVĆQHVUHJLVWURVGH descansando (93,0%), alimentándose (4,2%) y apareándose (2,7%). Sin embargo, nuestros resultados sugieren que Águila, Carancho cordillerano, Tiuque y Aguilucho (Buteo polyosoma) son especies con un alto potencial de sufrir accidentes debido a su abundancia, actividad a baja altura y tamaño corporal. Se sugiere un monitoreo constante y evaluación de las medidas de mitigación adoptadas por la empresa. ǢW2-='89-;@3(,-£' r($3/9!2;!2|<W<$,-£'W$£ POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Los tendidos eléctricos son responsables de lesiones o muertes por electrocución o colisión de aves rapaces en todo el mundo. Esta situación sería crítica en ambientes montañosos donde la topografía abrupta es un factor que aumenta la accidentabilidad en rapaces. Entre Enero y Octubre del 2014 estudiamos la riqueza, abundancia y riesgo de accidentes de aves rapaces asociadas al tendido de media tensión del proyecto Alto-Maipo en la precordillera de Santiago, Chile. Realizamos conteos PHQVXDOHVGLXUQRVG¯DVSRUPHVHQSXQWRVGHUDGLRĆMR km) y censos de carretera en 3 valles (Colorado, Yeso, Volcán), abarcando 55 km. Detectamos 9 especies de rapaces en al área de estudio: Vultur gryphus (N=206), Milvago chimango (N=31), Geranoaetus melanoleucus (N=22), Phalcoboenus megalopterus (N=16), Buteo polyosoma (N=12), Parabuteo unicinctus (n=12), Falco sparverius (N=9), Falco peregrinus (N=3) y Glaucidium nanum Page 165, Posters 238 Breeding biology of Sporophila lineola(Thraupidae) in the municipality of Florestal, Minas Gerais, Brazil D. F. Ferreira1*, L. E Lopes1 ǢW f$!16<9 £38'9;!£ r&!£-£!#-3ǢǨ|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Sporophila lineola is a migratory species that inhabits a variety of open habitats across much of South America. This study was conducted in the Campus Florestal of the Universidade Federal de Viçosa (19°52’51’’S, 44°24’49’’W), MG, Brazil, and aimed to describe the breeding biology of the species. We monitored 41 active nests at intervals of 2-5 days, from December 2014 to April 2015. Nests are a shallow cup made with vegetable ĆEHUV)HPDOHVDUHUHVSRQVLEOHIRUQHVWEXLOGLQJDQGLQFXEDWLRQ which is asynchronous. Males are responsible for nest guarding and territory defense, with agonistic interactions between S. lineola and Satrapa icterophrys, Pitangus sulphuratus, Sporophila {փdփTT ID t ABSTRACT t nigricollis and &KU\VRPXVUXĆFDSLOOXV. Clutches are of two (78.1% of the nests) or three (21.8%) eggs, which are ovoid shapedand cream colored, covered with brown dots and blotches. ,QFXEDWLRQSHULRGKHUHGHĆQHGDVWKHSHULRGEHWZHHQOD\LQJ RIWKHODVWHJJDQGKDWFKLQJRIWKHĆUVWQHVWOLQJZDVRIs GD\V1HVWOLQJSHULRGKHUHGHĆQHGDVWKHSHULRGEHWZHHQ KDWFKLQJRIWKHĆUVWQHVWOLQJDQGćHGJHRIWKHODVWQHVWOLQJ was of 10 ± 0.8 days. Both sexes feed the nestlings, generally with grass seeds. The simple percentage of successful nests was 29.3%, with 58.5% of the nests predated and 12.2% DEDQGRQHG5HSURGXFWLYHVXFFHVVFDOFXODWHGE\WKH0D\ĆHOG method was 29.8%, with daily survival rates of 0.934 ± 0.014 and 0.954 ± 0.018 during incubation and nestling periods, respectively. We observed that three of the monitored males were mated with more than one female, what is, to the best RIRXUNQRZOHGJHWKHĆUVWUHSRUWRISRO\J\Q\IRU S. lineola. 242 Rede de interações ave-planta: um estudo sobre frugivoria em áreas urbanas do Brasil ID t ABSTRACT t Table of Contents destes dois grupos de plantas. Foi conduzida uma revisão da literatura sobre frugivoria por aves em áreas urbanas do Brasil e a partir desses dados uma meta-análise foi realizada para criar uma rede de interações em escala nacional. Foram incluídos 15 trabalhos na meta-análise com 70 espécies de aves consumindo frutos de 15 espécies de plantas (6 exóticas e 9 nativas), sendo Tangara sayaca a espécie registrada no maior número de trabalhos (n=14) e Tyrannidae a família mais representativa (n=18 spp.). As avifaunas consumidoras de frutos exóticos e nativos não formaram grupos distintos HDUHGHGHLQWHUD©·HVIRLVLJQLĆFDWLYDPHQWHDQLQKDGDFRP um núcleo de espécies generalistas (NODF=0,30; p < 0,01) e não modular (M= 0,36; p= 0,16) i.e sem subgrupos. Duas plantas exóticas fazem parte do núcleo de generalistas da rede (Ficus microcarpa e Michelia champaca). As assembleias de consumidores de frutos nativos e exóticos não formaram grupos diferentes. Os resultados indicam que um grupo UHODWLYDPHQWHGLYHUVLĆFDGRGHDYHVFRQVRPHIUXWRVHP£UHDV urbanas no Brasil de uma maneira oportunista, sem preferência por nativos ou exóticos. Agradecimentos: FAPEMIG Diego Oliveira1*, Alexandre Franchin1, Oswaldo Marcal-Junior1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r&-'+3#-3Ǣǡ|@!,33W$31W#8 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS Teoria de Redes pode ser útil nestes estudos, pois permite avaliar simultaneamente várias espécies de aves e plantas envolvidas em interações. Os objetivos deste trabalho foram avaliar uma rede de interações de frugivoria por aves em DPELHQWHXUEDQRQR%UDVLOYHULĆFDURSDSHOGHSODQWDVQDWLYDV e exóticas na rede e comparar as assembleias de consumidores Page 166, Posters 245 The aerobic metabolism and thermoregulation after exhaustive activity is compromised in the Ornate Tinamou because it’s small heart Jordi Altimiras1*, Lina Giraldo2, Alvaro Garitano-Zavala2 ǢW-206-2+9<2-='89-;';TǣW29ধ;<;3&'$3£3+!T2-='89-&!&[email protected]&'!22&8Ì9 r/38&-W!£ধ1-8!9|£-<W9' POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY 7LQDPRXVDUHDQDQFLHQWIDPLO\RIQHRWURSLFDOć\LQJELUGV Scant data from a few species show that they have a small {փdփTT ID t ABSTRACT t heart so our aim was to characterize relative heart size of two species of the genus Nothoprocta and assess the physiological limitations associated with a small heart size. Relative heart size (0.24% for the Ornate Tinamou OT, a highland species and 0.28% for the Chilean Tinamou CT, a lowland species) ZDVVLJQLĆFDQWO\VPDOOHUWKDQKLJKDQGORZODQGFKLFNHQV (0.54% and 0.42% respectively), without evidence of right ventricular hypertrophy. Resting aerobic metabolism was 31% lower in OT than in highland chickens. When subjected to exhaustive activity, OT had elevated glucose and lactate levels suggesting a severe oxygen debt when exhausted. This ZDVIXUWKHUVKRZQDVDVLJQLĆFDQWGURSLQERG\WHPSHUDWXUH after an exhaustive bout. Finally heart rate while running on a treadmill at 3 km h-1 was 5% lower in OT, indicating that tinamous cannot compensate for the reduction in heart size with a faster heart rate. Altogether, we provide evidence that heart size is a phylogenetically conserved trait among tinamous and that the Ornate Tinamou cannot compensate aerobically for its small heart. Instead, it relies on anaerobic metabolism incurring in a large oxygen debt while exhausted. 247 Dinâmica da comunidade de aves ao longo de GXDVYDUL£YHLVWRSRJU£ĆFDVGHDOWLWXGHQD(VWD©¥R Ecológica de Caetetus (EECa), São Paulo Andreli Dalbeto1*, Guilherme Sementili Cardoso1, Reginaldo Jos Donatelli2 ǢWÕ9f8!&<!%È3'1-Í2$-!9-3£+-$!9l 33£3£+-!mTǣW!#38!;8-3&'82-;3£3+-! ID t ABSTRACT t Table of Contents o isolamento de populações e até extinção de espécies, reduzindo a biodiversidade local em função, principalmente, da perda de habitats e de uma maior incidência de raios solares entre os fragmentos. Ambientes espacialmente heterogêneos proporcionam uma grande variedade de microhabitats, aumentando o espectro de recursos que permitem a ocorrência de várias espécies Este estudo teve como objetivo analisar DVFRPXQLGDGHVGHDYHVHPGXDVYDUL£YHLVWRSRJU£ĆFDVGH altitude Porção Norte (PN - 480m) e Porção Sul (PS - 520m) QD(VWD©¥R(FROµJLFDVGRV&DHWHWXVEXVFDQGRYHULĆFDU suas relações ecológicas quanto a composição de espécies, DEXQG¤QFLDHVWUXWXUDWUµĆFDHHVWUDWLĆFD©¥RGDDYLIDXQDH também testar as possíveis diferenças na comunidade de aves entre os períodos seco e chuvoso nessas duas porções. Nesse estudo utilizou-se o método de Pontos de Contagem durante 12 meses, sendo de 10’ cada ponto equidistante 200m. O levantamento quantitativo registrou 125 espécies para PN e 156 espécies para PS. O Índice Pontual de abundância variou de 0,008 (1 contato) a 0,87 (210 contatos) na PN e de 0,004 (1 contato) a 0,91 (219 contatos) na PS. A diversidade (H’) para PN foi de 3,76 e para PS, 2,68. A comunidade de aves mostrou o mesmo padrão encontrado em outros fragmentos ćRUHVWDLVGHPDWDHVWDFLRQDOVHPLGHFLGXDO*UDQGHSDUWH das espécies exclusivas na ocorreram na PS, o que indica DIRUWHLQćX¬QFLDGDYHJHWD©¥RQDVDYHV-£DDQ£OLVHGD sazonalidade do regime de chuvas na EECa indica que tal IDWRUQ¥RLQćXHQFLRXGLUHWDPHQWHDGLQ¤PLFDGDDYLIDXQD POSTER SESSION: COMMUNITY ECOLOGY A perda e a fragmentação de habitas são as maiores ameaças a diversidade biológica. Essas alterações podem determinar Page 167, Posters {փdփTT ID t ABSTRACT t 249 Taxonomic status of Turdus daguae based on molecular and morphological analyses ID t ABSTRACT t Table of Contents 250 2HIHLWRGRSODQWLRGHGHQG¬Elaeis guineensis Jacq.) na diversidade funcional de aves amazônicas Jano Nez-Zapata1*, Luz Estela ZamudioBeltrn1, Adolfo G. Navarro-Sigenza1 Larissa C. Silva1*, Sara Almeida1, Mara R. Cardoso1, Pablo Cerqueira1, Leandro Juen2, Marcos P. D. Santos3 ǢW<9'3&' 33£3+!T !$<£;!&&'-'2$-!9 ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&' '&'8!£&3!8Æc<9'<!8!'29'1£-33'£&-TǣW29ধ;<;3&' -Í2$-!9-3£+-$!9T2-='89-&!&' '&'8!£&3!8Æl m r/!232!;<8'|@!,33W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY White-throated Robin (Turdus assimilis) is a widespread species distributed from northern Mexico to northwestern Ecuador. Morphological differentiation within the species is ample, and has led to the subdivision of the taxon in more than 10 subspecies, based mainly on plumage color and geographical distribution. One of its subspecies (T. a. daguae) has been sometimes considered different at species level due to the remarkable differences in size and plumage coloration, but no further studies have contributed to clarify its taxonomic situation. Based on molecular and morphological analyses, we determined differences between this and the others subspecies of T. assimilis. Tissue samples from throughout the distribution range were included in the present study. Phylogenetic analyses of mitochondrial DNA showed that samples considered as T. assimilis are separated in two lineages, one of them clustered all samples of T. a. daguae, and the other lineage clustered all the remainig T. assimilis. Multivariate analysis of morphological measurements of museum specimens also supports differentiation of both groups, with T. albicollis, as the sister taxon. All these evidences plus the geographic restriction of T. a. daguae to the Chocó region, suggest that this taxon is a separate species from T. assimilis. Page 168, Posters r£$!8&393#-3|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES O plantio de dendê afeta a diversidade de espécies, mas o conhecimento dos seus impactos sobre os papéis funcionais das mesmas é limitado. Avaliamos a diversidade funcional de aves HPSODQWLRGHGHQG¬HHPIUDJPHQWRVćRUHVWDLVDGMDFHQWHVQD Amazônia Oriental. Amostramos a avifauna através de pontos Ć[RVGHFHQVRVHPSDUFHODVVHQGRTXHWRGDVDSUHVHQWDYDP matas ripárias (APP). Consideramos três tratamentos: Floresta (198 espécies), Palma+APP (144) e Palma (88). Mensuramos a diversidade funcional através dos índices FD (Functional diversity), NRI (nearest relative index) e NTI (nearest taxon index), utilizando 25 características funcionais. O FD foi maior HPćRUHVWDGRTXHHPSDOPDSPDVQ¥RGLIHULXHQWUH ćRUHVWDH3DOPD$33S 215,HR17,LQGLFDUDP UHGXQG¤QFLDIXQFLRQDOQDV£UHDVGHćRUHVWDRXVHMDDVHVS«FLHV são funcionalmente mais similares. Essa redundância confere maior estabilidade à esse ambiente diante de perturbações randômicas. Uma análise de ordenação (RLQ) mostrou que traços generalistas (e.g. onivoria) estão associados às áreas GHSODQWLRHQTXDQWRDćRUHVWDDEULJDRVPDLVHVSHFLDOL]DGRV (e.g. frugivoria). Concluímos que a diversidade funcional de {փdփTT ID t ABSTRACT t DYHVGLPLQXLFRPDFRQYHUV¥RGHćRUHVWDVHPSODQWLRGH SDOPD$SHVDUGD)'Q¥RGLIHULUHQWUHćRUHVWDH3DOPD$33 esse segundo ambiente mostrou-se instável do ponto de vista funcional e a perda aleatória de espécies resultará na perturbação do ecossistema. Assim, faz-se necessário manter IUDJPHQWRVćRUHVWDLVDGMDFHQWHV¢V£UHDVGHSODQWLREHPFRPR ćRUHVWDVULS£ULDVGHQWURGRSODQWLRSDUDJDUDQWLURGHVHPSHQKR de serviços como polinização e dispersão de sementes. 252 La educación ambiental como herramienta de conservación de Ardenna creatopus, Isla Mocha, Chile Verónica López1*, Valentina Colodro1, Peter Hodum1, Cristian Cornejo2, Guillermo Reyes3 Ǣ[email protected];'123>£'&+'TǣW-2-9;'8-3&''&-3 1#-'2;'TǤW38638!$-Õ2!$-32!£ 38'9;!£ r='832-$!|3-03239W38+ POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES (Q,VOD0RFKDQLGLĆFDHOGHODSREODFLµQPXQGLDOGH Ardenna creatopus, ave marina pelágica, migratoria, en peligro de extinción. Se considera que la captura ilegal de polluelos para consumo realizada por la comunidad, puede ser una amenaza, estimándose el año 1998 una captura del 20% de la producción anual? El Gobierno de Chile, a través del Ministerio de Medio Ambiente (MMA) y la Corporación Nacional Forestal (CONAF), en conjunto con la ONG Oikonos, comienzan el año 2011 un trabajo de educación ambiental con los objetivos de: que los isleños conozcan a la especie, su estado de conservación y la ilegalidad del consumo. Lograr identidad de la comunidad con la HVSHFLH\FRQODFRQVHUYDFLµQGHVXćRUD\ODIDXQD&DGDD³R Page 169, Posters ID t ABSTRACT t Table of Contents se organizan diversas actividades, algunas con la participación hasta del 60% de la población de la isla (± 300 personas) a través del arte y la participación comunitaria. Durante todo el año, se trabaja con niños de la Escuela (± 16 niños). Trabajo realizado por isleños capacitados. Se realizan también trabajos con alumnos de la Escuela (± 70 niños): concurso de cuentos, realización de peluches, libro para colorear, entre otras. Se considera que los resultados han sido positivos, obteniendo una buena respuesta de la comunidad. Encuestas muestran un conocimiento del tema por parte de los isleños, pero sin FXDQWLĆFDFLµQGHOFRQVXPRGHODHVSHFLH(OWUDEDMRFRQVWDQWH con la comunidad y la capacitación de guías locales, ha JHQHUDGRODFRQĆDQ]DGHODFRPXQLGDGEXVFDQGRORJUDUXQ compromiso para los esfuerzos de conservación a largo plazo. 253 Are permanent preservation areas within forest plantations functional for grassland birds in Pampa Biome? Lucilene Jacoboski1*, Raquel Paulsen1, Sandra Hartz1 ǢW2-='89-&!&' '&'8!£&3-38!2&'&3<£c r£<$-£'2'W/!$3#390-|@!,33W$31W#8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES The Pampa Biome hosts many endemic and threatened taxa, though only 0.5% of the region is protected in Rio Grande do Sul, Southern Brazil. Forestation is one of the main threats to this biome. According to Brazilian law, cellulose companies must maintain permanent preservation areas (PPAs) within WKHVLOYLFXOWXUHIDUPVLQRUGHUWRHQDEOHVSHFLHVćRZDQG landscape connectivity. Hence, the aim of this study was to evaluate whether grassland PPAs in eucalyptus forestation {փdփTT ID t ABSTRACT t ID t at Pampa biome are functional for grassland birds. The study ZDVFRQGXFWHGLQ6¥R*DEULHO56PXQLFLSDOLW\Rèèè6 DQGRèèè:%UD]LO%LUGVZHUHVDPSOHGE\WKHĆ[HG point method at grassland PPAs and native rangelands areas grazed by livestock, from October 2014 to January 2015. We recorded 43 bird species, four of them in some threat category. 5LFKQHVVDQGDEXQGDQFHVKRZHGQRVLJQLĆFDQWGLIIHUHQFHV However, the composition was different (Q= 11.75, p= 0.003), demonstrating species turnover between areas, indicating that the PPAs are functional for a group of species. These results are satisfactory from a conservation perspective, yet plant succession dynamics in the Pampa is a concern for the conservation of birds that are restricted to well developed grassland areas, such as PPAs. As there is no disturbance in WKHVHDUHDVVXFKDVĆUHDQGJUD]LQJWKHZRRG\YHJHWDWLRQ can advance in detriment of the grasslands. Therefore, management practices could be adopted as an experiment to avoid encroachment of woody plants within the PPAs, in order to maintain grasslands and prevent loss of biodiversity. 254 Effects of Eucalyptus plantations on bird diversity and Page 170, Posters ABSTRACT t Table of Contents functional nestedness: a key factor for functional trait overlap Lucilene Jacoboski1*, Vanderlei Debastiani1, Andr Mendona-Lima2, Sandra Hartz1 ǢW2-='89-&!&' '&'8!£&3-38!2&'&3<£c T ǣW <2&!3 333;2-$!&3-38!2&'&3<£ r£<$-£'2'W/!$3#390-|@!,33W$31W#8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Understanding ecological processes that sustain bird functional diversity in silviculture areas is relevant because different functional traits can show distinct responses to this landscape alteration, and environment functioning can be affected. Replacement of native habitats by silviculture can be a relevant factor changing functional characteristics of assemblages. This study aimed evaluate functional and taxonomic differences in bird assemblages in a native forest and eucalyptus plantations, and also to assess species functional QHVWHGQHVV6DPSOLQJZDVFRQGXFWHGLQ%DUUDGR5LEHLUR56 municipality (30°17’29’’S and 51°18’9’’W), Brazil. We sampled birds in eucalyptus plantations and in a native forest totalizing Ć[HGSRLQWVEHWZHHQ2FWREHUDQG'HFHPEHURI Species were characterised in relation to 14 traits. A total of VSHFLHVZHUHLGHQWLĆHG5HVXOWVVKRZHGKLJKHUIXQFWLRQDO and taxonomic diversity of birds in the native forest than in plantations, suggesting a greater niche complementarity in forest native. In our study the most affected species by silviculture were those that nest in vegetation, forage in air and nectarivores. This can also be the result of action of DQHQYLURQPHQWDOĆOWHULPSRVHGE\VLOYLFXOWXUHVHOHFWLQJ {փdփTT ID t ABSTRACT t species with similar traits. On the other hand, we observe functional nestedness of traits of species from plantations in relation to the native forest (treeNodf= 46.53, p= 0.001), indicate trait overlap in plantations. Our results demonstrate that some functions are affected or even lost in silviculture area. In this sense, the occupation of the plantations is determined by the combination of traits of each the species. 255 Current health and reproductive status of captive Cyanopsitta spixii in Brazil 3DWULFLD3HUHLUD6HUDĆQL1*, Marcus Vincius Romero Marques2, Ramiro das Neves Dias-Neto3, Camile Lugarini1, Ricardo Jos Garcia Pereira4, Lorenzo Crosta5, Michael Lierz6, Ryan Watson ǢWc-3cTǣWf TǤW8-!&3<83TǥW'6!8;!1'2;3 &''683&<32-1!£T fTǦW';'8-2!8-32;'='$$,-!TӐW£-2-$(38 -8&9T'68-£'9T16,-#-!29!2& -9,T<9;<9f-'#-+f2-='89-;@-'99'2 r6!;8-$-!W9'8!)2-|-$1#-3W+3=W#8 POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES Cyanopsitta spixii is currently one of the most threatened animals in the world. It is considered extinct in the wild since 2000 and around 100 individuals remain in captivity. The recovery of the species relies on the successful reintroduction of captive-bred birds into a suitable habitat within its range. The Spix´s Macaw Action Plan and its Captive Breeding Program aim to manage the captive population at the highest standards. :HSUHVHQWWKHUHVXOWVRIWKH%UD]LOLDQćRFNIXOĆOOPHQWRI the health and reproductive management protocol over the past year. In March 2014, 10 Spix’s in Brazil were handled and samples surveyed. For all birds, negative diagnosis were found considering the investigation for hemoparasites, Page 171, Posters ID t ABSTRACT t Table of Contents Chlamydia psittaci, Salmonella spp., Clostridium spp, Mycoplasma spp., Mycobacterium spp., Adenovirus, Alphaherpesvirus, Polyomavirus, Circovirus and Avian Bornavirus. Only serology for avian Polyomavirus showed questionable results (1:2) to three birds. Hematology and Eletrocardiograms were also performed. Only one bird showed signs of heart disease. This LVDQLPSRUWDQWĆQGLQJFRQVLGHULQJWKDWWKHODVWWZRGHDWKVLQ Brazil (early 2014) were due to heart failure in two old males. Semen analysis showed spermatozoa with morphological abnormalities, as well as altered motility and density. On the other hand, pairing decisions, reproductive and health management culminated with the birth of two healthy chicks LQ2FWREHU7KHVHZHUHWKHĆUVWELUWKVVLQFHZLWKLQ WKH%UD]LOLDQćRFN3URSK\ODFWLFPDQDJHPHQWLVWKHEHVW approach to safeguard the health of captive endangered birds, once it prevents the introduction and spread of pathogens. 258 Reproducción de Sula variegata (Aves, Sulidae) en La Quirilluca, Chile Central Tania Hornauer1*, Juan J. Saez1, Juan C. Torres-Mura1 ǢW<9;'2;!#£' r;,382!<'8|9<9;'2;!#£'W$£ POSTER SESSION: NESTING BIOLOGY & REPRODUCTION La reproducción de las aves marinas depende de las condiciones oceánicas y es sensible a las variaciones en los recursos alimentarios. Sula variegata es un ave costera endémica de la corriente de Humboldt, en categoría de conservación según la legislación chilena, y una de las principales aves guaneras del 3DFLĆFRVXURULHQWDO6XVSULQFLSDOHVFRORQLDVGHUHSURGXFFLµQ {փdփTT ID t ABSTRACT t ID t se ubican en islas sin depredadores terrestres pero en la zona central de Chile existe reproducción en un área continental denominada Acantilados de la Quirilluca (Puchuncaví, región de Valparaíso). Por medio de observaciones sistemáticas y recuentos periódicos se determinó el tamaño poblacional, el ciclo reproductivo y los patrones de actividad durante dos años consecutivos. La reproducción es estacional, realizándose en primavera y verano, con variaciones interanuales en la cronología. La población de aves adultas es cercana a los 5.000 ejemplares en primavera. El número de aves que se mantiene en reposo durante el día en la colonia varía por la salida de aves a los sitios de alimentación en el mar, observándose el máximo de ejemplares al amanecer y al atardecer, reduciéndose a un 65% al mediodía. La llegada de las aves a la colonia ocurre entre septiembre y octubre, el cortejo ocurre entre octubre y noviembre y de noviembre a enero se produce el periodo de incubación; la crianza de pollos se extiende hasta Abril. En invierno desaparecen de la zona ya que la mayoría de la población se desplaza hacia el norte. (OQ¼PHURSURPHGLRGHSROORVSRUQLGRIXHGH$ĆQHVGH Abril la mayoría de los individuos corresponde a volantones, etapa en que la que se observa la mayor mortalidad. 259 Assembleia de aves aquáticas em lagos de várzea no Baixo Page 172, Posters ABSTRACT t Table of Contents Rio Amazonas, Santarém, Pará, ao longo de um ciclo sazonal Danilo Almeida-Santos1*, Giulianne Ferreira1, Edson Lopes1 ǢW r&!2-£3!<+<9;39!2;39|@!,33W$31W#8 POSTER SESSION: COMMUNITY ECOLOGY Lagos de várzea na Amazônia são inundados sazonalmente, gerando quatro fases: enchente, cheia, vazante e seca, o que SRGHLQćXHQFLDUHPSURFHVVRVHFROµJLFRV1µVDQDOLVDPRV a assembleia de aves aquáticas em lagos de várzea no baixo Rio Amazonas, ao longo de um ciclo sazonal. Amostramos dez lagos de várzea em cada fase do ciclo sazonal utilizando o método de transecção, percorrendo em embarcação o perímetro de cada lago. Registramos 52 espécies ao longo de todo o ciclo; 25 nas quatro fases, 5 em três, 10 em duas e 12 em uma fase. As famílias com maior riqueza foram Ardeidae (11) e Scolopacidae (8), e as espécies mais abundantes foram Ardea alba (1293), Jacana jacana (925), Bubulcus ibis (802), Phaetusa simplex (670) e Egretta thula (638). As 10 espécies migrantes setentrionais registradas ocorreram principalmente nas fases vazante e seca, entre agosto e dezembro. Dentre estas, Calidris fuscicollis e Tringa melanoleuca são novos registros para a região. Na fase seca ocorreu a maior riqueza (47 espécies) e o número total de registros (4009). Dentre as 25 espécies registradas nas quatro fases, sete foram mais abundantes na fase seca e uma na fase vazante. Na fase cheia a riqueza foi correlacionada com o tamanho e forma dos lagos. Fatores como a variação da composição, riqueza e abundância ao longo do ciclo e a presença de espécies raras, sugerem que pesquisas investigando assembleias de {փdփTT ID t ABSTRACT t aves aquáticas em várzeas amazônicas devem considerar todas as fases do ciclo sazonal. Isto está relacionado com a conservação deste ecossistema, pois estudos realizados em apenas uma fase do ciclo possivelmente não irão incorporar todas as espécies que utilizam este ambiente. ID t ABSTRACT t Table of Contents WKHVLWHDVDFRQWDFW]RQHZKHUHW\SLFDOELUGVIURPêWHUUDĆUPHë forest (78%) mix with birds from second-growth forest and open areas (22%). This study highlights the importance of this area as a passage zone and shows that maintenance of large urban forest fragments in this region is relevant to prevent anthropogenic impacts and maintain population viability. 263 Bird assemblages at MUSA canopy tower in the Botanical Garden Adolpho Ducke, Central Amazonia Marina F. A. Maximiano1,2*, Leandro J. C. L. Moraes1, Marcelo H. M. Barreiros, Felipe B. R. Gomes2,3 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW<9'<&! 1!AÖ2-!TǤW2-='89-&!&' '&'8!£&3!8ÆT$!16<9£;!1-8! r1!8-2!i1!?-1-!23|,3;1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY Canopy towers are relevant for a complete sampling of bird assemblages in the Amazonian tall forests, as it allows access to low sampled strata. To characterize the bird assemblages around a recently constructed canopy tower in Museum of Amazonia (MUSA), located on the Botanical Garden Adolpho Ducke, at the edge of one large forest fragment in Manaus, Central Amazonia, we conducted systematic surveys from June 2014 to March 2015 in the three tower platforms, corresponding to distinct forest strata, identifying and registering all seen or heard species. A total of 150 species were registered, belonging to 38 families. Most of species (101) were recorded in the second platform, located 28 m above ground. Sensitive and migratory species were registered, such as Harpia harpyja and Setophaga spp., respectively, as well as several canopy species, such as Vireolanius leucotis and Xipholena punicea. The assemblage composition characterizes Page 173, Posters 268 Blood parasites in Monasa nigrifrons (Galbuliformes: Bucconidae) in cerrado of Minas Gerais, Brazil Paulo Vitor Alves Ribeiro1*, Camilla Queiroz Baese1, Vitor Carneiro de Magalhes Tolentino1, Maria Jlia Rodrigues da Cunha4, Adriano Marcos da Silva1, Giancarlo ngelo Ferreira1, Lus Pedro Mendes Paniago1, Celine de Melo ǢW29ধ;<;3&'-3£3+-!T2-='89-&!&' '&'8!£&'#'8£Æ2&-!TǥW29ধ;<;3 &'-Í2$-!9-31Ì&-$!9T2-='89-&!&' '&'8!£&'#'8£Æ2&-! r6!<£3f=-;38Ǩǥ|,3;1!-£W$31 POSTER SESSION: PARASITISM & AVIAN DESEASES Monasa nigrifrons is an insectivorous specie that doesn’t present sexual dimorphism, males and females have blacksooty plumage and red beak. The individuals live in small groups in gallery forests and are distributed throughout South America. Hemoparasites can infect several species of birds, LQFOXGLQJWKLVFRPSURPLVLQJWKHLUĆWQHVV7KHREMHFWLYHRI this study was to determine the occurrence and parasitemia of hemoparasites in M. nigrifrons. Five individuals of this specie ZHUHFDSWXUHGLQDIRUHVWLQ$UDJXDUL0*SHUIRUPLQJWZR blood smears for each bird, stained with Giemsa and analyzed with light microscopy. For determining parasitemia, the number RIHU\WKURF\WHVDQGSDUDVLWHVLQPLFURVFRSLFĆHOGVZHUH TXDQWLĆHGWRWDOLQJĆHOGVDQGHU\WKURF\WHV$OO {փdփTT ID t ABSTRACT t the birds (100%) showed co-infection by Haemoproteus and Plasmodium. In total, 193 erythrocytes (0.80%) were infected by Haemoproteus and 26 (0.10%) by Plasmodium. The parasitemia of Plasmodium ranged from three to seven (cv = 38%) parasites, while Haemoproteus, four to 76 (cv = 80.1%) parasites, but there wasn’t correlation of parasitemia between the both genus (r = 0.134, df = 3, p = 0.831). The fact that all individuals are infected can be attributed to the foraging behavior sit-and-wait and to the habit of nesting on the ground. When the birds are grouped, it’s estimated that there are greater release of dioxide FDUERQDWWUDFWLQJćLHVYHFWRUVWRSHUIRUPEORRGIHHGLQJDQG WUDQVPLWWLQJWKHSDUDVLWHV7KLVZDVWKHĆUVWVWXG\WRGRFXPHQW occurrence, parasitemia and co-infection by Haemoproteus and Plasmodium in M. nigrifrons. Acknowledgments: FAPEMIG &5$$34&13T3(/' 269 Blood parasites in Antilophia galeata and Pipra fasciicauda (Passeriformes: Pipridae) in cerrado of Minas Gerais, Brazil Paulo Vitor Alves Ribeiro1*, Camilla Queiroz Baese1, Vitor Carneiro de Magalhes Tolentino1, Maria Jlia Rodrigues da Cunha2, Adriano Marcos da Silva1, Giancarlo ngelo Ferreira1, Lus Pedro Mendes Paniago1, Celine de Melo ǢW29ধ;<;3&'-3£3+-!T2-='89-&!&' '&'8!£&'#'8£Æ2&-!TǣW29ধ;<;3 &'-Í2$-!9-31&-$!9T2-='89-&!&' '&'8!£&'#'8£Æ2&-! r6!<£3f=-;38Ǩǥ|,3;1!-£W$31 ID t ABSTRACT t Table of Contents WKHVHFRPSURPLVLQJWKHLUĆWQHVV7KHREMHFWLYHRIWKLVVWXG\ was to determine and compare the occurrence and parasitemia of hemoparasites in both species. 30 individuals of Antilophia galeata were captured in four forests of Triângulo Mineiro and 34 of Pipra fasciicaudaLQDIRUHVWIURP$UDJXDUL0* For each bird, were made two blood smears, stained with Giemsa and analyzed by light microscopy. For determining SDUDVLWHPLDWKHHU\WKURF\WHVDQGSDUDVLWHVZHUHTXDQWLĆHG LQPLFURVFRSLFĆHOGVE\LQIHFWHGLQGLYLGXDO7KHUH ZDVLQIHFWLRQLQĆYHLQGLYLGXDOVRIA. galeata, one (3.3%) by Haemoproteus, four (13.3%) by Plasmodium, and in four (11.8%) individuals of P. fasciicauda, one (2.95%) by Haemoproteus and three (8.82) by Plasmodium. The parasitemia in A. galeata were: two (0.008%) Haemoproteus and 18 (0.072%) Plasmodium in 25,000 erythrocyte analyzed, and in P. fasciicauda, were: two (0.01%) Haemoproteus and 20 (0.10%) Plasmodium in 20,000 erythrocytes. The low rates may be due to the solitary and territorial behavior of both species, because when birds are grouped, it’s estimated that there LVJUHDWHUFDUERQGLR[LGHUHOHDVHDWWUDFWLQJćLHVYHFWRUVWR perform blood feeding and transmitting the parasites. This ZDVWKHĆUVWVWXG\IRFXVHGRQFRPSDULQJRFFXUUHQFHDQG parasitemia of Plasmodium and Haemoproteus between these two species of Pipridae. Acknowledgements: FAPEMIG &5$$34&13T3(/' POSTER SESSION: PARASITISM & AVIAN DESEASES Antilophia galeata and Pipra fasciicauda are predominantly frugivorous birds that have sexual dimorphism, live close to gallery forests and are distributed in South America. Hemoparasites can affect several species of birds, including Page 174, Posters {փdփTT ID t ABSTRACT t 276 Functional bird richness in a forest complexity gradient in Araucaria forests Larissa, C. Calsavara1*, Gabriela, M. Bochio1, Hugo, R. Medeiros2, Jos, M Torezan1, Marcos, R. Lima1, Luiz Anjos1 ǢWTǣW2'96 ID t ABSTRACT t Table of Contents FRic (r = 0.39; P = 0.33) and between REA and bird richness (r = 0.232; P = 0.57). It is possible that bird communities in AF are resistant to fragmentation or that the forest complexity gradient was too weak (range: 33.3-51.3). Alternatively, RXUVDPSOHVL]HQ ZDVWRRVPDOOWRĆQGDQHIIHFW r£!8-$389-2-|+1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY Araucaria forests (AF) in southern Brazil have suffered strong fragmentation resulting in fragments with varying vegetation structure (e.g., canopy cover, number of Araucaria and dead trees.). Studies have shown that forest structure is a good predictor of bird composition and that heterogeneous habitats have higher bird richness. An explanation for this pattern is that heterogeneous habitats offer more niche spaces for the bird community. If this is the case, then heterogeneous habitats should harbor species with different ecological traits (body mass, diet, substrate and foraging method). In this study, we evaluated both taxonomic and functional bird richness in a gradient of forest complexity in AF in southern Brazil (Paraná State). Our prediction is that taxonomic and functional bird richness will be positively correlated with forest complexity. We sampled 8 sites along a forest complexity gradient, which was measured with the use of Rapid Ecological Assessment (REA) of forest characteristics (e.g., number of Araucaria trees and dead trees). REA gives a number from 12 (low forest complexity) to 60 (high forest complexity). Bird communities were sampled in each site using 6 point counts (100m radius) GXULQJVSULQJDQGVXPPHURI:HFDOFXODWHG Functional Richness (FRic) using functional traits from the bird communities. We found a lack of correlation between REA and Page 175, Posters 281 (IHLWRLPHGLDWRGDRFRUU¬QFLDGHFKXYDVVREUH a abundância relativa de aves na caatinga Clarisse C. O. S. Silva1*, Pedro T. S. M. Moura1, Thales A. D. S. Silva1, Leonardo F. F. Frana1 ǢW2-='89-&!&' '&'8!£<8!£&3'1-f8-&3 r$£!8-99'$3W9-£=!|+1!-£W$31 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY O deslocamento pode ser responsável por parte da variação na abundância local de aves Neotropicais, fazendo com que uma atividade comportamental seja responsável por vieses na percepção de abundância das espécies. Objetivamos aqui, avaliar variações no número de capturas em ocasiões com e sem a ocorrência de chuvas no dia anterior. Realizamos o HVWXGRQD(6(&6HULGµ|èH|è:£UHDVRELQćX¬QFLD de clima semiárido. Estabelecemos uma área de 31,5 ha com vegetação arbustiva, a qual recebeu 48 redes de neblina (18 m x 3 m). Realizamos a coleta de dados em duas expedições, sendo uma na estação seca e uma na chuvosa, respectivamente. Em FDGDH[SHGL©¥RPRQLWRUDPRVD£UHDSRUVHLVGLDVFLQFRKRUDV dia). As aves capturadas foram individualizadas com anilhas (CEMAVE-ICMBio) e liberadas. Utilizamos o Teste t para duas amostras independentes no programa Bioestat (versão 5.3). Obtivemos 2.331 registros de aves durante as duas expedições, sendo 311 indivíduos durante a primeira expedição e 2020 {փdփTT ID t ABSTRACT t QDVHJXQGD2Q¼PHURGHUHJLVWURVIRLVLJQLĆFDWLYDPHQWH maior durante as coletas com ocorrência de chuvas no dia anterior do que nas coletas sem ocorrência de chuva para a seca (t8;p<0,05=4.516, p=0,001), no entanto o mesmo não ocorreu no período chuvoso (t8;p<0,05=1,3155, p=0,11). O aumento severo no número de registros após um dia de chuva durante a estação seca indica que as espécies podem estar presentes no local, sem ser detectadas ou detectadas em abundância muito inferior a real. Portanto, faz-se necessário cuidado ao tratar de variação sazonal na abundância relativa das populações e presença de Aves na Caatinga, para evitar subestimativas provocadas por vieses metodológicos. ID t ABSTRACT t Table of Contents registered overall. It was also observed to eat eggs or shells, but QHYHUDVWKHĆUVWQHVWYLVLWRU([FOXGLQJCoragyps atratus and youngs Urubitinga urubitinga, other bird species normally do not interact with nests. The second most frequent species in nests was Crax globulosa (14%). Other studies with camera-traps not VSHFLĆFDOO\DVVRFLDWHGWRFDLPDQQHVWVUHFRUGHGRQO\VL[VSHFLHV of birds in the same region and period. Nests represent the most vulnerable life-phase of crocodilians and females choose their location based on best environmental conditions. These habitats or protein availability can offer ideal circumstances for others species. We have to improve our knowledge on birds OLYLQJLQVLGHćRRGHGIRUHVWGXULQJWKHGU\VHDVRQDVCathartes aura, which appears to be a secondary predator of caiman nests. 283 Why birds are common around caiman nests in Central Amazonia? Boris Marioni1*, Carolina Bertsch1, Ronis Da Silveira2 285 Efeito imediato da captura sobre a abundância relativa de aves na caatinga ǢW29ধ;<;3-!+!<TǣW2-='89-&!&' '&'8!£&31!A32!9l m Clarisse O. Silva1*, Pedro T. S. M. Moura1, Leonardo F. F. Frana1 r#1!8-32-|1!$W$31 ǢW2-='89-&!&' '&'8!£<8!£&3'1-f8-&3 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS r$£!8-99'$3W9-£=!|+1!-£W$31 In Piagaçu-Purus Reserve (PP-SDR), central Amazonia, FRQWLJXLW\EHWZHHQKLJKODQGVDQGćRRGSODLQVRIIHUYDULRXV habitats for a vast variety of avian species. During surveys of caiman nests predators, we evaluated if nests, an indicator of habitat quality, work as an attractor for birds. We used 25 camera-traps installed between 11 and 54 days during two nesting seasons (2013-2014) in 10 and 15 nests, respectively each year. A total of 14 bird species were photographed in 27 independent occasions through 103 events. The number of species recorded in each nest varied from none to three. Cathartes aura was the most frequent (23%) species of bird POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY Page 176, Posters Mudanças comportamentais podem alterar a percepção sobre a abundância das aves. Entender o papel de repostas comportamentais na abundância possibilita que sejam evitados vieses em estudos populacionais. Objetivamos avaliar se o número de capturas de aves com redes de neblina difere entre o primeiro e demais dias de amostragens. Realizamos o HVWXGRQD(6(&6HULGµ|èH|è:£UHDVRELQćX¬QFLD de clima semiárido. Estabelecemos uma área de 63 ha, que recebeu 96 redes de neblina (18 x 3 m). Realizamos a coleta de dados em três expedições (exp1, exp2 e exp3), sendo duas {փdփTT ID t ABSTRACT t durante estações secas e uma chuvosa, respectivamente. Em cada expedição monitoramos a área por seis dias (cinco KRUDVGLDHDVDYHVFDSWXUDGDVIRUDPLQGLYLGXDOL]DGDVFRP anilhas e liberadas. Utilizamos o Teste t para duas amostras independentes no programa Bioestat (versão 5.3). Obtivemos 3.577 registros de aves durante as três expedições, sendo 424 indivíduos durante a primeira expedição, 506 na segunda e QDWHUFHLUD2Q¼PHURGHUHJLVWURVIRLVLJQLĆFDWLYDPHQWH maior no primeiro dia de coleta do que nos demais dias durante a seca (exp1, t22;p<0,05=5,7553, p<0,001; exp2, WS SPDVQ¥RIRLVLJQLĆFDWLYDPHQWH diferente o período chuvoso (t16;p<0,05=-0,1213, p=0,45). $GLIHUHQ©DVLJQLĆFDWLYDGXUDQWHDVHVWD©·HVVHFDVIRLXP forte indício de que existiu um comportamento das Aves para evitar uma nova captura, o qual não ocorreu durante RSHU¯RGRFKXYRVRSRVV¯YHOTXHHVWHSDGU¥RVHMDUHćH[R da maior atividade das espécies no período chuvoso. Desse modo, novas avaliações de variação na abundância de Aves da Caatinga devem antes lidar com esta questão comportamental. ID t ABSTRACT t Table of Contents necessárias para minimizar o tempo e os recursos gastos. O presente trabalho teve como objetivos confeccionar uma lista e avaliar a riqueza de espécies de aves utilizando a metodologia das Listas de Mackinnon associada a estimadores de riqueza na região do Rio Itaguaré, no município de Bertioga, SP. Foram realizadas campanhas nos três principais ecossistemas da região: restinga, estuário e praia, totalizando 9 km de amostragem. Foram registradas 76 espécies, sendo 14 endêmicas. A estimativa de riqueza para a região foi de 123 ± 6 espécies, bem acima do número de espécies encontradas. $PHWRGRORJLDGDV/LVWDVGH0DFNLQQRQbFDUDFWHUL]RXVH como de fácil execução para estudos rápidos áreas tropicais, SULQFLSDOPHQWHSRUSHUPLWLUSDXVDVSDUDLGHQWLĆFD©¥RGDV espécies em campo. Apesar disso, aconselhamos o uso desta metodologia associada a estimadores de riqueza que permitem inferir a necessidade ou não de mais estudos para a elaboração de levantamentos de aves mais completos. Na região de estudo, seria necessária a ampliação da área de amostragem para uma melhor caracterização da riqueza de aves. 286 O uso das Listas de MackInnon em avaliações ecológicas U£SLGDVGHDYHVXPHVWXGRGHFDVRQDćRUHVWD$WO¤QWLFD Pedro V. R. Martins1*, Francisco S C Buchmann2, Cesar Cestari3 ǢWTǣWfTǤWf-3£!83 r6'&83=8-1!|+1!-£W$31 POSTER SESSION: FIELD TECHNIQUES & TOOLS FOR CONSERVATION Apesar da alta biodiversidade e taxa de endemismo de aves, a ćRUHVWD$WO¤QWLFDWHPVLGRFRQWLQXDPHQWHGHVPDWDGD'HVWD IRUPDDYDOLD©·HVHFROµJLFDVTXHVHMDPU£SLGDVHHĆFLHQWHVV¥R Page 177, Posters {փdփTT ID t ABSTRACT t 289 3DOHRGLVWULEXL©¥RHHVWLPDWLYDGHGLYHUJ¬QFLDGH populações de Pipridae apontam conexões espaçoWHPSRUDLVHQWUHćRUHVWD$WO¤QWLFDH$PD]¶QLFD Helder Araujo1*, Nayla Nascimento1, Bruno Xavier1, Carlos Agne4, Erich Mariano5 ǢW2-='89-&!&' '&'8!£&!!8!Ð#!TǥW9;<&391#-'2;!-9T ǦW2-='89-&!&' '&'8!£&'!16-2!8!2&' r,'£&'8|$$!W<(6#W#8 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS $GLYHUJ¬QFLDGHW£[RQVHQWUHDVćRUHVWDV$PD]¶QLFDH $WO¤QWLFDVXJHUHGXDVFRQH[·HVKLVWµULFDVHQWUHHVVDVćRUHVWDV uma no Mioceno e outra no Quaternário. É proposto, com dados de palinofósseis, que essa última conexão ocorreu HQWUHR3OHLVWRFHQR+RORFHQRSRUPHLRGHGXDVURWDVXPD litorânea e outra pelo interior do nordeste brasileiro, via matas ciliares. Pipridae possui membros com populações disjuntas HQWUHćRUHVWD$WO¤QWLFDQRUGHVWLQDHD$PD]¶QLD&RPLVVR integramos dados de paleomodelagens de distribuição de Chiroxiphia pareola, Dixiphia pipra e Ceratopipra rubrocapilla, estimativa de tempo de divergências moleculares nas duas primeiras espécies, dados de distribuição atual de outros táxons e palinofósseis para avaliar as propostas espaço-temporais de conexão. A estimativa média de tempo de divergência entre as populações disjuntas foi de 144 e 126 mia e uma cladogênese anterior foi de 248 mia. Entre esses períodos, fases úmidas no nordeste são suportadas por espeliotemas e travertinos. A distribuição potencial das três espécies a 130 mia aponta uma probabilidade climática de conexão próxima ao litoral norte da região, bem como manchas mais ao sul. Page 178, Posters ID t ABSTRACT t Table of Contents Embora possa ter existido probabilidade climática próximo ao litoral norte, não suportamos essa conexão com base na ausência atual das três espécies em ambientes potenciais na região (Baturité) e na ocorrência de outros piprídeos nesses ambientes. Com isso sugerimos uma conexão pleistocênica HQWUHDVćRUHVWDVHPXPSHU¯RGRHQWUHHPLDH por rotas de matas ciliares atualmente situadas em regiões próximas ao rio São Francisco e Chapada Diamantina. 290 Social interactions and foraging behaviour of Cyanocorax cyanopogon H[SRVHGWRDUWLĆFLDOSUHGDWRUV M.C. Beiriz1*, L.R.S. Zanette1, L.A.M. Mestre2 ǢW '&'8!£2-='89-;@3('!8ÆTǣW '&'8!£2-='89-;@3(!8!2Æ r$!83£-2!#'-8-A|+1!-£W$31 POSTER SESSION: BEHAVIOUR We describe the behaviour of White-naped jays (Cyanocorax cyanopogonGXULQJDQH[SHULPHQWZLWKIHHGHUVDQGDQDUWLĆFLDO predator. Our main goal was to understand how groups of White-naped jays use habitats where the risk of predation is high. From September 2014 to March 2015 we observed 8 groups of jays (30 individuals) in feeders set at the Nature Reserve of Pedra dos Ventos Hotel, in Quixadá- Ceará, Brazil. :HSODFHGHLJKWDUWLĆFLDOIHHGHUVDSODVWLFWUD\[[FP in patches where groups of jays had been previously found. Each feeder was covered with a 100g of seeds mixed with 1Kg of sand. In order to observe the reaction of jays to predators near the feeders, we set a plastic snake 5m apart from feeder in three patches, 10 minutes after the jays arrived at the feeder. In 62.5% of all the groups observed the sentinel left {փdփTT ID t ABSTRACT t its position in the tree and joined the group feeding. In all the SDWFKHVZLWKWKHDUWLĆFLDOVQDNHWKHMD\VDEDQGRQHGWKHIHHGHU and gave an alarm call . In one of three groups with snakes the jays never returned after the snake had been removed. We observed direct aggressions (pecks) and harassment between the members of a group of six individuals that visited the feeder without the snake exposed. We also observed that some members of a group had priority in accessing feeders, which suggests a dominance hierarchy. We also recorded food sharing indicating the establishment of social alliances, as reported for other corvids. Our initial data suggest that associations of jays may be a strategy to reduce the risk of predation. Future work will focus on accessing habitat quality and foraging behaviour of jays using giving-up density. ID t ABSTRACT t Table of Contents by circumnavigating 70 lakes along 1,000km of Amazon 5LYHUćRRGSODLQV7RWHVWWKHVHK\SRWKHVHVDQRQPHWULF multiple-dimensional scaling ordination complemented by multiple linear models was used to determine relationships between bird richness and assemblage composition, and biotic and abiotic lake characteristics. At a local scale, lake VKDSHZDWHUWUDQVSDUHQF\DQGWURSKLFVWDWXVLQćXHQFHELUG assemblages. At a regional scale, differences among sites in water body richness, produced by Amazon River tributaries, and the two water types, are determinants of variation in composition of waterbird assemblages. The results indicate that waterbirds assemblage composition within Amazonian ćRRGSODLQVGRHVUHVXOWIURPOLQNVLQSURFHVVHVRSHUDWLQJDW ERWKVSDWLDOVFDOHVDVSUHGLFWHGE\QHXWUDOWKHRU\RILQćXHQFHG by local ecological factors as predicted by niche theory. 291 Spatial distribution and composition of waterbirds in relation to limnological conditions in the Amazon basin Renato Cintra 8$-2;8!93!8'9|+1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY The main hypothesis is that waterbird richness in Amazonian lakes differs between white-and black-waters, and has gradients in species composition relating to lake-to-lake differences in shape, depth, water transparency, habitat richness, and productivity. I tested a complementary hypothesis that bird assemblages respond to variations in lake characteristics over a regional scale, and to neighboring aquatic components, called water body richness, including rivers, channels, and ponds. Bird surveys were conducted Page 179, Posters 292 The importance of inter-habitat characteristics on gap- crossing decisions of a bird in the Atlantic Forest hotspot Amanda Navegantes1*, Renato Crouzeilles1, Henrique Rajo2, Rui Cerqueira1, Maria Lucia Lorini3 ǢW2-='89-&!&' '&'8!£&3-3&'!2'-83f TǣW32ধ($-! 2-='89-&!&'!;£-$!&3-3&'!2'-83ff-3TǤW2-='89-&!&' '&'8!£&39;!&3&3-3&'!2'-83f r!1!2&!i2!='+!2;'9|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES 7KHUHVSRQVHRILQGLYLGXDOVWRKDELWDWFRQĆJXUDWLRQDQG their ability to cross inter-habitat gaps are vital to enhance population persistence through functional connectivity. Here, we quantify the effects of inter-habitat distance, matrix {փdփTT ID t ABSTRACT t ID t type and stepping stones on the gap-crossing probability for Formicivora littoralis, an endangered species of the Atlantic Forest. We hypothesized that gap-crossing probability i) is negatively related to the distance between habitat patches, ii) is positively related to the presence of stepping stones and iii) is affected differently by the matrix type. We compared gap-crossing movements within six different matrix conditions (herbaceous and non-vegetated with or without stepping stones, unpaved and paved roads). We used playback to stimulate individuals to cross these different matrices between 153 pairs of habitat patches at Restinga de Massambaba, Rio de Janeiro, Brazil. Inter-habitat distance, matrix type and stepping stones strongly affected gap-crossing probability for F. littoralis. As expected, the success in crossing gaps was negatively related to the distance between habitat patches, positively related to the presence of stepping stones, and differently affected by the matrix type. Gap-crossing movements were more frequent and wider in matrices with than without stepping VWRQHVLQGHSHQGHQWRIWKHVSHFLĆFPDWUL[W\SH6WHSSLQJ stones reduced the distance between habitat patches and increased the similarity between matrix and habitat patches, consequently increasing functional connectivity. We suggest that stepping stones can enhance matrix permeability to gapcrossing movements of F. littoralis more than matrix type alone. 293 Population structuring analyses provide guidelines Page 180, Posters ABSTRACT t Table of Contents for captive breeding and reintroductions of the endangered Aburria jacutinga (Cracidae) Mercival Francisco1*, Paulo R.R. Oliveira-Jr.1, Mariellen C. Costa1, Luis F. Silveira2 ǢW2-='89-&!&' '&'8!£&'3!8£39T$!16<9&'383$!#!TǣW'3 &'='9T<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3 r1'8$-=!£|<(9$!8W#8 POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES The survival of many species has relied on captive breeding and reintroduction into the wild. As captive populations are often small, a major concern of managers is maintaining their genetic integrity. To tackle this problem, the maximum genetic variability should be preserved within and between populations during the captive stage of conservation plans. Then, understanding the levels of population structuring and levels of genetic variability within the different lineages provide important guidelines for management. Because of its conservation status, a successful captive breeding program for the Black-fronted Piping-guan, Aburria jacutinga, has started in the decade of 1980. Here we investigate levels of genetic structuring between and levels of genetic variability within the three the aviaries that compose the original genetic repositories of captive Jacutingas: Tropicus; &(633DUDLEXQDDQG*XDUDWXEDXVLQJQLQHPLFURVDWHOOLWH loci. Bayesian clustering analyses revealed that that CESP lineage diverged from Tropicus and Guaratuba, but no inbreeding has been detected within these aviaries. Then, we propose three main management guidelines: i) as far as inbreeding can be avoided within these captive lineages, {փdփTT ID t ABSTRACT t they should be managed separately to minimize adaptation to captivity, ii) crossbreedings, however, are indicated for pre-release generations. Then, pre-release pairs should be formed and managed separately, and iii) reintroducing the species in areas where it has been extinct is more prudent than supplementing natural populations, as population structuring in the wild is not known and supplementations could involve risks of disrupting local adaptive complexes. 294 $YHVGHVXEERVTXHHPXPD£UHDGHćRUHVWD RPEUµĆODGHQVDQD$PD]¶QLD&HQWUDO importância das unidades de conservação Renata S. Oliveira1*, Edson Lopes2 ǢW !$<£&!&'92;'+8!&!9&3!6!/9TǣW r8'2!;!93<A!#-3|,3;1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Cerca de 1300 espécies de aves ocorrem na Amazônia, boa parte endêmica deste bioma. Contudo, ainda há enormes ODFXQDVQRFRQKHFLPHQWRFLHQW¯ĆFRGHVWDUHJL¥RHQTXDQWR seus ecossistemas têm sido destruídos antes de conhecermos sua biodiversidade. Nós estimamos a riqueza de aves de VXEERVTXHHPXPD£UHDGHćRUHVWDSULP£ULDLQDOWHUDGD da Floresta Nacional (Flona) do Tapajós, uma Unidade de Conservação (UC) de uso sustentável na Amazônia central. Realizamos amostragens com redes de neblina nos meses GH-XQKRH6HWHPEURGH&RPXPWRWDOGHKRUDV rede, capturamos 239 indivíduos de 50 espécies, distribuídas em 23 famílias, o que representa 36,76% das espécies de aves de sub-bosque já registradas para a UC em estudos Page 181, Posters ID t ABSTRACT t Table of Contents anteriores. Thamnophilidae (n=13) e Dendrocolaptidae (n=8) foram as famílias mais representadas e as espécies mais abundantes foram Glyphorynchus spirurus (n=34), Lepidothrix iris (n=19) e Willisornis poecilinotus (n=15). A riqueza estimada pelo Jackknife 1 foi 68,7 ± 9,3 e a curva acumulativa de espécies não apresentou tendência a estabilização, indicando que com maior esforço de campo mais espécies seriam registradas. Algumas das espécies registradas possuem distribuição relativamente restrita e várias pertencem a grupos funcionais, tais como seguidores de bando misto e VHJXLGRUHVGHIRUPLJDVGHFRUUHL©¥RFODVVLĆFDGDVHPRXWURV estudos como afetadas negativamente por fatores como IUDJPHQWD©¥RćRUHVWDOHRXFRUWHVHOHWLYRGHPDGHLUDHVWD última, uma atividade desenvolvida na UC. Os resultados deste estudo sugerem a condição preservada da área estudada e a importância desta UC na manutenção de populações de aves com interesse conservacionista. 295 Reciprocal vocal interactions between two sympatric Laterallus species in the coast of the Río de la Plata Emiliano A. Depino1*, Juan I. Areta1 ǢWf r&'6-23'1-£-!23|+1!-£W$31 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS ,QWHUVSHFLĆFUHVSRQVHVWRYRFDOL]DWLRQVEHWZHHQFRH[LVWLQJ VSHFLHVPD\UHćHFWXQGHUO\LQJHFRORJLFDOLQWHUDFWLRQV:H examined vocal interactions between sympatric Laterallus leucopyrrhus and L. melanophaius in the coast of the Río de la Plata, Buenos Aires, Argentina. These species occur in {փdփTT ID t ABSTRACT t ID t different but adjacent habitats with minor overlap and their loudsongs (trills) are very similar. Hence we asked, how do WKH\UHVSRQGWRKRPRDQGKHWHURVSHFLĆFSOD\EDFN":H carried out 192 playback trials over a year, 96 in typical L. leucopyrrhus habitat (Scirpus giganteus Bulrush) and 96 in typical L. melanophaius habitat (Coastal Scrub). Each habitat was sampled twice per season (once with playback of each crake) during the four seasons. We placed 12 playback points per habitat and recorded responses inside a 25m-radius. 3OD\EDFNUHVSRQVHVWRKRPRDQGKHWHURVSHFLĆFSOD\EDFNV were statistically the same for both crakes (P-values>.05; :LOFR[RQ0DWFKHG3DLUV7HVWV7KHVHLQWHUVSHFLĆFLQWHUDFWLRQV VHHPWRLQGLFDWHLQWHUVSHFLĆFWHUULWRULDOLW\GXHWRDQ incidental effect of similarities in vocalizations, or (2) an DGDSWDWLRQWRUHGXFHLQWHUVSHFLĆFFRPSHWLWLRQEHWZHHQ sympatric species with similar ecological characteristics. Future studies should test these proposals by assessing responses to homologous vocalizations with very different sound characteristics, such as contact or aggressive calls, and by measuring detailed variables in playback responses. 297 3UREOHPDVFRPSOXPDJHQVYHUGHROLYDGHI¬PHDV Page 182, Posters ABSTRACT t Table of Contents adultas de Manacus manacus Chiroxiphia pareola, a ELRPHWULDSRGHDX[LOLDUQDLGHQWLĆFD©¥RHPFDPSR Juan Ruiz-Esparza1*, Daniela Pinheiro Bitencurti Ruiz-Esparza1, Caroline Silva1, Patricio Adriano Rocha1, Stephen Francis Ferrari1 ǢW2-='89-&!&' '&'8!£&''8+-6' r/<!2$3£38!&3ǣǢ|,3;1!-£W$31 POSTER SESSION: FIELD TECHNIQUES & TOOLS FOR CONSERVATION Diferenciar fêmeas ou machos de plumagens juvenis, em algumas espécies de aves da família Pipridea, se torna complicado por conta da semelhança e pela coexistência destas espécies. O objetivo deste trabalho é apresentar diferenças entre as medidas biométricas de fêmeas adultas de Manacus manacus e Chiroxipia pareola para auxilio na LGHQWLĆFD©¥RHPFDPSRDVVLPFRPRHVWLPDURWDPDQKRGD área compartilhada por ambas as espécies. Os dados deste estudo foram coletados em duas unidades de conservação do estado de Sergipe (Refúgio de Vida Silvestre da Mata do Junco e a Floresta Nacional do Ibura), através de campanhas sistemáticas de três dias, entre os anos 2011 e 2013, nas quais as aves foram capturadas utilizando redes de neblina. Foram usadas as medidas de comprimento de asa, comprimento total e massa corpórea das aves capturadas para indicar diferenças estatísticas através de uma prova t. Através de programas de imagem foi gerado um polígono da área que estas espécies compartilham. As medidas de 81 fêmeas de M. manacus e 21 fêmeas de C. pareola foram analisadas, apresentando GLIHUHQ©DVLJQLĆFDWLYDQRVSDU¤PHWURVWHVWDGRV$PEDVDV espécies compartilham uma área de 420.680.498 ha, a qual representa mais de 80% da área de distribuição de C. pareola. {փdփTT ID t ABSTRACT t O valor da asa não apresentou sobreposição, por tanto se VXJHUHRXVRGHVWHSDU¤PHWURSDUDDX[LOLDUQDLGHQWLĆFD©¥R de fêmeas adultas de M. manacus e C. pareola em campo, visto que elas podem ser encontradas na mesma área. 299 (VWUXWXUDĆORJHQ«WLFDGDVDVVHPEOHLDVGHDYHVGDFDDWLQJD Erivelton R. Nascimento1*, Kelly Isadora de O. Correia2, Juan Ruiz-Esparza3, Sidney F. Gouveia4 ǢW2-='89-&!&' '&'8!£&''8+-6' r'8-='£;32W<(9|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS (VWXGRVĆORJHQ«WLFRVDVVRFLDGRVDSDGU·HVHVSDFLDLVGD biodiversidade podem informar como a diversidade biológica HYROXLXHVHRUJDQL]RXQRHVSD©RJHRJU£ĆFR$TXLLQYHVWLJDPRV RSDGU¥RGHHVWUXWXUDĆORJHQ«WLFDGHDVVHPEOHLDVGHDYHV ao longo da Caatinga. Reunimos 83 levantamentos de aves GD&DDWLQJDHXWLOL]DPRVXPDĆORJHQLDFRPSOHWDGHVVDV HVS«FLHVSDUDGHVFUHYHURSDGU¥RGHHVWUXWXUDĆORJHQ«WLFD dessas assembleias. Usamos a métrica padronizada de GLVW¤QFLDVĆORJHQ«WLFDVP«GLDVHQWUHSDUHVGHHVS«FLHVQDV assembleias, NRI (Net Relatedness Index). Valores positivos ou negativos apontam comunidades formadas por táxons ĆORJHQHWLFDPHQWHSUµ[LPRVRXGLVWDQWHVUHVSHFWLYDPHQWH Registramos 464 espécies nas assembleias, sendo seis GHODVFRPGLVSHUV¥RĆORJHQ«WLFDVLJQLĆFDWLYDGLVWULEX¯GDV próximas à zona de transição com a Amazônia. Apenas uma DVVHPEOHLDWHYHHVWUXWXUDĆORJHQ«WLFDVLJQLĆFDWLYDPHQWH agrupada. As demais assembleias não apresentaram estrutura VLJQLĆFDWLYDDSUHVHQWDQGRSRUWDQWRSDGU¥RDOHDWµULR$ Page 183, Posters ID t ABSTRACT t Table of Contents organização das assembleias de aves da Caatinga parece responder predominantemente a processos estocásticos, mas WDPE«PK£LQćX¬QFLDGHFRPSHWL©¥RQRSDVVDGRLPSHGLQGRD coexistência de espécies intimamente relacionadas por meio da exclusão competitiva e, em menor proporção, do efeito de ĆOWURVDPELHQWDLVVREUHRVFODGRVGLVWULEX¯GRVUHJLRQDOPHQWH As assembleias de aves da Caatinga parecem resultar de uma interação complexa de diferentes processos ecológicos ao longo da história do bioma. Essas informações podem subsidiar a conservação da diferentes aspectos da biodiversidade, bem como o entendimento da história evolutiva do grupo na região. 300 3ROLPRUĆVPRGHSOXPDJHPHPCnemotriccus fuscatus (Wied, 1831) não está associado com mutações do receptor de melanocortina-1 (MC1R) Sandriellem N. Vieira1*, Juliana Araripe1, Alexandre Aleixo2, Pricles Rgo1 ǢW2-='89-&!&' '&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&r9!2&8-'££'1W=-'-8!|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS O passeriforme Cnemotriccus fuscatus é uma ave neotropical considerado politípica, possuindo atualmente sete subespécies, caracterizadas por colorações diferentes de plumagem, variando entre tons de branco, amarelo, cinza e amarronzado. Apesar de estudos comprovarem a ligação da genética com a variação da coloração, seu entendimento em espécies selvagens ainda é escasso. Dentre os marcadores genéticos utilizados para entender o processo de mudanças de coloração em aves, destaca-se o gene receptor de melanocortina-1 (MC1R), o qual tem demonstrado casos de associação à {փdփTT ID t ABSTRACT t YDULD©¥RGHFRORUD©¥RLQWHUHLQWUDHVSHF¯ĆFDFRPPXWD©·HV não-sinônimas. Objetivando saber se este gene está associado à variação de coloração da plumagem em C. fuscatus, esta pesquisa foi realizada com três subespécies de C. fuscatus: C. f. duidae (ventre amarelo e garganta amarelo-alaranjado); C. f. bimaculatus (ventre branco e peito cinza acastanhado); e C. f. fumosus (ventre amarelo claro e peito com tom amarronzado). Foi sequenciado um fragmento do MC1R de 695 pares de bases para cada indivíduo, o qual inclui todos os sítios conhecidos por atuar na mudança de pigmentação em outros grupos de aves. Foram encontrados sete sítios heterozigotos nos indivíduos, dos TXDLVDSHQDVXPUHVXOWRXHPYDULD©¥RSDUDFRGLĆFD©¥RQ¥R sinônima. No entanto, nenhuma variação mostrou associação com os padrões de coloração das subespécies estudadas. Assim, observa-se que mudanças na sequência de nucleotídeos GHVWHJHQHQ¥RDOWHUDPRSROLPRUĆVPRGDSOXPDJHP encontrado em C. fuscatus, sendo necessária a investigação de outros genes ou fatores regulatórios que possam explicar os padrões de pigmentação nesta espécie de ave. 301 Incidence of progressive greying in the 3ODLQćDQNHG5DLORallus wetmorei) Adriana Rodrguez-Ferraro1*, Adriana Rojas2, Miguel Lentino3 ǢW2-='89-&!&-1Õ23£Ð=!8TǣW2-='89-&!&'2;8!£&' '2'A<'£!TǤW <2&!$-2-££-!1,'£69 ID t ABSTRACT t Table of Contents with progressive greying exhibit only a few white feathers on early stages, but the amount of white feathers increases after every moult cycle, retaining the color in the eyes, bill, and legs. The objective of this study was to describe the incidence of SURJUHVVLYHJUH\LQJLQWKH3ODLQćDQNHG5DLORallus wetmorei), an endemic and threatened species restricted to northwestern Venezuela, which exhibit two color morphs: dark and pale. We conducted observations and captured rails at 5 localities and examined 18 museum specimens, recording the part of the body with white feathers and the extent of progressive greying. We recorded progressive greying only in dark morph individuals: 4 captured and 5 observed. The amount of white feathers varied considerably among individuals, ranging from a few small feathers to extensive progressive greying. Wild individuals with progressive graying were recorded at ĆYHORFDOLWLHVEXWRQO\RQHPXVHXPVSHFLPHQDSDOHPRUSK has white feathers. This individual was collected in a sixth locality, where the species is locally extinct because of habitat destruction. Our results indicate that progressive greying RFFXUVDWVL[ORFDOLWLHVZKHUHWKH3ODLQćDQNHG5DLOKDVEHHQ reported, and affects both morphs, although currently seems more common on dark morph individuals. We did not observe DJJUHVVLRQIURPFRQVSHFLĆFVWRZDUGFRORUDEHUUDQWUDLOVDQG all individuals showing progressive graying paired with normal plumage rails, and for two of them we had evidence of breeding. r83&8-+<'A!|<9#W=' POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY Progressive greying is a recently described color aberration, which consists in the progressive loss of pigment with age. Birds Page 184, Posters {փdփTT ID t ABSTRACT t 302 (VWXGRĆORJHRJU£ĆFRGHLepidothrix nattereri (Aves: Passeriformes) baseado em dados moleculares Keila Lima1*, Cleyssian Dias1, Juliana Araripe1, Alexandre Aleixo2, Pricles Rgo1 ǢW2-='89-&!&' '&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&r0'-£!£-1!Ǩǡ|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS A espécie Lepidothrix nattereri é um passeriforme neotropical pertencente à família Pipridae, distribuído em parte do bioma Amazônico. Atualmente são descritas duas subespécies (L. n. nattereri e L. n. gracillis) distintas com base em caracteres morfológicos e por área de ocorrência. A possibilidade de estes táxons serem espécies válidas motivou a realização deste trabalho que visa aplicar análises moleculares baseadas em sequenciamento de genes mitocondriais numa abordagem ĆORJHRJU£ĆFD)RUDPDQDOLVDGRVH[HPSODUHVGDHVS«FLH distribuídos em 25 pontos de coleta de quatro Estados da Amazônia brasileira, abrangendo a área descrita para as duas subespécies, sendo 30 exemplares para L. n. nattereri e 23 para L. n. gracillis$Q£OLVHVĆORJHQ«WLFDVPRVWUDUDPRPRQRĆOHWLVPR da espécie e a presença de dois grupos ligeiramente distintos, também evidenciados pelas redes de haplótipos. Os resultados obtidos não apoiam a divisão das duas subespécies como sugerido na literatura, visto que os exemplares dos dois grupos encontrados não coincidem com a distribuição para as subespécies. Os dois grupos apresentam uma área de simpatria próxima à região do Rio Madeira. Algumas hipóteses podem ser levantadas para explicar este padrão: contato secundário entre populações anteriormente separadas (áreas de refúgios); Page 185, Posters ID t ABSTRACT t Table of Contents eventos de hibridização e introgressão com outra espécie do gênero Lepidothrix ( L. coronata – grupo exquisita pelo Rio Madeira e L. iris eucephala pelo estreito do Rio Tapajós). 306 $Q£OLVHĆORJHRJU£ĆFDGRFRPSOH[RLepidothrix iris/ nattereri/vilasboasi (Aves, Passeriformes), ressalta a necessidade de revisão taxonômica Cleyssian N. P. Dias1*, Keila A. Lima1, Juliana Araripe1, Alexandre Aleixo2, Pricles S. Rgo1 ǢW2-='89-&!&' '&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&- POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS Após ter sido considerada como extinta por mais de 50 anos, Lepidothrix vilasboasiWHYHVXDYDOLGDGHFRQĆUPDGD por caracteres morfológicos, apesar das suspeitas de que este táxon poderia ser resultado de hibridização entre duas espécies do mesmo gênero (L. iris e L. nattereri). Desde então, nenhum estudo envolvendo estes táxons foi publicado EXVFDQGRFRQĆUPDURVGDGRVPRUIROµJLFRV1HVWHFRQWH[WR a genética molecular tem se mostrado uma ferramenta HĆFLHQWHSDUDDUHVROX©¥RWD[RQ¶PLFDGHHVS«FLHVVRE suspeita de hibridização. O presente estudo teve como REMHWLYRFRQĆUPDURPRQRĆOHWLVPRHHVWDEHOHFHUDVUHOD©·HV ĆORJHQ«WLFDVHQWUHDVWU¬VHVS«FLHVGHLepidothrix, fazendo uso de sequenciamento dos marcadores moleculares ND2, COI (mitocondriais) e Mioglobina (nuclear). Os resultados preliminares indicam que L. vilasboasi compartilha vários haplótipos (mitocondriais e nucleares) com indivíduos de L. iris pertencentes a subespécie eucephala. Os marcadores mitocondriais indicam uma separação clara entre os indivíduos {փdփTT ID t ABSTRACT t das subespécies L. iris eucephala e L. iris iris, sendo a última mais proximamente relacionada com a espécie L. nattereri, mas como grupos independentes. Os marcadores nucleares mostraram-se conservados dentro do gênero, não sendo possível encontrar sítios que diferenciassem os táxons abordados, nem evidências de processos de hibridização ou introgressão envolvendo L. vilasboasi. Os dados obtidos até o momento ressaltam a necessidade de revisão taxonômica para L. iris, uma vez que as duas subespécies não formam um grupo PRQRĆO«WLFRDO«PGHPRVWUDUDQHFHVVLGDGHGHPDLVHVWXGRV para compreender a história evolutiva que envolve L. vilasboasi. 308 Análisis comparativo de imágenes obtenidas por micro tomógrafo y diafanización para la descripción morfológica de siringes Natlia S. Porzio1*, Adolpho H. Augustin1, Carla S. Fontana1 ǢW32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£ ID t ABSTRACT t Table of Contents descripciones anatómicas. Como parte del diseño experimental de uno proyecto que involucra el análisis morfológico de la siringe y pico, correlacionando estos aspectos con la estructura del canto de tres especies simpátricas de Sporophila (S. hypoxantha, S. beltoni y S. caerulescens) empezamos a comparar los resultados de obtención de imágenes utilizando las dos técnicas: diafanizacíon y microtomógrafía. En la diafanización, XWLOL]DPRVHOSURFHVRTXHGH7D\ORU\9DQ'\NHPRGLĆFDGR Las siringes utilizadas están en la colección ornitológica del Museo de Ciencias e Tecnología da PUCRS. Hasta ahora, las imágenes generadas por Skyscan (3D) permiten la visualización de estructuras más exactas para el análisis de datos. Además, esta técnica posibilita el uso de contrastes para indicar estructuras óseas o tejido blando permitiendo una descripción morfológica más precisa. A pesar del alto costo para compra y mantenimiento del equipo, consideramos que el Skyscan es una herramienta importante para el estudio morfológico descrito. r2!ধ638A-3|,3;1!-£W$31 POSTER SESSION: MORPHOLOGY La diversidad morfológica de las siringes es utilizada tanto para el reconocimiento de grandes grupos de aves, como SDUDODFODVLĆFDFLµQGHORVWD[D/DGHVFULSFLµQPRUIROµJLFD GHODVLULQJHHVUHOHYDQWHSDUDHVWXGLRVĆORJHQ«WLFRV\HFR morfológicos. En general se utiliza el método de diafanizacíon y observación en lupa para el análisis descriptivo de la siringe. Durante el preparo del material, estructuras pequeñas pueden ser dañadas; además, la percepción de las mismas depende de la capacidad del observador. Recientemente la utilización do microtomógrafo de rayos x (Skyscan) posibilita el procesamiento de imágenes de mejor calidad para efectuar Page 186, Posters 309 Avifauna de um Remanescente Florestal de Ecótono entre Cerrado e Mata Atlântica na Região Metropolitana de Belo Horizonte Tulaci B. F. Duarte1*, Joo C C Pena2, Marcos Rodrigues2 ǢW2-='89-&!&' '&'8!£&'<838';3TǣW2-='89-&!&' '&'8!£&'-2!9'8!-9 r;<£!$-#,!0ধ|@!,33W$31W#8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES A fragmentação de habitat é um dos maiores responsáveis pela redução de espécies no mundo. Com o intuito de se conhecer a riqueza de aves, já que são consideradas como bons indicadores ecológicos, realizou-se um levantamento da avifauna na Mata {փdփTT ID t ABSTRACT t do Isidoro. A mata, também conhecida como Granja Werneck, localizada na região norte de Belo Horizonte, capital de Minas Gerais, representa um ecótono entre cerrado e mata Atlântica e é um dos últimos grandes fragmentos de vegetação relativamente preservados do município. Foram encontradas 106 espécies de aves, distribuídas em 35 famílias, incluindo o cuitelão Jacamaralcyon tridactyla (Vieillot, 1817) espécie que consta na lista de aves ameaçadas pela União Internacional para a Conservação da Natureza, além de representantes endêmicos de ambos os biomas, como os da família Pipridae: soldadinho Antilophia galeata (Lichtenstein, 1823) e o tangarazinho Ilicura militaris6KDZ1RGGHU9HULĆFRX se que a região ainda precisa de estudos mais aprofundados para melhor direcionar as futuras intervenções antrópicas. 312 $YHVGHćRUHVWDVVHFDVQRQRUGHVWH brasileiro: revisando suas origens Helder Araujo1*, Erich Mariano2 ǢW2-='89-&!&' '&'8!£&!!8!Ð#!TǣW2-='89-&!&' '&'8!£&'!16-2!8!2&' ID t ABSTRACT t Table of Contents HĆORJHQLDVPROHFXODUHVGHHVS«FLHVHQG¬PLFDVHW¯SLFDV dos ambientes deciduais, bem como integramos com dados de palinofósseis, fósseis de mamíferos, paleomodelagens e dados de travertinos e espeliotemas. Com isso, sugerimos que GLYHUVLĆFD©¥RGHW£[RQVGHDYHVQD&DDWLQJDRFRUUHXGHVGHR Mioceno Inferior ao Pleistoceno Superior. Modelos alopátricos, parapátricos ou dispersão com posterior especiação podem VHUH[HPSOLĆFDGRVHPGLIHUHQWHVW£[RQVHGLVWLQWRVPRPHQWRV dessa história. Desse modo, podem ser falseadas hipóteses clássicas sobre a origem recente da fauna que ocorre na Caatinga. Ainda, existem endemismos na região associados WDQWRD£UHDVDEHUWDVHRXDUEXVWLYDVFRPRDćRUHVWDVVHFDV propriamente ditas. Portanto, sugerimos que o mosaico de £UHDVDEHUWDVHćRUHVWDLV«DQWLJRQDUHJL¥RHDSRQWDPRV DLQGDTXHDVKLVWµULDVGRVW£[RQVDVVRFLDGRVDVćRUHVWDVVHFDV estão relacionadas com linhagens amazônicas (eg. Hylopezus e Xiphocolaptes). Já táxons associados à vegetação aberta estão relacionados com linhagens da “Diagonal Seca” e, quando ocorrem na Amazônia, habitam vegetação aberta, ribeirinha, bordas de mata ou clareira (eg. Myrmorchilus e Stigmatura). r,'£&'8|$$!W<(6#W#8 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS $&DDWLQJD«DSRQWDGDFRPRXPQ¼FOHRGHćRUHVWDVVHFDV da América do Sul, disjunto de outras áreas na Argentina, Bolívia, Peru, Equador, Colômbia e Venezuela. A região já foi reconhecida como uma importante área de endemismo de aves, no entanto, foram realizados poucos estudos sobre HYROX©¥RGLYHUVLĆFD©¥RHGLVWULEXL©¥RGDVHVS«FLHVDVVRFLDGDV &RPRREMHWLYRGHFRQVWUXLUKLSµWHVHVGHGLYHUVLĆFD©¥RGD avifauna na Caatinga, nós revisamos padrões de distribuição Page 187, Posters 317 )DWRUHVTXHLQćXHQFLDPQDHVFROKDGHFDYLGDGHVQLQKR pela Pyrrhura HQG¬PLFDGRQRUGHVWHEUDVLOHLUR Ceclia Luna1*, Fbio Nunes1, Lorenzo Zanette1, Luiz Mestre2 ǢW2-='89-&!&' '&'8!£&3'!8ÆTǣW2-='89-&!&' '&'8!£&3!8!2Æ r£-$!8-!3$£#£|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Pyrrhura griseipectus, RSHULTXLWRFDUDVXMD«FODVVLĆFDGR pela IUCN como em perigo crítico de extinção. É endêmico do Ceará, Brasil, de biologia ainda pouco conhecida com {փdփTT ID t ABSTRACT t ID t sua maior população residente no Maciço de Baturité. O objetivo deste trabalho foi determinar quais características bióticas e abióticas podem interferir na escolha de cavidades para reprodução. Por meio de busca ativa e entrevistas locais foram encontradas 67 cavidades e selecionadas 36 VHQGRFODVVLĆFDGDVHPFRPRUHSURGXWLYDVQ TXDQGR comprovado que ali houve eclosão de ovos e não reprodutivas (n=21). P. griseipectus se apropria de cavidades pré-formadas principalmente nas espécies de árvore Inga ingoides (33,3%) e Albizia polycephala (20%). Foram analisadas as seguintes variáveis das cavidades: a) altura, b) DAP, c) temperatura externa, d) temperatura interna, e) umidade externa, f) umidade interna, g) profundidade, h) diâmetro da entrada, i) entrada do oco em formato circular, j) entrada do oco em formato de ĆVVXUDOSUHVHQ©DGHGRVVHOHPD]LPXWH$VYDUL£YHLVTXH DSUHVHQWDUDPGLIHUHQ©DVVLJQLĆFDWLYDVIRUDP(QWUDGDGR oco de formato circular (GLM, D.D.=5.201, p=0.022, n=19) e umidade interna (GLM, D.D.=5.544, p=0.018, n=25), sendo as reprodutivas mais úmidas do que as não reprodutivas. Tais resultados sugerem que as variáveis microclimáticas podem ser importantes na escolha da cavidade a ser ocupada, sendo necessárias condições ideais para a eclosão dos ovos e manutenção da ninhada. A seleção de hábitat para QLGLĆFD©¥RLQćXHQFLDGLUHWDPHQWHQRVXFHVVRUHSURGXWLYR dos indivíduos, sendo o conhecimento destas variáveis um fator chave na preservação de espécies ameaçadas. 318 3HUĆOSDUDVLW£ULRGHRupornis magnirostris apreendido Page 188, Posters ABSTRACT t Table of Contents e recolhido pelo cetas/ibama no estado do Piauí Renata Sousa Silva1*, Rodrigo Moraes1, Emille Sousa1, Amanda Navegantes2, Simone Freire1, Shirliane Araujo Sousa3 ǢW2-='89-&!&'9;!&<!£&3-!<ÐfTǣW2-='89-&!&' '&'8!£&3 -3&'!2'-83f TǤW2-='89-&!&' '&'8!£&3-!<Ðf r8'£[email protected]$!=-'-8!|#3£W$31W#8 POSTER SESSION: PARASITISM & AVIAN DESEASES As endoparasitoses que acometem a avifauna são de grande LPSRUW¤QFLDSDUDDVD¼GHS¼EOLFDSRLVSRGHPVLJQLĆFDUR agravamento de problemas econômicos, sociais, médicos e ambientais, sobretudo nos países em desenvolvimento. $JUDQGHGLYHUVLGDGHGHHVS«FLHVHQYROYLGDVQRWU£ĆFRGH animais silvestres no Piauí é fator de risco para a disseminação de inúmeros agentes zoonóticos no estado. Diante disso, este WUDEDOKRWHYHFRPRREMHWLYRHVWDEHOHFHURSHUĆOSDUDVLW£ULR de Rupornis magnirostris apreendido e recolhido pelo CETAS do IBAMA-PI. No período de dezembro de 2014 a janeiro de 2015, foram necropsiados dois indivíduos Rupornis magnirostris, e destes, um apresentou estruturas parasitárias. A necrópsia foi realizada no Laboratório de Zoologia e Biologia Parasitária (ZOOBP) na Universidade Estadual do Piauí (UESPI), os órgãos foram separados individualmente em placas de Petri contendo solução salina 0,85% de NaCl e examinados em microscópio estereoscópico e os nematódeos encontrados IRUDPĆ[DGRVHP£OFRROTXHQWH1DDYHHPTXHVW¥R foram encontrados sete indivíduos, os quais, cinco são machos e dois são fêmeas, oriundas do esôfago e do estômago, os quais pertencem ao gênero Contracaecum, pertencente à superfamília Ascarididae e a família Anisakidae. Conclui-se que {փdփTT ID t ABSTRACT t o presente estudo corrobora a hipótese de que os inquéritos parasitológicos podem ser utilizados no entendimento das relações aves-parasitos, trazendo informações sobre a transmissão de doenças para as aves e para o homem. 321 Análises moleculares preliminares revelam separação entre populações de Pipra fasciicauda scarlatina (Hellmayr, 1915) do Nordeste e da Amazônia Dnilson O. Ferraz1*, Larissa Sampaio de Souza1, Pablo Vieira Cerqueira2, Juliana Araripe1, Alexandre Aleixo2, Pricles Sena do Rgo1 ǢW2-='89-&!&' '&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&r#-3i('88!A|,3;1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS A espécie Pipra fasciicauda ocorre na Amazônia Meridional desde os Andes, Brasil Central, e isoladamente no nordeste EUDVLOHLUR+DELWDPDWDVVHFDVPDWDVGHWHUUDĆUPHPDWDVGH WUDQVL©¥RPDWDVGHJDOHULDHćRUHVWDVULEHLULQKDV$WXDOPHQWH são reconhecidas cinco subespécies baseadas em caracteres morfológicos. A compreensão da história evolutiva de SRSXOD©·HVLVRODGDVSRGHFRQWULEXLUSDUDLGHQWLĆFD©¥RGH SURFHVVRVGHHVSHFLD©¥RHPUHI¼JLRVćRUHVWDLV2SUHVHQWH HVWXGRWHPFRPRREMHWLYRYHULĆFDURQ¯YHOGHGLYHUJ¬QFLDHQWUH a população da Caatinga e populações que ocorrem no Bioma Amazônico, por meio de marcadores moleculares. Foram analisados um fragmento mitocondrial (ND2) e um nuclear (G3PDH). Foram amostrados 12 exemplares da população do Nordeste e 12 do bioma amazônico. Por meio da rede de haplótipos, o marcador mitocondrial ressaltou a separação entre as populações, o que não foi possível ser evidenciado Page 189, Posters ID t ABSTRACT t Table of Contents para o marcador nuclear, provavelmente por conta de sua taxa evolutiva mais lenta. A divergência genética para o marcador mitocondrial dentro das populações não ultrapassou 0.2% e entre as populações foi de 0.9%. As análises até o presente momento sugerem que as populações em questão estão em processo de isolamento, uma vez que já é possível observar a presença de haplótipos exclusivos no marcador mitocondrial. Nesse sentido, os resultados apontam para a ocorrência de uma subespécie independente no bioma Caatinga. Caso ocorra DFRQĆUPD©¥RGRVGDGRVSUHOLPLQDUHVDSµVDLQVHU©¥RGH novos marcadores, programas de conservação deverão ser estimulados vistos o isolamento da população do Nordeste e também devido à intensa degradação do seu habitat. 323 Experience-based nest-box and mate choice in the white-rumped swallow Tachycineta leucorrhoa Viviana Massoni1*, Carolina I. Mio2, Florencia Bulit ǢW @f2-='89-&!&&'<'239-8'9TǣW29ধ;<;3&' -3£3+!<#;836-$!£Tf r1!9932-|'+'W($'2W<#!W!8 POSTER SESSION: BEHAVIOUR 1HVWVLWHDQGPDWHFKRLFHFDQSURIRXQGO\LQćXHQFHDQ RUJDQLVPèVĆWQHVVDQGLQGLYLGXDOVRIVRPHQRUWKHUQ hemisphere species use both self- and social information to select nests and mates. To expand the knowledge on southern hemisphere birds we explored the variables associated to nest-box and mate choice in the White-rumped Swallow Tachicyneta leucorrhoa using a nine years? dataset on returning breeders at a colony located in Chascomús (Buenos Aires, Argentina). Breeders presented moderate {փdփTT ID t ABSTRACT t return rates (38.1%) and low local recruitment rates (4.1%). Generalized linear mixed models revealed that, out of eight variables examined, previous breeding performance and mate UHWHQWLRQVLJQLĆFDQWO\H[SODLQHGYDULDWLRQLQQHVWER[DQG mate-choice, although differently for sexes. Female’s reuse RIDSDUWLFXODUER[ZDVVLJQLĆFDQWO\H[SODLQHGE\DVXFFHVVIXO previous breeding experience, while this variable did not affect male’s choice. Nest-box retention alone was a good predictor of mate choice variation in males, while females would choose a mate already settled in a box, regardless of their individual increase in breeding performance. We suggest that box retention by females would be related to maintaining social partners with good abilities as caregivers, indirectly assessed through their box claiming competence. 325 Can exotic tree plantations preserve bird diversity of native woodlands in Buenos Aires, Argentina? Mariela Vernica Lacoretz1*, Sebastin Andrs Torrella2, Gustavo Javier Fernndez1 ID t ABSTRACT t Table of Contents and they are the major native woodlands of the Buenos Aires province; however, only a few remain. Even though the talares face continuous deforestation, little is known about the consequences of their replacement by exotic woodlands on bird biodiversity. We conducted bird census at 52 points in native and exotic woodlands (Pinus spp. and Eucalyptus spp.). At each point where a bird census was made, we also determined structure and composition of vegetation. Exotic tree plantations showed a reduction in bird species richness of at least 50%. Moreover, bird abundance and diversity in talares was higher than in plantations. Community structure differed mainly in the identity of the dominant species. Furthermore, vegetation structure varies between types of woodland, being exotic tree plantations taller and with different composition of strata. This study shows that exotic tree plantations are unsuitable to preserve bird diversity not only because these woodlands differ in woody species composition but also in structure. The results indicate that a high proportion of bird species, formerly present in the region, are unable to adapt to the exotic woodland resulting in large losses of bird species. ǢW8<63&'$3£[email protected];!1-'2;3&'='9TfT2-='89-&!& &'<'239-8'9fTǣW8<63&'9;<&-39&'-9;'1!9$3£+-$!9'2 1#-'2;'9+8$3£!9lmTT T2-='89-&!&&'<'239-8'9 r1£!$38';A|'+'W($'2W<#!W!8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Argentina has become one of the countries with the highest deforestation rate in recent years. Over the last century the country has lost 70 percent of its native forests, leading to large losses of biodiversity. The talares woodlands (Celtis ehrenbergiana) belongs to Espinal ecoregion of Argentina Page 190, Posters {փdփTT ID t ABSTRACT t 326 (VWUDW«JLDVGHIRUUDJHDPHQWRGHEHLMDćRUHV$YHV Trochilidae) em relação à diversidade de recursos ćRUDLVGHPalicourea rigida Kunth (Rubiaceae). Carlos Henrique Nunes1*, Liliane Martins-Oliveira1, Renata Leal-Marques1, Paulo Eugnio Alves Macedo Oliveira1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! ID t ABSTRACT t Table of Contents agonísticos. E. macroura foi a espécie mais agressiva e a resposta “fuga” foi a mais frequente. Nos pontos com menos recursos, $PD]LOLDĆPEULDWD foi a espécie mais agressiva. A distribuição HVSDFLDOGHUHFXUVRVćRUDLVLQćXHQFLRXDGLYHUVLGDGHGH EHLMDćRUHVTXHXWLOL]DUDPP. rigida, e o comportamento de forrageamento e defesa. Agradecimento: FAPEMIG. r,'28-7<'#-3<(<|@!,33W$31W#8 POSTER SESSION: BEHAVIOUR %HLMDćRUHVV¥RDYHVUHVWULWDV¢V$P«ULFDVVHQGRDVSULQFLSDLVD H[SORUDUQ«FWDUćRUDO1RVVDKLSµWHVH«TXHRFRPSRUWDPHQWR GRVEHLMDćRUHVVHU£LQćXHQFLDGRSHODGLVWULEXL©¥RHVSDFLDOGH Palicourea rigida. O objetivo foi determinar como a distribuição de P. rigidaLQćXHQFLDRFRPSRUWDPHQWRGHEHLMDćRUHV2 trabalho foi realizado em uma RPPN de Uberlândia, MG de QRYHPEURDMDQHLUR)RUDPHVWDEHOHFLGRVWU¬V transectos com três pontos de amostragem abrangendo a distribuição espacial de P. rigida. Foram registrados: espécie YLVLWDQWHQ¼PHURGHćRUHVHLQćRUHVF¬QFLDVYLVLWDGDVWHPSRGH forrageamento e ações agonísticas. Foram feitos 307 registros GHRLWRHVS«FLHVGHEHLMDćRUHVEupetomena macroura foi a mais frequente. Phaethornis pretrei exibiu as maiores médias GRQ¼PHURGHćRUHVHLQćRUHVF¬QFLDVYLVLWDGDVUHJLVWUR2 tempo médio de defesa foi maior para E. macroura. Houve correlação positiva entre o número de indivíduos de P. rigida, YDORUFDOµULFRGLVSRQ¯YHOQ¼PHURGHćRUHVHPDQWHVHWHPSR total de visitas, número de registros de visitantes e o tempo de GHIHVD7DQWRRQ¼PHURGHćRUHVYLVLWDGDVTXDQWRRQ¼PHUR de registros foram maior onde havia maior disponibilidade de recursos. O número de encontros agonísticos foi maior nos pontos com maior abundância de P. rígida, sendo 136 encontros Page 191, Posters 328 $LQćX¬QFLDGDSURIXQGLGDGHGHODJRVQDDEXQG¤QFLDGHDYHV piscívoras no Arquipélago de Anavilhanas, Amazônia Central Renata Xavier1*, Renato Cintra1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!f r8'2!;!&!9-£=!?!=-'8|@!,33W$31W#8 POSTER SESSION: HABITAT USE A abundância de aves aquáticas depende das características do habitat em uma escala local. Este é o primeiro estudo na Amazônia brasileira que investigou como os atributos de ODJRVGH£JXDSUHWDLQćXHQFLDPDYHVSLVF¯YRUDVHPQ¯YHO SRSXODFLRQDO2REMHWLYRGHVWHWUDEDOKRIRLYHULĆFDURV efeitos da profundidade de lagos sobre a abundância de aves piscívoras. O estudo foi realizado em novembro-dezembro de 2007, em 45 lagos do Arquipélago de Anavilhanas, Rio Negro, Amazônia Central. Foi utilizado um barco para percorrer cada lago e fazer o levantamento das aves, bem como para coletar os dados das profundidades dos lagos. As espécies Ardea cocoi, Megaceryle torquata e Pandion haliaetus foram positivamente correlacionadas com a profundidade, enquanto Egretta thula esteve negativamente correlacionada. Ardea cocoi é maior que Egretta thulaHVHEHQHĆFLDGHODJRVPDLVSURIXQGRV porque consegue forragear em áreas mais profundas. {փdփTT ID t ABSTRACT t Parece existir um limite de profundidade para espécies SHUQDOWDVFRPRDVJDU©DVLQćXHQFLDGRSHORFRPSULPHQWR das pernas. Pandion haliaetusVHEHQHĆFLDGHODJRVPDLRUHV e mais profundos pois tende a concentrar a pesca em águas abertas e no centro de lagos, onde a profundidade é maior. Megaceryle torquata costuma pescar a partir de poleiros altos e seleciona os lagos mais profundos porque requerem um mínimo de água para pescar e não colidirem com o fundo. Os resultados mostram claramente que as populações de GLIHUHQWHVHVS«FLHVGHDYHVDTX£WLFDVV¥RLQćXHQFLDGDV pela profundidade de lagos de água preta na Amazônia. 329 A meta-analysis of New World nest predators Joo C. T. de Menezes1*, Miguel ngelo Marini2 ǢW'2;83&'-Í2$-!9-3£+-$!9'&!!&'T2-='89-&!&'8'9#-;'8-!2! !$0'2A-'TǣW'6!8;!1'2;3&' 33£3+-!T2-='89-&!&'&'8!9£-!TǤW r/3$!;'1'|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Predation is the primary cause of nest mortality and a powerful selective agent in most New World bird species. Numerous VWXGLHVKDYHWULHGWRĆQGIDFWRUVUHODWHGWRWKHSUH\èVQHVWLQJ ELRORJ\WKDWFRXOGLQćXHQFHSUHGDWLRQUDWHVEXWIDLOHGWRUHDFK a universally applicable consensus. It is increasingly suggested that the approach should instead begin with the study of nest predators. This study aims to compile a comprehensive list of FRQĆUPHGQHVWSUHGDWRUVLQWKH1HZ:RUOG/LWHUDWXUHZDV searched for records of nest predation detected by direct observation or remote monitoring. A total of 248 species belonging to 62 families were recorded depredating nests of 342 bird species in 19 countries. 51% of the predators were Page 192, Posters ID t ABSTRACT t Table of Contents birds, 30% mammals, 14% reptiles and 4% arthropods, notably ants and crabs. 60% of all references mention events that took place in the United States, causing this country’s predator list to be the most numerous. Corvidae, Accipitridae, Laridae and Ramphastidae accounted for most species of predators among birds, Sciuridae and Cebidae among mammals, and Colubridae among reptiles. Genera that depredated the nests of most species (20 each) were Corvus, Larus, Molothrus, Cyanocitta and Accipiter (birds), Cebus and Procyon (mammals), and Pantherophis, Pituophis and Coluber (reptiles). Nutrition and competition seem to be the major motivating factors behind nest predation. This work will hopefully provide a valuable basis for future studies and management plans, but it also shows the need of further investigation on the identity of nest predators, especially those in the Neotropical region. 330 Efeito da riqueza de habitats marginais de lagos sobre a abundância de aves piscívoras no Arquipélago de Anavilhanas, Amazônia Central Renata Xavier1*, Renato Cintra2 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!f r8'2!;!&!9-£=!?!=-'8|@!,33W$31W#8 POSTER SESSION: HABITAT USE 3HODSULPHLUDYH]SDUDD$PD]¶QLDYHULĆFDPRVDQ¯YHO populacional, se a abundância de aves piscívoras depende das características do habitat em uma escala local. O objetivo IRLYHULĆFDURVHIHLWRVGDULTXH]DGHKDELWDWVPDUJLQDLVGH lagos sobre a abundância de aves piscívoras. O estudo foi realizado em novembro-dezembro de 2007, em 45 lagos do {փdփTT ID t ABSTRACT t ID t Arquipélago de Anavilhanas, Amazônia Central. Foi utilizado um barco para percorrer cada lago para registrar as aves e a ULTXH]DGHKDELWDWVĆVLRQRPLDGDYHJHWD©¥RQDVPDUJHQV dos lagos. As espécies Anhinga anhinga, Ardea alba, Ardea cocoi, Megaceryle torquata, Pandion haliaetus e Phalacrocorax brasilianus estiveram positivamente correlacionadas com a riqueza de habitats. Estas espécies dependem da disponibilidade de poleiros para caçar, descansar ou secar as penas, portanto lagos com maior riqueza de habitats favorecem o aumento na abundância destas espécies. As garças Ardea alba e Ardea cocoi, assim como outras espécies da família Ardeidae, descansam GXUDQWHRGLDHRXIRUPDPFRO¶QLDVQDYHJHWD©¥RPDUJLQDOGH corpos d’água, sendo a vegetação arbórea muito importante para estas aves. Phalacrocorax brasilianus e Anhinga anhinga descansam por longos períodos na vegetação na margem d’água, secam e fazem a manutenção de suas penas após mergulhos, além de usarem a vegetação para reprodução. Megaceryle torquata pesca a partir de poleiros altos na beira d’água e Pandion haliaetus costuma empoleirar-se antes de pescar e para comer a presa após a captura. A riqueza de habitats marginais é um fator determinante na variação na abundância local de aves piscívoras na Amazônia. 332 Morfologia comparada da asa da tesourinha Page 193, Posters ABSTRACT t Table of Contents (Tyrannus savana) na América do Sul Ivan Celso Carvalho I.C.C. Provinciato1*, Alejandro Edward A.E. Jahn2 ǢW2-='89-&!&'9;!&<!£!<£-9;!f-3£!83 r-=!2i$'£93|+£3#3W$31 POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY Pesquisas realizadas no hemisfério norte mostraram que aves que migram por longas distâncias tendem a ter asas com uma morfologia mais pontuda em relação às aves que migram por pequenas distâncias. Possivelmente isso ocorre porque asas PDLVSRQWXGDVDXPHQWDPDHĆFL¬QFLDHUDSLGH]SDUDY¶RV de longa distância. Essa relação também será verdadeira para aves que migram entre os trópicos e o hemisfério sul? Nós comparamos a morfologia da asa de Tesourinhas não migratórias (Tyrannus savana monachusTXHQLGLĆFDPDRQRUWH da América do Sul e de migratórias (Tyrannus savana savana), que invernam em áreas em comum com os residentes mas QLGLĆFDPDRVXOGD$P«ULFDGR6XO$O«PGLVVRQµVWDPE«P FRPSDUDPRVDPRUIRORJLDGDDVDGDTXHOHVTXHQLGLĆFDPQD $UJHQWLQDHGDTXHOHVTXHQLGLĆFDPQR%UDVLOYLVWRTXHRVTXH QLGLĆFDPQR%UDVLOY¥RPLJUDUPHWDGHGDGLVW¤QFLDHPUHOD©¥R àqueles que migram para a Argentina. Utilizando diferentes medidas da asa bem como o peso da ave nos permitiu obter valores de wing loading, aspect ratio e kipp’s distance. Utilizando esses valores, nós encontramos diferenças entre populações migratórias e populações não migratórias e também entre as populações que migram distâncias maiores (Argentina) em relação àquelas que migram distâncias menores (Brasil). Estes valores obtidos sugerem que a morfologia da asa da Tesourinha sofre uma pressão seletiva da migração, mas indicam também {փdփTT ID t ABSTRACT t que a morfologia da asa pode ser afetada por estratégias de forrageamento, idade e principalmente pelo sexo, onde machos tendem a possuir asas mais pontudas que as fêmeas. 334 Comportamento alimentar de psitacídeos em 0DXULWLDćH[XRVDem Uberlândia – MG Camila P. Teixeira1*, Renata Leal-Marques1, Carlos Henrique Nunes1, Liliane Martins-Oliveira1 ǢW2-='89-&!&' '&'8!£&'#'8£Ç2&-! r;'-?'-8!6W$!1-£!|+1!-£W$31 ID t ABSTRACT t Table of Contents 41.5 horas de observação em 0ćH[XRVD, sendo efetuados 70 registros de indivíduos de Brotogeris chiriri em 0ćH[XRVD, dos quais em 21 foi observado consumo de fruto. O tempo médio de consumo de frutos foi de 153,6 ± 119,7 s. O número de indivíduos de B. chiriri e a duração do consumo de frutos de 0ćH[XRVDaumentaram quanto menor o número de frutos fechados (r=-0,71; p<0,05; r=-0,74; p<0,05). Frutos abertos de 0ćH[XRVDpor sua coloração chamativa podem atuar como um atrativo para B. chiriri consumir os frutos da espécie vegetal, independente da quantidade. Agradecimento: Fapemig POSTER SESSION: BEHAVIOUR Muitos frugívoros, tem na polpa de frutos a fonte de recursos alimentares. Os Psittacidae tem sua dieta composta principalmente de frutos, sementes e bagas. O trabalho teve por objetivo determinar e comparar o comportamento de forrageamento de aves da família Psittacidae em Mauritia ćH[XRVD e determinar a relação entre o número de frutos da planta e os comportamentos das aves. Nossa hipótese é que as espécies de psitacídeos apresentariam comportamentos de forrageamento diferentes entre si ao se alimentarem de frutos de 0ćH[XRVD e a disponibilidade de frutos iria interferir nos comportamentos das aves. O estudo foi realizado em veredas da cidade de Uberlândia - MG. As observações foram realizadas de Novembro de 2014 a Janeiro de 2015 no período da manhã (07:00 - 12:30h) e tarde (14:00 - 18:30h). O método de observação utilizado foi animal focal. As estratégias de forrageamento foram divididas em 3 categorias: tática de forrageamento, tática de manipulação (consumo) e FRPSRUWDPHQWRDSµVDYLVLWD)RLTXDQWLĆFDGRRQ¼PHURGH frutos disponíveis no ponto de observação. Foram realizadas Page 194, Posters 338 Bird survey gaps in the Brazilian Pampas: conservation implications Thaiane W. da Silva1*, Graziela Dotta1 ǢW32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£ r;,!-!2'>9|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION The Pampas biome occupies 63% of Rio Grande do Sul state in Brazil. Besides the huge biodiversity of its grasslands, conversion to agriculture is currently the main threat for the region. More than 380 species of birds occur in the Pampas (12,5% under threat). Here we compiled information about locality records of bird studies in the Pampas aiming to identify gaps of study. We carried out a literature review (Scopus and Web of Knowledge) looking for studies in the last 20 years, and we got species’ presence data from museum collections. Next we organized a list of localities and the number of studies carried out at each place, and plotted them on a map of the biome. We added a 25x25 km grid to {փdփTT ID t ABSTRACT t LGHQWLI\JDSDUHDVGHĆQHGDVVTXDUHVRQWKHJULGZLWKRXW VWXGLHVWKHQZHYHULĆHGKRZVWXGLHVZHUHGLVWULEXWHGLQDUHDV important for grassland conservation: Valuable Grassland Areas (VGAs), Brazilian Ministry of Environment Priority Areas for Conservation (MMA), Important Areas for Birds (IBAs), and Protected Areas (PAs). Only 34% of the Pampas had at least one study, highlighting the need of more effort across great part of the region to improve knowledge of birds’ occurrence and distribution. The percentage of area surveyed was similar for VGAs (20%), MMA (14%), and IBAs (21%), emphasising the poor knowledge on birds’ distribution in areas important for conservation. Turning to PAs, more than a half of them do not have any information about the occurrence of bird species. The uneven distribution of research among Brazilian biomes, with the Pampas among the less known, emphasises the importance of studies like ours that helps to guide where to focus future research. 339 3URWRFRORQXWULFLRQDOGHUHDELOLWD©¥RSDUDĆOKRWHV de andorinhão-do-temporal (Chaetura meridionalis) realizado na divisão de medicina veterinária e m Lais P. Caccia 2-='89-&!&'8'9#-;'8-!2!!$0'2A-' ID t ABSTRACT t Table of Contents humana na cidade. Uma espécie com adaptação interessante é o andorinhão-do-temporal (Chaetura meridionalis) que substituiu o oco das árvores pelo interior das chaminés SDUDQLGLĆFDUQRYHU¥R3HODDQDWRPLDGRQLQKRDTXHGD GRVĆOKRWHVGHDQGRULQK¥RQDVFKDPLQ«V«UHFRUUHQWHQHVVD época, causando um aumento no número de recebimentos desses animais na Divisão Técnica de Medicina Veterinária e Manejo da Fauna Silvestre (DEPAVE-3), da Secretaria Municipal do Verde e do Meio Ambiente - PMSP, que ao longo dos anos vem apresentando baixas taxas de sucesso na reabilitação dos mesmos. Portanto, foi testado o protocolo nutricional de Kyle & Kyle (2004) que é realizado com sucesso em Chaetura pelagica, visando aumentar as taxas de reabilitação em Chaetura meridionalis. O trabalho foi realizado com 30 animais, apresentando sucesso de 46% na reabilitação, o maior dos últimos 4 anos. Durante o mês do tratamento os andorinhões apresentaram comportamentos de estampagem por agrupamento e altruísmo entre parentes. A soltura foi realizada em chaminé de residência já habitada por outros indivíduos da espécie e foi monitorada pelo munícipe todos os dias até a migração dos mesmos. Os ĆOKRWHVPXLWRLPDWXURVQ¥RUHVLVWLUDPHSRUWDQWRIRUDP propostas para estes metodologias diferentes para seu tratamento inicial, antes que chegue ao DEPAVE-3. £!-9Ǣǧ|,3;1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS A pressão antrópica ao longo dos anos provocou grandes PRGLĆFD©·HVQRVHFRVVLVWHPDVHKDELWDWVGRVDQLPDLV silvestres. As aves, por exemplo, conseguiram se adaptar bem a essas mudanças, passando a conviver com a população Page 195, Posters {փdփTT ID t ABSTRACT t 342 Densidad, uso de hábitat y patrón de actividad de Strigiformes en un bosque seco andino Juan F. Freile 31-;$<!;38-!23&''+-9;83982-;3£+-$39 /(8'-£'3|@!,33W$31 POSTER SESSION: BEHAVIOUR Existen muy pocos estudios sobre las aves nocturnas andinas. La composición y ecología de las comunidades no ha sido estudiada en los Andes del norte. Por ello, investigamos la densidad poblacional, distribución espacial y uso de hábitat de búhos (Strigiformes) en un bosque seco andino en Jerusalem, provincia de Pichincha, Ecuador (2300 m de altitud), entre abril 2011 y marzo 2012. Adaptamos un protocolo de mapeo de transectos con bandas de distancia paralelas a la línea media. Estimamos la posición de cada búho registrado (primer contacto visual o auditivo) tomando el ángulo de ubicación y banda de distancia. Con la acumulación de puntos de registro en el mapa, modelamos la distribución espacial de territorios y estimamos su densidad poblacional. De seis especies registradas, Tyto alba y Athene cunicularia mostraron alta densidad en distintos hábitats, mientras que Ciccaba albitarsis y Aegolius harrisii se encontraron en baja densidad en matorral seco montano maduro y zonas más húmedas. Asio stygius y Bubo virginianus se encontraron en hábitats DOWHUDGRVDXQTXHP£VHVSHF¯ĆFRVTXHT. alba y A. cunicularia. Existe superposición de territorios entre T. alba, A. cunicularia y A. stygius, mientras C. albitarsis y A. harrisii ocuparon espacios más restringidos y parcialmente superpuestos con las especies más abundantes. Adicionalmente, analizamos variables climáticas y de luminosidad que sugieren que Page 196, Posters ID t ABSTRACT t Table of Contents los búhos vocalizan más en las primeras horas de noches oscuras y sin viento. Recomendamos estudiar comunidades nocturnas con similar composición de especies en ecosistemas húmedos para determinar si mantienen los patrones de abundancia y uso de hábitat encontrados en Jerusalem. 344 Birds of southern Brazilian grasslands Eduardo Chiarani1*, Christian B. Andretti1, Carla S. Fontana1 ǢW r'$,-!8!2-|@!,33W$31W#8 POSTER SESSION: DIVERSITY & DISTRIBUTION The southern grasslands of South America, located in two Brazilian biomes (Pampa - PA and Mata Atlântica - MA) and part of Uruguay, Argentina, and Paraguay, have been suffering large changes in land use, with severe consequences in loss of biodiversity. From September 2014 to January 2015 we surveyed birds in 13 sites spread across the Brazilian southern grasslands (nine in PA and four in MA biome), aiming to compare their bird communities. Birds were recorded by point counts (24) and transects (12), distributed in areas of grassland as well as adjacent riparian forests, in each of the study sites. We recorded 299 bird species (280 in PA grasslands and 188 in MA grasslands), with 19 threatened species (at regional, national or global level). The similarity between bird communities of the two biomes was 0.56 (Jaccard’s index). The 13 sites showed similar values of species richness, with a mean of 136.9 ± 13.4 species by area (ranging from 114 to 157). The PA biome had 111 exclusive species and 13 threatened, while only 19 species were found exclusively {փdփTT ID t ABSTRACT t on MA grasslands (10 threatened species). The species richness we recorded corresponds to approximately 63% of the total species known to occur in the Brazilian southern JUDVVODQGV0RVWRIWKHVSHFLHVZHGLGQRWĆQGDUHIRUHVW related taxa. Differences between the bird communities of the two biomes might be related to elevation and isolation of the MA grasslands compared to PA grasslands. More surveys would help clarify whether these differences occurred due to sample effects or might be explained by the greater heterogeneity of grassland typologies in the Pampa biome. 345 Breeding success of the Brazilian population of Gubernatrix cristata Christian Beier1*, Mrcio Repenning1, Mauricio S. Pereira1, Andr Pereira1, Carla S. Fontana1 ǢW32ধऄ$-!2-='89-&!&'!;Õ£-$!&3-38!2&'<£ ID t ABSTRACT t Table of Contents IRUGD\VDQGWKHQHVWOLQJVćHGJHDWGD\V0D\ĆHOGèV QHVWLQJVXFFHVVZDV7KHPHDQQXPEHURIćHGJOLQJV from successful nests was 1.6 (1-3) chicks. Eggs of Molothrus bonariensis were found in 60% of the nests with a mean of 1.5 egg per parasitized nest (n=14). Predation was the main cause of nest loss (82%), followed by abandonment after puncture of eggs by female M. bonariensis (14%). We recorded helpers at nests in two territories on each breeding season, where we observed re-nesting after successful attempts. 6XUYLYDOUDWHRIĆUVWPRQWKćHGJOLQJVZDV:HUHFRUGHG inbreeding between a male and its offspring. The low nesting success raises some concerns about the maintenance of the Brazilian population of G. cristata, which is target of a captive breeding program. Understanding the autoecology of G. cristata is fundamental to provide the base to next government strategies to manage and conserve the Brazilian population. r#'-'8W382-;3|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION The globally endangered passerine Gubernatrix cristata occurs in Argentina, Uruguay and Brazil. Bird trapping and habitat loss are the main causes for its fast population decline in the last decades. The only known wild population of G. cristata in Brazil is located in the municipality of Barra do Quaraí, state of Rio Grande do Sul, and it is estimated to be less than 100 individuals. We investigated the breeding biology of this population in two breeding seasons from 2013-2015. Breeding begins in October, with a peak of nesting attempts in late November, and lasts until February. We found 30 nests (14 and 16 nests on each season, respectively). The modal clutch size was three eggs (2-4 eggs). The incubation period lasts Page 197, Posters 348 Antecedentes reproductivos y cuidado parental de Cóndor Andino (Vultur gryphus) en Chile Central Víctor Escobar-Gimpel1*, Sergio Alvarado2, Anir Muñoz1 ǢW38638!$-Õ21-+39&'£Õ2&38TǣW83+8!1!&'!£<&1#-'2;!£T29ধ;<;3 &'!£<&3#£!$-32!£T !$<£;!&&''&-$-2!T2-='89-&!&&',-£' r='+-16'£|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Los antecedentes sobre la reproducción en vida silvestre de Cóndor Andino (Vultur gryphus), especie típicamente carroñera, son escasos a lo largo de todo su rango de distribución, extendiéndose desde Venezuela hasta Cabo de Hornos, principalmente a lo largo de la cordillera de Los Andes. El objetivo del siguiente trabajo es contribuir al conocimiento {փdփTT ID t ABSTRACT t ID t sobre la biología reproductiva de la especie, entregando DQWHFHGHQWHVVREUHQLGLĆFDFLµQHQOD]RQDFHQWUDOGH&KLOH y el cuidado parental en dos nidos. Entre 2007 y 2009, se UHDOL]µXQDE¼VTXHGDLQWHQVLYDGHWHUULWRULRVGHQLGLĆFDFLµQ\ el estudio de cuidado parental de dos parejas reproductivas. 6HLGHQWLĆFDURQWHUULWRULRVGHQLGLĆFDFLµQDO(VWHGHOD ciudad de Santiago, en la cordillera de Los Andes. En los dos territorios estudiados durante la época reproductiva, los machos ingresaron al nido con mayor frecuencia que las hembras (62,2% vs 26,4%; N=21) y (50% vs 37%; N=47). El transporte de alimento al nido y la conducta de alimentación de la cría fueron realizados con mayor frecuencia por el macho (65% vs 35%; N=28) y (63,6% vs 36%; N=19). La interacción padre-cría sin entrega de alimento fue realizada más frecuentemente por la hembra en un nido (75% vs 25%; N=4) y en igual proporción por los padres en el otro. La vigilancia del territorio fue realizada más frecuentemente por el macho en un nido (56% vs 40%; N=91) y por la hembra en el otro (54,6% vs 41,2%; N=24). Contrariamente a lo observado en otros estudios, las conductas de cuidado parental son compartidas por los padres, las que podrían estar determinadas por la oferta y disponibilidad de alimento. 356 Responses of urban tolerant birds to the level Page 198, Posters ABSTRACT t Table of Contents of urbanization in a neotropical city Rafael Amorin1*, Vincius Abilhoa2 ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&' '&'8!£ &3!8!2ÆTǣW<9'<&'-9;Õ8-!!;<8!£&3!63&!1#<-! r!138-2W8!(!'£|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES This paper compares the proportion of urban tolerant birds in the urban avian community and the amount of built-up areas, mostly impervious surface, as indicators of urbanization on patterns of avian species composition in a Neotropical city in Southern Brazil. From September to December 2013 (breeding season), bird surveys were conducted in 120 squares of 100 ha randomly select within Curitiba. All bird species seen or KHDUGGXULQJWKHVDPSOHWLPHIUDPHPLQVTXDUHZDV UHFRUGHG8UEDQWROHUDQWELUGVZHUHLGHQWLĆHGEDVHGRQWKHLU tolerance and ability to exploit urbanized areas. The extent of XUEDQPRGLĆFDWLRQDQGGLVWXUEDQFHZDVHVWLPDWHGGLUHFWO\ from urban landscape data analyses through a geographic information system. For each sample point (square) the amount of built-up areas (e.g. buildings, roads, industrial areas, pavedRYHUVRLOFRPSDFWHGQHDULPSHUYLRXVRSHQVSDFHVZDV measured. Simple regressions were performed to assess the relationship of overall species richness (log) and the percentage of urban tolerant birds (log) against the percentage of built-up areas as the predictor variable. We recorded 102 bird species, including 13 urban tolerant species. As expected, urbanization VLJQLĆFDQWO\UHGXFHGVSHFLHVULFKQHVVEXWXUEDQWROHUDQW VSHFLHVZHUHOHVVDIIHFWHGWRFKDQJHVRQODQGPRGLĆFDWLRQV {փdփTT ID t ABSTRACT t associated to urban growth, probably because such guild can XVHYDULRXVW\SHVRIKDELWDWLQWKHKXPDQPRGLĆHGHFRV\VWHP The increase of “urban-adaptable” species in intermediate and high urbanized areas was probably favored by the availability of nest sites and food, and also by the higher temperature caused by the impermeabilization of the land surface. 360 Alpha taxonomy of Momotus momota (Linnaeus, 1766) (Aves: Momotidae) Gabriella R. Frickes1*, Marcos A. Raposo1, Dante M. Teixeira1 ID t ABSTRACT t Table of Contents Momotus lessonii and Momotus subrufescens are distinct species, examining the nomenclatural aspects and proposing the best possible treatment to be applied at the time. Thus, we selected 14 plumage characters and six distinct measures, which would be analyzed using Statistica 8. The study of DSSUR[LPDWHO\VWXIIHGVSHFLPHQVEHORQJLQJWRĆYH museums revealed the existence of a single diagnosable species, Momotus momota (Linnaeus, 1766), which has wide distribution and has great polymorphism. Future studies with different approaches, including genetic nature, may complement the observation of certain distribution patterns observed. ǢW<9'<!$-32!£c2-='89-&!&' '&'8!£&3-3&'!2'-83 r+!#8-'££!(8-$0'9|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY Described by Brisson in 1760, the Momotus genus encompasses three species currently recognized. Momotus momota (Linnaeus, 1766) can be found from Mexico to northwestern Argentina and most of Brazil, and is characterized by the black bill, red eyes, black pileum, blue crown, black periophthalmic mask, “stickpin” green with cinnamon, chest with two black spots, and the spatula formed at the tip of its long tail. The taxonomic revisions carried out point to the existence of variations in size and plumage of this species along the geographical range, and such diversity resulted in 20 subspecies described, a complex with intricate nomenclature that needs a taxonomic revision, as the evaluation of the polytypic species without the use of VXEVSHFLĆFOHYHOLVHVVHQWLDOIRUWKHHVWDEOLVKPHQWRIFRQVLVWHQW species (Cracraft, 1983; Nelson & Platnick, 1981). This study aims to test the hypothesis suggested by Snow (2001) that Momotus momota, Momotus coeruliceps, Momotus bahamensis, Page 199, Posters 363 Temporal coordination of duet singing in the Rufous Hornero Pedro Diniz1*, Gianlucca S. Rech1, Pedro H.L. Ribeiro1, Regina H. Macedo1 ǢW2-='89-&!&'&'8!9-£-! r6&!&-2-A|+1!-£W$31 POSTER SESSION: BIOACOUSTICS Female and male Rufous Horneros (Furnarius rufus) emit sexVSHFLĆFVRQJW\SHVVLPXOWDQHRXVO\WRSHUIRUPGXHWV7KUHH hypotheses have been proposed to explain how individuals adjust their singing tempos to coordinate songs in duets. ,QGLYLGXDOVPD\FRPELQHĆ[HGVRQJVLQWRGXHWVWKURXJKDQ initial and common cue (i.e., they do not make adjustments during the course of a duet). Alternatively, an individual may adjust its singing tempo based upon what it sang previously in the same duet (i.e., autogenous feedback), or based upon what its partner sang previously in a duet (i.e., heterogenous feedback). We recorded duets from a banded and urban population of Rufous Hornero in Central Brazil, and then GHOLPLWHGWKHĆQHGHWDLOVRIWLPLQJIRUPDOHDQGIHPDOH {փdփTT ID t ABSTRACT t songs in each duet. Based on preliminary analysis, we found that duration in songs by males and females was positively correlated, suggesting that at least one sex was adjusting its VLQJLQJWHPSRGXULQJWKHFRXUVHRIDGXHW:HDOVRYHULĆHG ZKHWKHUWKHWLPLQJRIQRWHW\SHFKDQJHLVPRUHLQćXHQFHG by the timing of the individual or its partners past notetype change. Interestingly, we found that male note-type FKDQJHZDVPRUHLQćXHQFHGE\LWVSDUWQHUVODVWQRWHW\SH ZKHUHDVIHPDOHQRWHW\SHFKDQJHZDVPRUHLQćXHQFHGE\ its own last note-type change. Our results suggest that males are mostly responsible for duet coordination in horneros because they responded to females to coordinate duets (heterogenous feedback hypothesis). In contrast, females may contribute to duet coordination through the autoadjustment of song tempo (autogenous feedback hypothesis). 372 $VSHFWRVGHPRJU£ĆFRVGHOFKRUOLWRFRUGLOOHUDQR (Phegornis mitchellii) en los andes de Chile Central Andrea Minoletti1*, Fernando Daz2, Jim Johnson3, Andrea Contreras1, Anir Muoz2 ǢW2-='89-&!&&',-£'T !$<£;!&&'-'2$-!9 38'9;!£'[email protected]&'£! 329'8=!$-2&'£!!;<8!£'A!W!#38!;38-3&'$3£[email protected]&!-£='9;8'WT ǣW'&&'#9'8=!&38'9&'='[email protected]&!-£='9;8'&',-£'TT ǤW -9,!2&-£&£-(''8=-$'T£!90!W2$$,38!+'W!2!&!W ID t ABSTRACT t Table of Contents efectos antropogénicos y climáticos. Nuestro estudio es el SULPHUHVIXHU]RSDUDGHWHUPLQDUDVSHFWRVGHPRJU£ĆFRV de P. mitchellii. El estudio se desarrolló en el Valle del Río Yeso (-33,64° S, -69,93° O), Chile central, durante cuatro temporadas reproductivas entre 2010-2014. Durante todo el periodo marcamos individualmente 101 aves (adultos y juveniles), y monitoreamos 66 familias distintas. Para estimar la tasa de sobrevivencia aparente utilizamos el método de captura-recaptura, y a través del Programa MARK determinamos una sobrevivencia aparente de adultos moderadamente alta (0,77), con un modelo constante (i.e., sin efecto del tiempo). La detección interanual de juveniles es muy baja como resultado de una baja sobrevivencia o una dispersión fuera de nuestra área de estudio. Para evaluar la tasa de reproducción anual determinamos el número total de eclosiones durante una temporada. Observamos que las parejas reproductivas producen exitosamente > 1 nidada, de 2 huevos, durante cada temporada, resultando HQXQWRWDOGHHFORVLRQHVSDUHMDUHSURGXFWLYDWHPSRUDGD Nuestro estudio sugiere que la tendencia de la población local es estable, y probablemente su tamaño esté regulado por la limitada disponibilidad de manantiales y humedales salobres, de los cuales la especie depende para forrajear. r!2&8'!W1-23£'ষ|+1!-£W$31 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY Con una población estimada de <10.000 individuos, el Chorlito Cordillerano (Phegornis mitchellii) es una de las aves playeras más raras del mundo. La especie es endémica de los humedales altoandinos, los que están amenazados por Page 200, Posters {փdփTT ID t ABSTRACT t 373 UEcoNet: Envisioning collaboration among cities, regions and countries Juliana Bedoya-Durn1*, Farah Carrasco-Rueda1, Anglica GarcaVillacorta1, Flavia A. Montao-Centellas1, Mariana Villegas-Bilbao1 ǢW2-='89-;@3( £38-&! r1/#'&[email protected]!|<*W'&< POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES +XPDQGRPLQDWHGHFRV\VWHPVRFFXUZRUOGZLGHDQGbKDYH been increasingly the focus of ecological research. Surprisingly, despite having some of the largest cities in the world, Latin American research on urban ecology is still poorly developed. Envisioning a collaboration network among researchers with focus on urban ecology, we engaged representatives from Tropical Andean countries to join efforts to launch UEcoNet: an Urban Ecosystems Network . UEcoNet will serve as a platform IRUGDWDVKDULQJRQXUEDQHFRV\VWHPVDQGbWRVWUHQJWKHQ FROODERUDWLRQDPRQJVFLHQWLVWVDQGbWKHSXEOLFLQJHQHUDO7KH WZRPDLQJRDOVRI8(FR1HWDUH7RFROOHFWDQGbV\QWKHVL]H GDWDRQXUEDQELRGLYHUVLW\DQGbWRLPSOHPHQWFURVVVLWH VWXGLHVIRUGDWDFROOHFWLRQRQGHWHUPLQHGWRSLFVHJVSHFLĆF taxa, ecosystem services, ecological processes) following standardized methods to allow comparisons. Our preliminary evaluation showed that, although still limited, the information on bird diversity in Neotropical urban ecosystems still surpases WKHLQIRUPDWLRQIURPRWKHUWD[D7KHUHIRUHGXULQJWKHĆUVW stage, UEcoNet will focus on synthesizing information on XUEDQDYLIDXQDDQGbGHVLJQLQJDFURVVVLWHH[SHULPHQWWR survey urban birds in Neotropical cities. Although initially centered on Neotropical countries, UEcoNet is open to Page 201, Posters ID t ABSTRACT t Table of Contents researchers from any country. Participants from research LQVWLWXWLRQVDQGb8QLYHUVLWLHVDUHZHOFRPHWRMRLQWKHQHWZRUNb 374 Descrição de nove ninhos de aves em um fragmento de Mata Atlântica em Murici - AL Hermnio A. L. S. Vilela1*, Cauay V. Gazele1, Arthur B. de Andrade1, Mrcio A. Efe1 ǢW2-='89-&!&' '&'8!£&'£!+3!9 r,'81-2-3=-£'£!|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Estudar a biologia reprodutiva de aves é um passo importante para entender a sua história de vida, assim contribuir para várias áreas de conhecimento, como ecologia, conservação e manejo. Apesar disso, para muitas espécies não existe nenhuma descrição de seus ninhos, ovos e parâmetros reprodutivos, WDLVFRPRWHPSRGHLQFXED©¥RHSHUPDQ¬QFLDGHĆOKRWHV no ninho. O objetivo desse trabalho foi analisar parâmetros reprodutivos e caracterizar morfológica e biometricamente ninhos de aves em um dos maiores fragmentos remanescentes do Centro de Endemismo Pernambuco em Alagoas, bem FRPRLGHQWLĆFDUSRWHQFLDLVSUHGDGRUHV2IUDJPHQWRHVW£ inserido na Estação Ecológica (ESEC) de Murici, onde foram realizadas expedições mensais entre setembro de 2014 à abril de 2015. Os ninhos foram encontrados a partir de busca ativa por sinais de reprodução. O monitoramento das atividades dos ninhos foi realizado virtualmente por meio de armadilhas IRWRJU£ĆFDVHPHGLGRUHVGHWHPSHUDWXUDGDWDORJJHU2V QLQKRVIRUDPFODVVLĆFDGRVFRPRGRWLSRFDYLGDGHVHPW¼QHOH copo raso ou fundo com variações na forma de sustentação. No total foram encontrados nove ninhos ativos de espécies {փdփTT ID t ABSTRACT t diferentes. Somente um dos ninhos alcançou o sucesso aparente, com recrutamento dos ninhegos. Todos os outros foram considerados predados ou abandonados. As armadilhas IRWRJU£ĆFDVUHJLVWUDUDPDSUHGD©¥RGRVQLQKRVSRUXPURHGRU marsupial, uma serpente Sibynomorphus sp. e por quati, Nasua nasua. Informações sobre cuidado parental em Thamnophilus aethiops também são adicionadas. Contudo, os ninhos monitorados apresentaram um baixo sucesso reprodutivo coerentes com fragmentos conservados de Mata Atlântica. 375 Ecologia de forrageamento de Empidonomus varius (Aves: Tyrannidae) em ambiente urbano: respostas a variações temporais, ambientais e sazonais Liliane Martins-Oliveira1*, Carlos Henrique Nunes1, Renata Leal-Marques1, Oswaldo Maral Júnior1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r£-£-!2''$3<(<|+1!-£W$31 ID t ABSTRACT t Table of Contents duas vezes por estação (seca e chuvosa) por ano, no período da manhã. Foram realizadas 180h de observação em 2009, e KHP2P«WRGRGHREVHUYD©¥RIRLDQLPDOIRFDO registrando os comportamentos relacionados à procura, ataque e substrato. Foram utilizados os testes Qui-quadrado e MannWhitney para as análises. O tempo de procura por poleiro maior no ano de 2009 nas praças pode estar associado à seletividade ou disponibilidade de presas. E varius forrageou mais alto no DQRGHQDVSUD©DVRQGH«PDLVLQWHQVDDDWLYLGDGH humana. O uso preferencial de substratos vegetais destaca a importância da arborização. Em relação aos tipos ambientais H¢VD]RQDOLGDGHHPQ¥RIRLREVHUYDGDPXGDQ©DQRV tempos de forrageio de E. varius. A plasticidade comportamental pode explicar a ausência de diferenças em alguns aspectos do comportamento em resposta às mudanças ambientais e sazonais. Compreender esses padrões comportamentais das aves contribui para história de vida, o planejamento e manejo dos espaços urbanos. Agradecimento: Fapemig. POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Tiranídeos se adaptaram a vários ambientes e apresentam amplo repertório comportamental. Nossa hipótese é que o forrageamento de uma ave terá variações em resposta a fatores ambientais, mudanças sazonais e temporais. Este estudo objetivou avaliar diferenças no comportamento de forrageamento de Empidonomus varius em resposta a variações temporais, sazonais, e tipo de ambiente urbano. O trabalho foi UHDOL]DGRQD]RQDXUEDQDGH8EHUO¤QGLD0*%UDVLO1RVDQRV de 2012 a 2014, foram estabelecidas 30 parcelas em parques e 30 em praças, em 2009 foram estabelecidas 21 parcelas em praças e 12 em parques. Todas as parcelas foram amostradas, Page 202, Posters 376 Eroding the differences: agriculture and cattle promotes biotic homogenization in resident bird communities of Mexican tropical dry forest Leopoldo D. Vzquez-Reyes1*, Maria del Coro Arizmendi1, Hctor Octavio Godnez lvarez1, Adolfo Gerardo Navarro Sigenza1 ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3 r£'363£&3W=!A7<'A|<2!1W1? POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Agricultural activities promote changes in natural ecosystems that generate homogenous ecological conditions according {փdփTT ID t ABSTRACT t ID t to human requirements, and facilitate biological invasions mediated by man-made transportation at a global scale. On that conditions, biotic homogenization can occur. This phenomenon consists in the erosion of biological differences between biotas of contrasting ecosystems, due to extinction of local specialist species, and invasions of exotic generalists. However, scenarios where differences increase (biotic differentiation) can also occur. In this study, we assess the biotic homogenization hypothesis in resident bird communities of a tropical dry forest in central Mexico, a globally relevant ecosystem due to its biodiversity and endemisms, but also endangered due to agricultural activities. We conducted point-count surveys to assess biotic dissimilarity between resident bird communities in both tropical deciduous and oak forests in the upper Balsas River basin, considering three progressive levels of anthropic SHUWXUEDWLRQ2XUĆQGLQJVVKRZDVLJQLĆFDQWGHFUHPHQWRI taxonomic dissimilarity due to species turnover in function of anthropic perturbation. This results in homogenization of bird communities in human settlements at both vegetation types, thus breaking the natural pattern of distance-decay of VLPLODULW\2XUĆQGLQJVVKRZIRUWKHĆUVWWLPHWKDWDJULFXOWXUH and cattle raising promote taxonomic homogenization of bird communities in the Neotropical dry forests, indicating the need for developing production strategies with lesser impacts in natural vegetational cover, in order to reduce ELRGLYHUVLW\HURVLRQWKDWWKHPRGLĆFDWLRQVSURPRWH 378 Diferencias en ecología y biología reproductiva de especies Page 203, Posters ABSTRACT t Table of Contents GH(PEHUL]LGDHFRPRKHUUDPLHQWDSDUDUHVROYHUĆORJHQLD Gina J. Diaz-Rodrguez1*, Gustavo A. Londoo1 ǢW2-='89-&!&!$-32!£&'3£31#-! +/&-!A8|<2!£W'&<W$3 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Recientemente se han desarrollado estudios moleculares basados en ADN mitocondrial en los que se proponen nuevas ĆORJHQLDVSDUDODIDPLOLD(PEHUL]LGDHVLQHPEDUJRKDVLGRGLI¯FLO generar un árbol que concuerde con los datos morfológicos y moleculares, sin mencionar que dependiendo de la muestra y las técnicas usadas los árboles resultantes pueden variar. Por esta razón es necesario desarrollar nuevas metodologías TXHSHUPLWDQREWHQHUĆORJHQLDVP£VUREXVWDVDXQTXH hasta hoy los géneros tradicionales Buarremon, Arremon y Lysurus se mantienen como Arremon. Se recolectó y analizó la información anteriormente mencionada en la temporada más activa de reproducción, con los picos de pluviosidad en el PNN Tatamá-Risaralda, Colombia, para algunos representantes de los géneros Arremon y Atlapetes. Se instalaron sensores de temperatura en nidos, se realizaron mediciones morfológicas y descripciones de huevos y nidos, se monitoreó el desarrollo de polluelos. Se encontraron diferencias entre las especies correspondientes al tamaño de nidada, el tamaño de los huevos, el comportamiento de incubación, pero se resaltan grandes diferencias en la forma del nido, los materiales usados en su construcción y sus diferentes preferencias de ubicación espacial del mismo, que son poco usuales entre miembros de un mismo género. En este estudio se propone el uso de información sobre la ecología y biología reproductiva, como herramienta {փdփTT ID t ABSTRACT t DOWHUQDWLYDSDUDGLOXFLGDUUHODFLRQHVĆORJHQ«WLFDVGHQWUR del grupo. Estos resultados podrían sustentar propuestas de cambios dentro de la familia Emberizidae y soportar relaciones de parentesco para las especies estudiadas. ID t ABSTRACT t Table of Contents PD\RUFRPSHWHQFLDLQWUDRLQWHUHVSHF¯ĆFDFRPRFRQVHFXHQFLD de la reducción en la cantidad de hábitat adecuado disponible. 381 Respostas comportamentais do forrageamento de tiranídeos (Aves: Tyrannidae) a diferentes ambientes urbanos 380 Efectos de la pérdida de hábitat en la conducta territorial de rapaces nocturnas (Strigiformes) de la Reserva de la Biosfera Los Tuxtlas, Veracruz Liliane Martins-Oliveira1*, Renata Leal-Marques1, Carlos Henrique Nunes1, Oswaldo Maral Júnior1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! M.Isabel Herrera-Jurez1*, Patricia Escalante-Pliego1 r£-£-!2''$3<(<|+1!-£W$31 ǢW29ধ;<;3&'-3£3+!&'£!2-='89-&!&!$-32!£<;231!&'Ì?-$3lm POSTER SESSION: BEHAVIOUR r#-3£W-9!#'£,'88'8!|+1!-£W$31 A rápida urbanização traz uma crescente preocupação com a conservação biológica. Aves são excelente modelo para entender os efeitos da urbanização na vida silvestre, e tiranídeos é um dos grupos de aves da Região Neotropical PDLVGLYHUVLĆFDGRHPWHUPRVGHQ¼PHURVGHHVS«FLHV$ família Tyrannidae foi utilizada como modelo para avaliar se há variações nos comportamentos de forrageamento das aves em resposta às diferenças ambientais da área urbana de Uberlândia, MG. Foram considerados três tipos de hábitats: Ruas, Praças e Áreas Alteradas Próximas a Remanescentes de Vegetação nativa (APRs). Em cada ambiente foram HVWDEHOHFLGDVSDUFHODVGHPtFDGD$VREVHUYD©·HV foram realizadas de abril a dezembro de 2009. Foram realizadas 280h de observação e feitos registros do comportamento de forrageamento dos tiranídeos. As análises usadas foram ANOVA, Kruskal-Wallis e escalonamento multidimensional não métrico (NM-MDS), realizadas para 15 espécies de tiranídeos. No que se refere às respostas comportamentais dos tiranídeos aos diferentes ambientes, foram observadas diferenças para altura do substrato de procura, sendo menor POSTER SESSION: BEHAVIOUR Una gran diversidad de variables ecológicas actúan como determinantes del comportamiento territorial. Utilizando la proporción de cobertura vegetal remanente en el paisaje como un indicador de la calidad del hábitat, se evaluó el efecto de la pérdida de cobertura vegetal en la conducta territorial de especies de rapaces nocturnas (Strigiformes) en la Reserva de la Biosfera Los Tuxtlas. Se estimó la latencia a la primera respuesta y la duración del periodo de respuesta a intrusiones simuladas mediante el uso de vocalizaciones pregrabadas (playbacks) a lo largo de un gradiente de pérdida de cobertura vegetal. La duración del periodo de respuesta mostró una correlación positiva con el incremento en la proporción de cobertura vegetal (r = 0.86, P < 0.01), no así la latencia promedio de la primera respuesta (r = - 0.04, P = 0.87). Los resultados indican que las especies de rapaces nocturnas responden de forma similar a los intrusos independientemente de la calidad del hábitat. Por otro lado, en zonas con una mayor cobertura vegetal la defensa territorial es más intensa, esto puede indicar Page 204, Posters {փdփTT ID t ABSTRACT t nas APRs. Não foram observadas variações no comportamento no que se refere ao tempo médio de procura no poleiro, número de poleiros usados na procura e distância de ataque (com raras exceções). Quanto aos comportamentos de ataque YHULĆFRXVHTXHDJUXSDPHQWRVVHIRUPDUDPGHDFRUGRFRP a espécie independente do tipo de ambiente. A amplitude de comportamentos das espécies pode possibilitar responder DVYDULD©·HVDPELHQWDLVVHPQHFHVVLGDGHGHPRGLĆFD©¥R de alguns comportamentos, o que pode contribuir para a ocupação desses espaços. Agradecimento: Fapemig. 382 5HYLV¥RELEOLRJU£ĆFDGLHWDGRV7KDPQRSKLOLGDH ID t ABSTRACT t Table of Contents onívora. Foram encontradas 44 referências que mencionam os itens alimentares dentro da família em 55 espécies, sendo todas consideradas predominantemente insetívoras. Porém para a espécie Cercomacra ferdinandi, nenhum estudo foi encontrado. Ainda para Pygiptila stellaris e Cercomacra melanaria foi encontrado apenas uma referência cada. Isto evidencia a prioridade em estudos aprofundados a respeito GDGLHWDGHVWDVWU¬V¼OWLPDVHVS«FLHVPHQFLRQDGDV3RUĆP esta lista proporciona uma única base de consulta que será ¼WLOSDUDGHWHUPLQD©¥RU£SLGDHVHJXUDGDVLQWHUD©·HVWUµĆFDV em Thamnophilidae em trabalhos de ecologia, conservação e manejo dos ecossistemas do Cerrado brasileiro. ocorrentes no cerrado Rosiani Ramos Lopes Brinck1*, Wagner de Freitas Pereira1, Srgio Roberto Posso1 ǢW r839-!2-i£36'9|,3;1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS Thamnophilidae é uma família de aves passeriformes que compreende cerca de 220 espécies, destas 160 ocorrem no Brasil e 56 no Cerrado. Embora os Thamnophilidae sejam VHPSUHFODVVLĆFDGRVFRPRLQVHW¯YRURVQ¥RK£QHQKXP estudo que teste esta assertiva. Este trabalho tem por objetivo providenciar uma lista de consulta única para as preferências alimentares de Thamnophilidae do Cerrado SRUPHLRGHUHYLV¥RELEOLRJU£ĆFD$UHYLV¥RELEOLRJU£ĆFDIRL realizada com o auxílio do Google Acadêmico. Uma espécie foi considerada dentro de uma categoria alimentar desde que a literatura indicasse tal categoria em pelos menos 75% das citações, caso contrário a espécie foi considerada Page 205, Posters 383 Conociendo la biodiversidad de mi campus: Guía de Aves del Campus de la Universidad Nacional de Colombia, Bogotá Laura Echeverri1*, Adriana Rodriguez1, Alejandra Chadid1, Angela Mayorga1, Cristian Mur1, Elizabeth Abril6, German Gutierrez1, Jaime Manzano1 ǢW2-='89-&!&!$-32!£&'3£31#-! r+3<2i!='9|+33+£'+83<69W$31 POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES La Universidad Nacional de Colombia en Bogotá es un FDPSXVGHKHFW£UHDVFRQ£UHDVYHUGHV\HGLĆFDFLRQHV con cerca de 2000 profesores y 30000 estudiantes, es el campus universitario más grande del país. Desde el 2005, El Grupo de Ornitología de la Universidad Nacional (GOUN) ha realizado actividades de observación y capturas de aves para capacitar a sus integrantes en el estudio de las aves y enseñar su importancia para dinámicas académicas, ambientales y sociales. El GOUN en el 2014 hizo la actualización de la Guía {փdփTT ID t ABSTRACT t ID t de aves del campus, en este trabajo se registraron un total de 122 especies de aves, de las cuales 81 fueron seleccionadas para salir en la guía de acuerdo a criterios de abundancia y IUHFXHQFLDGHGHWHFFLµQ&DGDĆFKDLQFOX\HIDPLOLDHVSHFLH QRPEUHFLHQW¯ĆFR\FRP¼QIRWRGHVFULSFLµQGHLGHQWLĆFDFLµQ hábitos alimenticios, hábitat, estructura social y si es residente o migratoria. Fue fundamental la participación de todo el grupo, al repartir las especies para reunir la información y elegir las fotografías. Gracias al apoyo de la Universidad Nacional y el Programa de Gestión de Proyectos se imprimieron 1300 ejemplares que han sido ampliamente distribuidos y aceptados por la comunidad universitaria. De esta forma la nueva Guía ha permitido la capacitación de estudiantes, profesores y administrativos, realización de jornadas de observación de aves y actividades lúdicas, demostrando así como un trabajo de un grupo estudiantil, vinculado a un buen apoyo institucional puede crear una herramienta que ayuda a generar conciencia DPELHQWDO\VHQWLGRGHSHUWHQHQFLDPHGLDQWHODLGHQWLĆFDFLµQ conocimiento de los hábitos ecológicos y la comunidad de aves. 387 Expansión del área de cría de Hirundo rustica Page 206, Posters ABSTRACT t Table of Contents erythrogaster en Argentina (1980-2015) Facundo A. Gandoy1*, Juan I. Areta1, Martin Carrizo, Cristian H. Perez2, Pablo Petracci, David W. Winkler3, Kaspar Delhey4 ǢWTǣWTǤW382'££!#3(82-;,3£[email protected]'6;3($3£[email protected]!2& =3£<ধ[email protected]£[email protected]ǥW$,33£3(-3£3+-$!£$-'2$'9T32!9,2-='89-;@ r !$<2&3+!2&[email protected]|@!,33W$31W!8 POSTER SESSION: DIVERSITY & DISTRIBUTION La Golondrina Tijerita (Hirundo rustica erythrogaster) se reproduce en Norteamérica y migra hacia el sur durante el invierno boreal. Sin embargo, un pequeño grupo de individuos FRPHQ]µDQLGLĆFDUFHUFDGHHQ6XGDP«ULFDHQOD provincia de Buenos Aires, Argentina. Registros aislados demuestran la expansión de su zona de cría, sin embargo no existe ningún estudio riguroso que documente la dinámica de este proceso. Realizamos búsquedas de nidos en Buenos Aires y provincias adyacentes entre 1999 y 2015 y suplementamos nuestros registros con datos publicados. Contabilizamos 1240 REVHUYDFLRQHVHQSXHQWHV\DOFDQWDULOODVUHJLVWUDQGRSUHVHQFLD ausencia y cantidad de nidos. Separamos nuestros datos y los de la bibliografía en cuatro periodos: p1 (1980-1993), p2 (1999-2002), p3 (2009-2011) y p4 (2013-2015). Calculamos HO£UHDP£[LPDRFXSDGDDOĆQDOGHFDGDSHULRGR\HQEDVHD las diferencias de áreas entre periodos calculamos el aumento anual promedio. El área de cría aumentó progresivamente de NPtD³RHQWUHS\SDNPtD³RHQWUHS\S \DNPtD³RHQWUHS\S'HQWURGHO£UHDFHQWUDOGH cría (radio de 250km a partir del centro del área del periodo 1) aumentó el tamaño promedio de las colonias desde el año QLGRVFRORQLDDOQLGRVFRORQLD(QHO {փdփTT ID t ABSTRACT t mismo periodo la densidad de colonias también aumentó de 51% de ocupación a 75%, porcentaje que se mantiene estable en el área central de cría y que decrece progresivamente hacia la región periférica (~250Km). Concluimos que la población se encuentra en aumento progresivo en área y densidad de individuos y con una expansión centrífuga. 388 3UHIHU¬QFLDDOLPHQWDUGHDUDUDVD]XLVAnodorhynchus hyacinthinus) por sementes de acuri (Attalea phalerata) com ou sem exocarpo no Pantanal Iara Roberta Azevedo-Niero1*, Wesley R. Silva1 ǢW2-$!16 ID t ABSTRACT t Table of Contents (Z=2,75; P=0,006), possivelmente devido à redução do tempo gasto na manipulação da semente, conforme apontam estudos anteriores. Sementes com exocarpo demandam maior tempo, pois as araras-azuis necessitam removê-lo para ter acesso ao endosperma das sementes. Sementes sem exocarpo são abundantes no solo da área de estudo, sendo disponibilizadas às araras-azuis após o exocarpo ter sido consumido SULQFLSDOPHQWHSHORJDGR1RVVRHVWXGRFRQĆUPDDSUHIHU¬QFLD das araras-azuis por sementes limpas de acuri, reforçando a hipótese de que sua associação com o gado possivelmente se desenvolveu a partir da dependência desta ave com os grandes mamíferos da extinta megafauna sul-americana, o que permitiu otimizar seu forrageamento em frutos de acuri. r-!8!2-'83|+1!-£W$31 POSTER SESSION: BEHAVIOUR Para que animais maximizem seu aporte energético, diversos comportamentos contribuem para que o ganho seja maior do que os gastos despendidos no forrageamento. Esse princípio tem sido invocado para explicar a preferência da araraazul (Anodorhynchus hyacinthinus) da região Pantanal-SulMatogrossense pelo consumo de sementes limpas de palmeiras, sem a presença do exocarpo, evitando assim, os gastos em removê-lo. Testamos essa hipótese realizando experimentos com indivíduos de vida livre no Pantanal do Miranda. Oferecemos, simultaneamente, sementes de acuri (Attalea phalerata) com e sem exocarpo, em 12 sessões de experimento que duravam até 12h. Após as araras-azuis deixarem espontaneamente o local dos experimentos, as sementes FRPLGDVIRUDPFROHWDGDVHLQVSHFLRQDGDV&RQĆUPDPRVD preferência alimentar das araras-azuis por frutos sem exocarpo Page 207, Posters 394 Comportamento de defesa de Athene cunicularia (Aves: Strigiformes) em resposta a aproximação de predadores a sua toca Karla L. N. Fabiano1*, Jeane Silva Miranda1, Renata LealMarques1, Carlos Henrique Nunes1, Liliane Martins-Oliveira1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r£!8-99!#-3ǣǡǢǦ|+1!-£W$31 POSTER SESSION: BEHAVIOUR A resposta à aproximação de predadores aos ninhos pode ser decisiva para garantir a sobrevivência e sucesso reprodutivo de uma ave. Nossas hipóteses são que as características morfológicas de um predador (modelo) vão interferir no comportamento de defesa do ninho executada por Athene cunicularia variando entre macho e fêmea; e que em locais de maior perturbação antrópica as corujas serão menos agressivas à aproximação de potenciais predadores. O trabalho {փdփTT ID t ABSTRACT t foi realizado na zona urbana de Uberlândia-MG, Brasil. O H[SHULPHQWRIRLUHDOL]DGRHPQLQKRVWRFDVVLPXODQGRD DSUR[LPD©¥RGRVREMHWRVFDL[DGHSDSHO¥RFDFKRUURDUWLĆFLDO e ser humano, nessa ordem. Cada objeto foi aproximado dos ninhos três vezes, anotando-se a distância de voo e fuga, e o comportamento executado por cada ave. Foram realizadas medidas de perturbação e utilizados ANOVA dois fatores, correlação de Spearman e qui-quadrado para análises. Foi YHULĆFDGRTXHA. cunicularia não variou seu comportamento de defesa (distância de voo e fuga, comportamento executado) em resposta a aproximação de diferentes objetos e do ser humano. Não houve variação na defesa em função do gênero da ave. Não houve relação entre as variáveis de perturbação e de comportamento da coruja quando da aproximação do ser humano indicando uma possível habituação. Entretanto, observamos correlação positiva entre a distância de fuga de A. cunicularia nos testes com cachorro e caixa em relação a perturbação próxima ao ninho. A. cunicularia se manteve PDLVDOHUWDDTXDOTXHUREMHWRQ¥RLGHQWLĆFDGRTXDQWR maior a perturbação no local, realizando movimentos de intimidação e ataque ao predador. Agradecimento: Fapemig ID t ABSTRACT t Table of Contents considered globally as Vulnerable. In Brazil, it is rare DQGbVSDUVHO\GLVWULEXWHGPRVWO\LQKLJKODQGVRIWKHVRXWKHUQ DQGbVRXWKHDVWHUQUHJLRQV'HWDLOVRQWKHJHRJUDSKLF DOWLWXGLQDODQGbFXUUHQWVWDWXVLQ%UD]LODUHUHYLHZHGKHUH EDVHGRQRXURZQREVHUYDWLRQVDQGbRQSXEOLVKHGUHFRUGV DQGbGLJLWDOYRXFKHUV,QWKHVWDWHVRI6¥R3DXOR0LQDV *HUDLVDQGb5LRGH-DQHLURWKHVSHFLHVRFFXUVIURPURXJKO\ 500 up to 2000 m above sea level, while in southern states RI6DQWD&DWDULQDDQGb5LR*UDQGHGR6XOLWRFFXUVDOVRLQ elevations up to around 1000m. The occurrence of the species in high altitudes during the colder months indicates that the population is year-round resident. In Campos do Jordão, São Paulo state, the Black-capped Piprites is not uncommon, being present in 11 of 354 Mackinnon?s lists, with a Frequency in Lists Index of 3.11. In both regions the species is mainly associated to Araucaria forest. Furthermore, population estimatives throughout its range are needed to HYDOXDWHWKHVWDWXVRIWKHVSHFLHVDQGbSURSRVHFRQVHUYDWLRQ strategies in different regions of its distribution. 396 Natural history and distribution of the Black-capped Piprites pileata in Brazilian Atlantic Forest Karla V C Barbosa1*, Thiago V V Costa2, Lus F Silveira2 ǢW!#38!;8-3&'$3£3+-!'8-$!&!TǣW<9'<&' 33£3+-!&! r#!8#39!W0!8££!|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Piprites pileata is a poorly known passerine endemic to WKH$WODQWLF)RUHVWRI%UD]LODQGb$UJHQWLQD,WLVFXUUHQWO\ Page 208, Posters {փdփTT ID t ABSTRACT t 398 Inventário e catalogação das aves de Alagoas: lacunas do conhecimento e conservação L. C. S. Cavalcante1*, R. Gaban-Lima2,3 ǢW!#38!;8-3&'38(3£3+-!T-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9 lmT';38&'-3&-='89-&!&'T29ধ;<;3&'-Í2$-!9-3£+-$!9'&!!&'T 2-='89-&!&' '&'8!£&'£!+3!9T!$'-TT8!9-£WTǣW!#38!;8-3&'38(3£3+-!T -9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9lmTǤW2-='89-&!&' '&'8!£ &'£!+3!9<9'<&'-9;8-!!;<8!£&!2-='89-&!&' '&'8!£&'£!+3!9 r$!=!£$!2;'£!<8'2'|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS Alagoas abriga dois notáveis biomas brasileiros, a Caatinga e a Mata Atlântica, havendo uma nítida faixa de transição ecológica entre eles, conhecida como Agreste. Apesar dessa YDULHGDGHGHDPELHQWHVHGDVXDFRPSOH[LGDGHELRJHRJU£ĆFD ainda não está disponível uma compilação criteriosa das aves do estado. Esse estudo tem como objetivos realizar OHYDQWDPHQWRELEOLRJU£ĆFRGLJLWDOHHPFROH©·HVRUQLWROµJLFDV visando a confecção do “Catálogo das Aves de Alagoas” (em elaboração pelo LSEA), onde se mapeará a distribuição das diferentes espécies, gerando informações que norteiem políticas públicas de conservação, demais estudos ornitológicos HTXHLQGLTXHPDVUHJL·HVGHĆFLHQWHPHQWHLQYHVWLJDGDV3DUD cada registro compilado todas as informações disponíveis estão sendo reunidas (e, g,: procedência, tipo de registro, sinonímias, autoria, etc.). Até a conclusão desse resumo foram levantadas 82 localidades (bem delimitadas) com algum relato de Aves para Alagoas. Por meio desse levantamento ĆFDHYLGHQWHTXHDVLQYHVWLJD©·HVRUQLWROµJLFDVV¥REDVWDQWH mal distribuídas, e que as porções mais interioranas, e Page 209, Posters ID t ABSTRACT t Table of Contents DTXHODVPDLVFRVWHLUDVV¥RGHĆFLHQWHPHQWHDPRVWUDGDV Até o momento foi detectada a ocorrência de 515 táxons, HVSHF¯ĆFRVRXVXEHVSHF¯ĆFRVHGHVVHVV¥RRĆFLDOPHQWH considerados ameaçados de extinção (nas diferentes categorias), sendo três deles já extintos. Desses táxons até agora compilados, 54 são endêmicos da Mata Atlântica e 10 da Caatinga, evidenciando que as áreas de Caatinga são GHĆFLHQWHPHQWHLQYHQWDULDGDV$LQGD«HYLGHQWHRJUDQGH número de espécies politípicas, reforçando a necessidade de serem realizados mais estudos de taxonomia alfa. 399 Efecto del pastoreo en la formación de bandadas invernales de las aves granívoras del desierto del Monte central, Argentina Agustn Zarco1*, Victor Rodolfo Cueto2 ǢWl8<63&'2='9ধ+!$-Õ2'2$3£3+!&'31<2-&!&'9&''9-'8;3mf !&-A!Tf'2&3A!TǣW8<63&'2='9ধ+!$-Õ2'2$3£3+!&' 31<2-&!&'9&''9-'8;3l$3&'9mT'2;83&'2='9ধ+!$-Õ297<'£&' 32;!Ó[email protected];'6!!;!+2-$!9lmT329'/3!$-32!£&'2='9ধ+!$-32'9 -'2)[email protected]Ì[email protected]='89-&!&!$-32!£&'£!!;!+32 r!+<9ধ2A!8|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Se ha propuesto que la formación de bandadas mixtas durante la temporada no reproductiva (época invernal) es un FRPSRUWDPLHQWRTXHDXPHQWDODHĆFLHQFLDHQODE¼VTXHGDGH alimento. Este agrupamiento sería especialmente importante para las aves granívoras en ambientes desérticos, donde las semillas no se encuentran distribuidas homogéneamente y pueden llegar a ser escasas. Los cambios en la abundancia de las semillas podrían entonces afectar el comportamiento {փdփTT ID t ABSTRACT t ID t de agregación en bandadas. En los bosques de Prosopis ćH[XRVD del desierto del Monte central, el pastoreo reduce notoriamente la abundancia de semillas de gramíneas, principal alimento de las aves granívoras y concomitantemente las aves son menos abundantes en esos ambientes. Para analizar si el pastoreo afecta al agrupamiento de aves granívoras, comparamos por medio de conteos en transectas durante dos inviernos consecutivos la proporción de individuos que se encuentran en bandadas o solitarios en bosques de 3URVRSLVćH[XRVD con y sin pastoreo. Además, comparamos el número y el tamaño de las bandadas en ambas situaciones. Observamos que en bosques pastoreados, la proporción de LQGLYLGXRVTXHVHHQFXHQWUDQDJUXSDGRVHVVLJQLĆFDWLYDPHQWH menor que en las zonas no pastoreadas (test dif. de prop p<0.01 para todas las especies). Pero, aunque las bandadas fueron más pequeñas, el número de bandadas per capita fue mayor en los bosques pastoreados. Concluimos que la reducción en el número de semillas de gramíneas incrementa la formación de bandadas, pero debido a la baja densidad de las aves en los bosques pastoreados, el tamaño de las bandadas es menor que en los bosques sin pastoreo. 400 Preliminary avifauna census of the Parque Natural Page 210, Posters ABSTRACT t Table of Contents Municipal do Curió de Paracambi (RJ, Brazil) as support for evaluation of environmental quality Ramiro Drio Melinski1*, Ana Carolina Maciel2, Renan Dias2, Mariana Vabo2, Ildemar Ferreira2, Fálvia Rocha2 ǢWTǣW r8!1-831'£-290-|,3;1!-£WW$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION The Parque Natural Municipal do Curió de Parcambi (PNMCP) has great ecological importance in protecting a remnant of Atlantic Forest in one of the priority conservation areas of this ecosystem, the Tinguá-Bocaina Biodiversity Corridor. It is possible to evaluate forest landscapes conservation status by describing their animal community, as some species are sensitive to changes in forest structure, factors such as vegetation composition and size of forest fragments can determine the presence or absence of such species. A census of the avifauna is necessary for biodiversity conservation planning actions because birds are one of the most distinct and well-described zoological groups, and can be used as bio-indicators of environmental change. The main methodology used for data collection was Fixed Sampling Point, applied monthly in three transects. So far, 90 species have been recorded, from 37 families, of which Tyrannidae (n=8; 8.89%) is the most representative. Three species in “Near Threatened” status (Primolius maracana, Dysithamnus stictothorax and Ramphodon naevius) were recorded; and one species of “Vulnerable” status (Procnias nudicollis). There are also 17 species endemic to the Atlantic Forest, with restricted GLVWULEXWLRQRUWKUHDWHQHGE\KXQWLQJRUWUDIĆF$OWKRXJKWKHVH {փdփTT ID t ABSTRACT t data are preliminary and might not represent all the species in PNMCP, the presence of Threatened and Near-Threatened and endemic species, along with the perspective of records of new species can provide support for greater efforts to protect this area, historically hit by deforestation and poaching. 401 Systematic sampling in the Pampas biome shows geographic expansion of forest birds in areas with grassland matrix in southern Brazil Christian Borges Andretti1*, Eduardo Chiarani1, Carla Suertegaray Fontana1 ǢW!#38!;8-3&'82-;3£3+-!W<9'<&'-Í2$-!9''$23£3+-!&! 32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£T r!2&8'ষW;$,'|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS Grasslands of southeastern South America are one of the most extensive open ecosystems in the Neotropical region. Extensive riparian forests occur in association to the grassland matrix, extending the occurrence of many forest species. From September 2014 to January 2015 we surveyed birds in 13 sites spread across the Brazilian southern grasslands, through expeditions lasting 4-6 days at each site. We recorded both grassland and forest species, that occur in forest formations associated to these open areas (e. g. riparian forests, forest patches, etc.). We recorded 12 species of forest birds in areas of the Pampas biome (Crypturellus obsoletus, Glaucidium brasilianum, Stephanoxis lalandi, Conopophaga lineata, Chamaeza campanisona, Leptopogon amaurocephalus, Tolmomyias sulphurescens, Euscarthmus Page 211, Posters ID t ABSTRACT t Table of Contents meloryphus, Cnemotriccus fuscatus bimaculatus, Megarynchus pitangua, Dendrocolaptes platyrostris, Tersina viridis), increasing their geographic distributions. Most species were recorded in forested areas along streams in predominantly open habitats. These species are characteristic of Atlantic Forest and their expansion occur through forest corridors, mainly riparian forests. The lack of a larger sample in forest formations inserted in the Pampas biome is certainly one of the main UHDVRQVIRUWKLVIRUWKLVQHZUHFRUGVKLJKOLJKWLQJWKHGHĆFLHQW sampling effort on these habitats in the most southern portion of the species distribution. Therefore, we emphasize the importance of these corridors for the occurrence and dispersion of forest bird species in areas of grassland matrix. 402 Distintos refúgios climaticamente estáveis do 4XDWHUQ£ULRQ¥RLQćXHQFLDPDYDULD©¥RPROHFXODUH acústica de0\LRWKO\SLVćDYHROD(Aves: Parulidae) Caio Brito1*, Erich Mariano2, Helder Araujo2 ǢW2-='89-&!&' '&'8!£&!!8!Ð#!TǣW2-='89-&!&' '&'8!£&'!16-2!8!2&' r$!-3#1#8-;3|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION A distribuição de 0\LRWKO\SLVćDYHROD, bem como vários habitats em que ocorre, é similar à distribuição de áreas estáveis de )ORUHVWDV(VWDFLRQDLV'HFLGXDLV)('VDRORQJRGDVćXWXD©·HV climáticas do Quaternário Superior. Embora a distribuição de 0ćDYHROD pareça estar relacionada com a distribuição GHćRUHVWDVVHFDVQRQRUGHVWHEUDVLOHLURDHVS«FLHWDPE«P RFRUUHHP£UHDVćRUHVWDLVQD)ORUHVWD$WO¤QWLFD)$$VVLP como áreas de FEDs demonstraram-se estáveis durante ćXWXD©·HVFOLP£WLFDVQRV¼OWLPRVDQRVDGLVWULEXL©¥R {փdփTT ID t ABSTRACT t da FA na região nordeste no Brasil também demonstrou forte HVWDELOLGDGHGXUDQWHDVPHVPDVćXWXD©·HVFOLP£WLFDV2 objetivo foi testar as hipóteses de estruturação genética e vocal de populações de 0ćDYHROD, entre habitats de FEDs e FA no nordeste brasileiro utilizando um marcador molecular (cytb) e o canto espontâneo da espécie. Foram utilizadas as metodologias cabíveis para coleta de amostras, extração de DNA e posterior DPSOLĆFD©¥RHVHTXHQFLDPHQWR$VJUDYD©·HVIRUDPREWLGDV pessoalmente ou em museus e bancos de dados públicos. Os resultados obtidos sugerem que 0ćDYHROD é uma espécie UHODFLRQDGDDDPELHQWHVćRUHVWDLVDVVRFLDGRVDê'LDJRQDOGH formações abertas” da América do Sul e que possui uma baixa taxa de variabilidade genética, como táxons de ambientes DEHUWRVHGLIHUHQWHVGHW£[RQVGHćRUHVWD¼PLGD$VYDULD©·HV moleculares e acústicas não apresentaram estruturação nas populações amostradas no nordeste brasileiro, ou seja, partindo do pressuposto que a espécie é associada às FEDs e que a colonização das populações na FA do nordeste remonta uma história mais recente, não seria esperado estruturação genética. 403 Male only parental care compensates loss of the female in the biparental Rufous Hornero (Furnarius rufus) Talita V. Braga1*, James J. Roper2 ǢW2-='89-&!&' '&'8!£&3!8!2ÆTǣW2-='89-&!&'-£!'£,!T ID t ABSTRACT t Table of Contents When one sex reduces parental effort, the other may maintain, increase, also reduce its parental effort, or may even abandon WKHQHVW7KLVVH[XDOFRQćLFWFDQEHEHWWHUXQGHUVWRRGZKHQ one member of a pair can be removed or is handicapped in some way that reduces its effort. Most of experimental studies assessed female response to reduced effort by males and found that they compensated for the loss by increasing care. However, the effort by the female tends to be less than that of the total care when males also contribute, and this UHGXFHGFDUHVKRXOGUHVXOWLQUHGXFHGĆWQHVV,QDQDWXUDO experiment in southern Brazil of a male Rufous Hornero (Furnarius rufus) whose mate disappeared during the nestling stage, we examined whether a single male compensates for the loss of the female, and if so, to what degree. Parental care was observed in 13 nests (12 pairs and the single male) during a total of 39 hours. This single male fed nestlings much more often than paired males and at a similar rate to that of pairs. He also removed feces more often than other males or pairs. We show that males can completely compensate the loss of the female while caring for growing nestlings. Thus, both males, and females, in pairs of Rufous Horneros, perform at a slower rate than their ability should allow, thereby supporting the LGHDRIVH[XDOFRQćLFWLQELSDUHQWDOFDUHVSHFLHV)XWXUHVWXGLHV PD\H[DPLQHKRZWKLVLQFUHDVHLQSDUHQWDOFDUHLQćXHQFHV survival of the individual adult as well as of the young. r;!£-;!=#8|+1!-£W$31 POSTER SESSION: BEHAVIOUR 3DUHQWDOFDUHLQELSDUHQWDOVSHFLHVFDQJHQHUDWHFRQćLFW between the sexes, in which one sex may attempt to reduce its effort, thereby coercing the other sex to increase effort. Page 212, Posters {փdփTT ID t ABSTRACT t 406 Paleodistribuição potencial e variação acústica não suportam o status de subespécie em 0\LRWKO\SLVćDYHROD (Aves, Parulidae) Caio Brito POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION 'XUDQWHSHU¯RGRVJHROµJLFRVSUHW«ULWRVDVćRUHVWDV¼PLGDV HćRUHVWDVVHFDVSDVVDUDPSRUH[SDQV·HVHUHWUD©·HVGHYLGR ao aquecimento e resfriamento do planeta. Alguns autores propuseram que as áreas atualmente disjuntas das FEDs poderiam ter se conectado durante o Quaternário, como por exemplo, na hipótese do arco pleistocênico. Outros autores sugerem que houve um longo período sem conexões HQWUHDVćRUHVWDVVHFDVDRVXOHDRQRUWHGD$PD]¶QLD desde, pelo menos, o Quaternário Superior. Desse modo, alterações climáticas do Quaternário Superior poderiam ter possibilitado conexão das populações atualmente disjuntas GH0\LRWKO\SLVćDYHROD0IćDYHRODH0ISDOOLGLURVWULV), assim FRPRDOJXPDVSURSRVWDVGDV)('V2REMHWLYRIRLYHULĆFDU DLQćXHQFLDGHIDWRUHVSDOHRFOLP£WLFRVQDGLVWULEXL©¥RGH 0ćDYHRODHDVVRFLDUHVVHVUHVXOWDGRV¢YDULD©¥RYRFDO entre as populações das duas subespécies reconhecidas, utilizando o canto espontâneo da espécie. Através de nossas modelagens de nicho ecológico (ENM) obtivemos quatro modelos referentes aos quatro períodos que abordamos neste estudo (Presente, Holoceno, LGM e LIG). Não encontramos HVWUXWXUD©¥RJHRJU£ĆFDHQWUHPHGLGDVGDVJUDYD©·HVGHM. f. pallidirostris (populações ao norte da Amazônia) e 0IćDYHROD (populações ao sul e sudeste da Amazônia). As populações de 0IćDYHROD e M. f. pallidirostris não apresentaram GLIHUHQ©DVVLJQLĆFDWLYDVHPVHXVFDQWRVHVSRQW¤QHRVDO«P Page 213, Posters ID t ABSTRACT t Table of Contents das ENMs terem mostrado uma conexão recente (LGM e LIG) entre as duas populações, hoje isoladas. Mais pesquisas, com amostragens genéticas, observação de campo e mais gravações, são necessárias para complementar nossos dados. 407 Analysis of biometric data and chest circumference of Amazona vinaceae Vanessa Tavares Kanaan1*, Rafael Meurer23DWULFLD3HUHLUD6HUDĆQL3 ǢW29ধ;<;396!3-£='9;8'TǣW2-='89-&!&' '&'8!£&'!2;!!;!8-2!T ǤW'2;83!$-32!£&''97<-9!'329'8=!3&'='9-£='9;8'9 r=!2'99!0!2!!2|+1!-£W$31 POSTER SESSION: MORPHOLOGY A common pattern among closely related animal taxa is that species vary little in terms of overall size. This implies that the evolutionary process creating this pattern involves an element of internal constraints. In order to maintain a record of natural variations between individuals, we analyzed the biometrics of 96 Amazona vinacea: 90 birds were illegal wildlife trade victims and six were offspring of apprehended birds born at the Curitiba Zoo. All subjects were release candidates of the “Reintroduction of the A. vinacea at the Araucárias National Park, Santa Catarina, Brazil” project. In this study we tested the hypothesis that morphometrics would be similar within the group. Using a caliper and scales, the following parameters were measured and the average was calculated: the total length (351,87mm, n=31), tarsus diameter (7,94mm, n=74), beak length or culmen (26,68mm, n =71), beak width (18,62mm, n= 79), tarsal length (23,55mm, n= 64), wing length (217,81mm, n= 81), tail length (11,87, n= 96), total length of the head (61,41, n=51), body weight (373, 71g, n=91). The {փdփTT ID t ABSTRACT t chest circumference (27,3cm, n=42) was calculated with a tape measure. Statistical analysis using a t-test showed no VLJQLĆFDQWGLIIHUHQFHVEHWZHHQWKHVHWRILQGLYLGXDOVIURPWKH apprehension and the zoo (P >0.05 for all parameters) showing homogeneity of the group of individuals sampled. The study of biometrics provides important information of basic biology and natural variation between individuals of Amazona vinacea. 409 Avifauna do Campus A.C. Simões - UFAL: composição, HVWUXWXUDWUµĆFDHTXDOLGDGHDPELHQWDO T. K. Guedes1*, C.F.M. Ferreira1, W.O. Silva1, R. Gaban-Lima1 ǢW!#38!;8-3&'38(3£3+-!T-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9lmT ';38&'-3&-='89-&!&'T29ধ;<;3&'-Í2$-!9-3£+-$!9'&!!&'T2-='89-&!&' '&'8!£&'£!+3!9<9'<&'-9;8-!!;<8!£&!2-='89-&!&' '&'8!£&'£!+3!9 r;!-2!0!83£-2'+<'&'9|@!,33W$31W#8 POSTER SESSION: COMMUNITY ECOLOGY As alterações na avifauna geradas pela expansão urbana são mal compreendidas em virtude das diferenças nos contextos regionais e dos tipos de ordenamento urbano, de gerenciamento e de manejo da paisagem. No município de Maceió, o Campus A. C Simões possui um mosaico de ambientes urbanizados, cuja comunidade de aves ainda é pouco investigada. Este estudo tem como objetivos (1) realizar inventários qualitativo e quantitativo (Pontos de contagem GHCGDVDYHVQR&DPSXVDYDOLDUDHVWUXWXUDWUµĆFD dessa comunidade e (3) investigar parâmetros relacionados à qualidade ambiental que possam funcionar para análises de bioindicação; visando contribuir para aumentar o conhecimento acerca da comunidade de Aves urbanas do Nordeste do Brasil, HJHUDULQIRUPD©·HVTXHSRVVDPDX[LOLDUDGHĆQL©¥RGHPHGLGDV Page 214, Posters ID t ABSTRACT t Table of Contents para o ordenamento, gerenciamento e manejo do campus e do entorno. As amostragens foram realizadas de setembro de 2014 até abril de 2015 (11 pontos e 20 horas de observação por mês). No total foram registradas 61 espécies, sendo a maioria (90%) pouco sensível às perturbações ambientais. A guilda com maior riqueza foi a dos onívoros (21), seguida dos insetívoros (14) e dos granívoros (9), entretanto, a guilda mais abundante foi a dos detritívoros (39,1% da comunidade), seguido pelos onívoros (35,3%) e pelos insetívoros (16,2%). A elevada abundância de detritívoros (representados apenas por 3 HVS«FLHVGH&DWKDUWLGDHHYLGHQFLDDJUDYHGHĆFL¬QFLDVDQLW£ULD local. A ausência de aves altamente sensíveis, acompanhadas da elevada proporção de espécies pouco sensíveis, evidenciam claramente a degradação ambiental do campus e entorno. 411 Historical biogeography of Campylopterus largipennis complex (Trochilidae) in Amazonian, seasonally dry tropical Forests and campos rupestres Anderson Chaves POSTER SESSION: SYSTEMATICS & TAXONOMY The hummingbird Campylopterus largipennis is the most widespread species in its genus, ranging from ORZODQGb$PD]RQLDQUDLQIRUHVWVWRKLJKDOWLWXGHURFN\ grasslands in southeastern Brazilian mountaintops. The current taxonomic treatment deemed C. largipennis as a SRO\WLSLFVSHFLHVUHSUHVHQWHGE\IRXUVXEVSHFLHVLQbDbFRPSOH[ (largipennis, obscurus, aequatorialisDQGbdiamantinensis). In this present study we evaluated the taxonomic status of the subspecies described by Bayesian phylogenetic reconstructions {փdփTT ID t ABSTRACT t ZLWKPLWRFKRQGULDODQGbQXFOHDUPROHFXODUPDUNHUV6HTXHQFHV were obtained from 1035bp for ND2 gene, 1023bp for BF7 DQGbESIRU*3'+DWRWDORILQGLYLGXDOVDQDO\]HGIURP ORFDWLRQV%D\HVLDQLQIHUHQFHQHWZRUNVDQGbWUHHVLQGLFDWH an ancient separation of the corresponding clades Amazonian VXEVSHFLHVRIFODGHVRIFHQWUDODQGbHDVWHUQ%UD]LO&RQVLGHULQJ the current nomenclature for the Amazonian subspecies of C. largipennis there was the formation of monophyletic groups to C. l. obscurusDQGbC l. aequatorialisDQGbWKHVHVXEVSHFLHV DUHGLYLGHGLQWRĆYHFODGHV2QO\C. l. largipennis formed a monophyletic clade. In addition, we observed clades corresponding to the areas of bird endemism in the Amazon, ZKLFKDUHODUJHO\GHĆQHGE\ZDWHUVKHGV+RZHYHUWKHGDWD LQGLFDWHSUREDEOHJHQHćRZEHWZHHQWKHKHDGZDWHUVRIPDMRU southern tributaries of the Amazon River. Our results agree ZLWKUHFHQWPRUSKRORJLFDODQDO\VHVRIWKLVFRPSOH[DQGbDUH also consistent with the separation of Campylopterus sp. nov. from the dry forest, as an independent taxonomic unit of C. l. diamantinensis, so that both could be elevated to species status. 413 Primeiros registros de reprodução de Tyrannus savana (Aves, Tyrannidae) na Amazônia Brasileira: Amazônia Ocidental como nova fronteira reprodutiva? Glauko Correa da Silva ID t ABSTRACT t Table of Contents savana (raça meridional), que realiza migração até Equador, Colômbia, Guiana, Curaçao, Trinidad e Texas. Ocorre na Amazônia entre fevereiro a julho, sendo sua área de invernada os campos e adjacências dessa região. Para o Planalto Central do Brasil migra de julho a agosto, se reproduzindo de setembro a dezembro. A partir de setembro, passa o seu segundo pico migratório, provavelmente de aves que se reproduzem no Sul do Brasil, Argentina e Uruguai. Após a reprodução no Planalto Central, se deslocam para o Norte de janeiro a fevereiro. Durante buscas de ninhos ativos de aves, nas áreas GHLQćX¬QFLDGLUHWDGRUHVHUYDWµULRGD$+(-LUDX5RQG¶QLD foram registrados ninhos ativos de T. savana (N=7), na localidade dos Igarapés: Jirau, Raul e Mutum, tributários do Rio Madeira, entre os meses de outubro a dezembro de 2014. Em MDQHLURGHHMDQHLURIHYHUHLURGHIRUDPUHJLVWUDGRV jovens e adultos nas localidades supracitadas, diferentemente do esperado em literatura no qual os indivíduos retornam e se reproduzem no Planalto Central. As aves da população do Sul do Brasil se reproduzem um pouco mais tarde que as do 3ODQDOWR&HQWUDOVHQGRHQFRQWUDGRVĆOKRWHVQRVQLQKRVHP janeiro, deixam o Rio Grande do Sul em fevereiro e março, voltando a este Estado em setembro. Portanto comportamento semelhante pode estar acontecendo concomitantemente HP5RQG¶QLD(VWH«RSULPHLURUHODWRQDOLWHUDWXUDFLHQW¯ĆFD de registro reprodutivo na Amazônia de T. savana. 3+39WW +£!<0388'!|@!,33W$31W#8 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION A espécie migratória Tyrannus savana de ampla distribuição no Brasil, apresenta-se em sub-espécies, com destaque T. savana Page 215, Posters {փdփTT ID t ABSTRACT t 414 Fungal characterization in occupied nests by free-living Amazona brasiliensis Rafael Meurer1*, Cristiane Kiyomi Miyaji Kolesnikovas2, Elenise Angelotti Bastos Sipinski3, Frederico Fontanelli Vaz43DWULFLD3HUHLUD6HUDĆQL5 ǢW2-='89-&!&' '&'8!£&'!2;!!;!8-2!TǣW993$-!3Ǥ2-1!£TǤW3$-'&!&' &''97<-9!'1-&!'£=!+'1'&<$!31#-'2;!£TǥW2-='89-&!&' '&'8!£ &3!8!2ÆTǦW'2;83!$-32!£&''97<-9!'329'8=!3&'='9-£='9;8'9 r8(!W1'<8'8i|,3;1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Amazona brasiliensis is a Psittacidae rated in the Brazilian list as near threatened with extinction, but highly dependent on management. It is endemic to the Atlantic Forest and has a restricted range on the south coast of Brazil. Currently, the total population is estimated at 6.650 individuals, 5.000 only for the state of Paraná. Among the actions outlined in the National Action Plan for the Conservation of Parrots of the Atlantic Forest, published in 2011, is the characterization of WKHKHDOWKSURĆOHRISRSXODWLRQVRIA. brasiliensis, A. pretrei, A. rhodocorytha and A. vinaceae in the wild. The objective of this study was to identify fungi present in the substrate of the DUWLĆFLDOZRRGRU39&QHVWVRFFXSLHGE\A. brasiliensis sampled and determine the natural patterns of fungi occurring during the reproductive period. The collections of the samples took place between December 2014 and January 2015, at Rasa Island (PR), using sterile plastic swabs and transport media. The nests surveyed (n=21) contained nestlings with age between 30 and 55 days. The microbiological and morphological analysis was performed following standard methodology (WINN et DOFRORQLHVZHUHLVRODWHGIURPĆODPHQWRXVIXQJL being 70.9% (n = 17) Aspergillus sp., 12.6% (n = 3) Trycophyton Page 216, Posters ID t ABSTRACT t Table of Contents sp., 4.1% (n = 1) Microsporum gypseum, 4.1 % (n = 1) Fusarium sp., 4.1% (n = 1) Mucor sp., 4.1% (n = 1) Syncephalastrum sp. The results constitute unprecedented characterization of fungal microbiota of the nests of this species and are important for monitoring the health of the population and an essential tool to management and conservation efforts. 415 Padrões de distribuição, riqueza e conservação de psitacídeos (Aves:Psittacidae) da Caatinga Marcos Silva1*, Flvia Pinto2, Luciano Naka1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3TǣW r1!8$39=-2-$-39i/(|@!,33W$31W#8 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION A compreensão dos padrões macro-ecológicos de distribuição de espécies é um tema de grande relevância para a biologia, principalmente quando se trata da conservação de espécies ameaçadas de extinção. A Caatinga possui 14 espécies de psitacídeos ocorrendo na região, com 5 espécies enquadradas em alguma categoria de ameaça. Nós obtivemos pontos georreferenciados de ocorrência e criamos a representação GDGLVWULEXL©¥RJHRJU£ĆFDGDVHVS«FLHVGHSVLWDF¯GHRV através de polígonos de distribuição gerados por especialistas, mínimos polígonos convexos e modelagens de nicho ecológico, resultando em mapas de distribuição que foram comparados entre si, indicando qual método mais se aproxima da distribuição baseado nas localidades de ocorrência. Criamos mapas de riqueza de espécies e relacionamos estes mapas, indicando qual melhor representa a riqueza de psitacídeos na Caatinga. Ainda sobrepomos o mapa de unidades de {փdփTT ID t ABSTRACT t conservação da Caatinga sobre o mapa de riqueza, para avaliar o quanto das áreas mais ricas está protegido. Os mapas de GLVWULEXL©¥RJHRJU£ĆFDGLIHULUDPVLJQLĆFDWLYDPHQWHTXDQWR ao método utilizado, onde sugerimos cautela ao lidar com cada um desses métodos. Devido a não uniformidade dos mapas, a comparação entre métodos determina a melhor escolha do mapa de distribuição. Os mapas produzidos por polígonos de especialistas, por exemplo, podem incluir áreas onde não há registros documentados e excluir áreas com registros recentes para as espécies. O sul do Piauí, sudoeste da Bahia, e litoral do Ceará são as áreas mais ricas em espécies de psitacídeos na Caatinga, as quais estão pouco representadas nas unidades de conservação da região. 416 Sucesso reprodutivo de Formicivora acutirostris em estuário sujeito à variação diária das marés Bianca Luiza Reinert1*, Claudia Golec, Marco Aurlio Pizo2, Marcos Ricardo Bornschein3 ǢW!;'8!;<8!29ধ;<;3&'9;<&391#-'2;!-9TǣW2-='89-&!&' 9;!&<!£!<£-9;!fTǤW83+8!1!&'Õ9f8!&<!%È3'1 $3£3+-!T329'8=!3'!2'/3&!-&!-£='9;8'T29ধ;<;3&' -Í2$-!9-3£+-$!9T2-='89-&!&' '&'8!£&'-2!9'8!-9 r#-!2$!8'-2'8;|@!,33W$31W#8 ID t ABSTRACT t Table of Contents compartilham as atividades de reprodução. Estudamos a sua reprodução de 2006 a 2015 na baía de Guaratuba, Paraná, com busca por ninhos nos territórios e monitoramento de QLQKRVHĆOKRWHVIRUDGRVQLQKRV(QFRQWUDPRVQLQKRV dos quais 382 chegaram a ter ovos e, dentre eles, 119 tiveram sucesso (31%). As causas de insucesso mais recorrentes foram predação (38%), alagamento por maré (27%) e queda do ninho (11%). Causas de insucesso relacionadas com água, vento e calor superaram predação, com 43%. Alagamento e predação não são constantes ao longo da estação reprodutiva, tendo picos em momentos opostos: alagamento percentualmente maior em setembro e outubro e predação em novembro e dezembro. O alagamento de ninhos é maior quando são PDLVDOWDVDVPDU«V$PDLRULDGRVĆOKRWHVTXHVDLXGRQLQKR VREUHYLYHXDW«VHWRUQDULQGHSHQGHQWHGHĆOKRWHV Dos que saíram e morreram, pelo menos 28% morreram no dia da saída do ninho, alguns afogados. Grande parte dos ĆOKRWHVTXHFKHJDUDP¢LQGHSHQG¬QFLDVDLXGRQLQKRHP outubro (47%). O sucesso reprodutivo da espécie é afetado SRUDVSHFWRVVXMHLWRV¢PXGDQ©DFOLP£WLFD&RQĆUPDQGRVH as previsões de aumento do nível do mar e da incidência de eventos climáticos extremos, como vendavais, a espécie poderá sofrer desequilíbrios populacionais, além de redução de hábitat. POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Aves estuarinas são vulneráveis à mudança climática, podendo sofrer perda de habitat e redução do sucesso reprodutivo pelo aumento do nível do mar, entre outras causas. Formicivora acutirostris é uma espécie ameaçada que ocorre em menos de 6 mil hectares distribuídos em parte do litoral sul do Brasil, principalmente em estuários. Ela vive em casais que Page 217, Posters {փdփTT ID t ABSTRACT t 417 Systematics of the ‘chordeiline’ nighthawks (Caprimulgidae) and revalidation of Nannochordeiles Hartert, 1896 ID t ABSTRACT t Table of Contents 418 On the holotype and type locality of the mysterious Cayenne Nightjar Setopagis maculosa (Caprimulgidae) Thiago V V Costa1*, Bret M Whitney2, Lus F Silveira1 Thiago V V Costa1*, Johan Ingels2, Vagner Cavarzere1, Lus F Silveira1 ǢW<9'<&' 33£3+-!&!TǣW -'£&<-&'92$W !2&<9'<13(!;<8!£$-'2$' ǢW<9'<&' 33£3+-!&!TǣW!£+'2#'8+£!!2ǨTfǨǡǧǡ'9;'£#'8+'2T'£+-<1 r;==$39;!|+1!-£W$31 POSTER SESSION: MORPHOLOGY POSTER SESSION: MORPHOLOGY The Cayenne Nightjar (Setopagis maculosa) was described based on a single male specimen collected by Samuel Klages in French Guiana, northeastern South America. Since then, no new specimens or reliable records have been made and the validity of the species has been questioned. A detailed analysis of the holotype reveals that it has unique and distinctive morphological traits that support the validity and taxonomic status of the species, being provisionally placed in Setopagis until additional data are available. Some features of its plumage ZKLFKDUHLPSRUWDQWIRUĆHOGLGHQWLĆFDWLRQKDYHEHHQODUJHO\ overlooked. These especially include the overall brownish XSSHUSDUWVWKHJUD\FURZQĆQHO\VWUHDNHGLQEODFNDQGWKH rufous sides of the head. New information on the type locality at the time of collection of the holotype contained in Klages’s diaries also sheds some light on the habitat where this species ZDVFROOHFWHGZKLFKPD\KDYHEHHQWHUUDĆUPHIRUHVW The subfamily Chordeilinae had long been considered a well-characterized group and including the genera Podager, Lurocalis, Nyctiprogne and Chordeiles. However, recent molecular studies revealed that Chordelinae is not monophyletic, as Lurocalis and Nyctiprogne are more close related to other groups than to Chordeiles and Podager. Those studies showed also that Chordeiles is not monophyletic, as C. pusillus and P. nacunda are sister taxa. For this reason, P. nacunda was included in Chordeiles, or alternatively C. pusillus was included within Podager. Here we present a systematic review of the group based on external, morphological characters and a phylogenetic analysis of the group based on 40 osteological characters. The analysis showed a strong support for the group composed by Chordeiles spp (including C. nacunda), with absence of Lurocalis and Nyctiprogne. Also, the results showed Chordeiles nacunda and C. pusillus in the base of the clade, as successive sister taxa of the remaining Chordeiles, partially in agreement to the previous studies. This pattern of relationship, and the morphological variation observed between C. nacunda and C. pusillus compared to the remaining species, indicates the need of reinclusion of C. nacunda in the genus Podager and revalidation of Nannochordeiles for C. pusillus. Page 218, Posters r;==$39;!|+1!-£W$31 {փdփTT ID t ABSTRACT t 419 (IIHFWVRIPL[HGVSHFLHVćRFNLQJDQGIRUHVWIUDJPHQWDWLRQLQ IHHGLQJHIĆFLHQF\RIELUGVLQWKH<XQJDVIRRWKLOO$UJHQWLQD Giselle Mangini1*, Facundo Ariel Gandoy1, Juan Ignacio Areta1 ǢW#-+'3 r9£-60230-;!|+1!-£W$31 POSTER SESSION: BEHAVIOUR 3DUWLFLSDWLRQLQPL[HGVSHFLHVćRFNVPD\KHOSLQFUHDVHIHHGLQJ HIĆFLHQF\QXPEHURIDWWDFNVWLPHRIELUGVE\ĆQGLQJPRUH SODFHVWRIHHGNQRZLQJUHFHQWO\GHSOHWHGDUHDVEHQHĆWLQJIURP ćXVKLQJLQVHFWVDQGLQFUHDVLQJSUHGDWLRQDYRLGDQFH%LUGVLQ yungas foothill live in a fragmented landscape. Forest fragments could contain limited food in comparison to continuous forest. :HFRPSDUHGIHHGLQJHIĆFLHQF\DQGVHDUFKUDWHQXPEHU RIVHDUFKEHKDYLRUVWLPHRIWKUHHVSHFLHVLQIRRWKLOOIRUHVW Salta, Argentina: Parula pitiayumi, Thraupis sayaca and Arremon ćDYLURVWULV. Five surveys were conducted through 7 months recording foraging behavior. Ratios of search and attack trough WLPHZHUHFRPSDUHGLQWZRVRFLDOVLWXDWLRQVLQVLGHRXWVLGH PL[HGVSHFLHVćRFNVDQGDWWZRODQGVFDSHFRQĆJXUDWLRQV IRUHVWIUDJPHQWFRQWLQXRXVIRUHVWParula pitiayumi and Thraupis sayacaLQFUHDVHGWKHLUIHHGLQJHIĆFLHQF\ZKHQ SDUWLFLSDWLQJLQPL[HGćRFNVLQVLGHIRUHVWIUDJPHQWV.UXVNDO Wallis; P-values<.05, n=71 and n=28 respectively), while $UUHPRQćDYLURVWULV did not show differences (P=0.32, n=41). Thraupis sayaca increased its search rate (p=0.0484) outside ćRFNVLQFRQWLQXRXVIRUHVWZKLOHQRGLIIHUHQFHVZHUHGHWHFWHG in P. pitiayumi and $ćDYLURVWULV. These results suggest that ćRFNLQJPLJKWUHSRUWPRUHEHQHĆWVLQIRUHVWIUDJPHQWVWKDQLQ continuous forests in our study sites. Surveys measuring food Page 219, Posters ID t ABSTRACT t Table of Contents availability and predator abundance are being conducted and should provide critical data to explain the observed patterns. 420 Breeding biology of Geositta poeciloptera (Aves, Scleruridae) in the upper Rio Grande grasslands, Southern Minas Gerais, Brazil Tamara L. Silva1*, Vitor Lombardi2, Leonardo Lopes2 ǢW2-='89-&!&' '&'8!£&'-39!f f £38'9;!£WT ǣW2-='89-&!&' '&'8!£&'-39! r;!1!8!6!99!839|+1!-£W$31W#8 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION Geositta poeciloptera is a globally Vulnerable grassland specialist passerine that is thought to be undergoing a rapid population decline. Almost nothing is known about the breeding biology of the species, what lead us to conduct this study. From July 2014 to February 2015, we studied the breeding biology of a population of G. poeciloptera found in the municipality of São João del Rey, MG, Brazil. We captured adult birds with mist nets and marked them with colored bands. We searched for nests by following the adult birds, what resulted in the discovery of 36 nests that we monitored with a boroscope. 1HVWW\SHLVFDYLW\ZLWKWXQQHOVLPSOHSODWIRUPDQGZHUH excavated in the banks along dirty roads (n=33), in armadillos burrows excavated in “murundus” (n=2) and on a small vertical pit on the ground (n=1). The nest chamber was layered with leaves of grass, small fragments of charcoal and mammal hairs and feces. Breeding season spanned through 135 days (from September to December), with a peak on numbers of nests in September. Mean clutch size is of three eggs (93%), with some few nests presenting two (3.5%) or four eggs {փdփTT ID t ABSTRACT t (3.5%). Eggs are white and pyriform. Incubation period is of 15 days and is performed by both sexes. Nestling period is of 17 days, and both parents feed the youngs. Fledglings stay in the parents territory for only about 15 days after leaving the nest, dispersing after that. The results found allow to know better the species and plan strategies for its conservation. 424 Avian inventory of the Recanto das Araras de Terra Ronca Extractive Reserve (Goiás, Brazil) Renata M. Rossato1*, Flor Maria Guedes F.M.G Las-Casas2, Ailton Carneiro A.C. Oliveira1, Cristine da Silveira Figueiredo C.S.F Prates3, Fernando de Lima F.L. Fvaro4, Joo Marcelo J. M. Holderbaum, Paulo Ricardo P. R. Siqueira5, Rita de Cassia Surrage R. C. S. Medeiros1 ǢWc-3TǣW2-='89-&!&' '&'8!£&''82!1#<$3T ǤW2-='89-&!&' '&'8!£&!!8!Ð#!TǥW!87<'!$-32!£&'£,! 8!2&'c-3TǦW2-='89-&!&'9;!&<!£&'32;'9£!839 ID t ABSTRACT t Table of Contents richness found for the Cerrado region (837). Nine of the 30 endemic Cerrado species were found in the reserve: Alipiopsitta xanthops, Antilophia galeata, Charitospiza eucosma, Clibanornis rectirostris, Cyanocorax cristatellus, Herpsilochmus longirostris, Knipolegus franciscanus, Melanopareia torquata and Saltatricula atricollis)LYHVSHFLHVZHUHFODVVLĆHGDV1HDU7KUHDWHQHGLQ Brazil and nine are contemplated by Action Plans for Avian Conservation. Even presenting a relatively small area when compared to other Brazilian Federal Protected Areas, the results demonstrate a representative species richness, with the occurrence of endemic species, reinforcing the importance of the RATRER for the conservation of the avifauna in the Cerrado region. This study will provide information for the elaboration of the RATRERs Management Plan and may also stimulate birdwatching tourism in the region, contributing to conservation and local community development. r8'2!;!W8399!;3|-$1#-3W+3=W#8 POSTER SESSION: DIVERSITY & DISTRIBUTION The Recanto das Araras de Terra Ronca Extractive Reserve (RATRER) is located in the Cerrado domain, in the northeastern part of the state of Goiás, Brazil, and comprises an area of 12.349 ha. It is a Federal Protected Area administered by the Chico Mendes Institute for Biodiversity Conservation. Besides being considered an Important Bird Area, the Terra Ronca region lacks local avian studies. Two expeditions to the RATRER were conducted, one during local dry season and the other in the rainy season, in August and November 2014, respectively. The avian assembly was sampled using 10-species MacKinnon lists and mist-nets. With all survey methods 216 species were GHWHFWHGZKLFKUHSUHVHQWVURXJKO\RIWKHWRWDOVSHFLHV Page 220, Posters 425 )UHTX¬QFLDGHPLFURQ¼FOHRVHPHULWUµFLWRVGH aves para avaliação da qualidade ambiental do mangue de Porto do Mangue/RN Raphaella Paiva1*, C. Calabuig1, H. Oliveira1 ǢW r!)2,!6!-=!i|,3;1!-£W$31 POSTER SESSION: FIELD TECHNIQUES & TOOLS FOR CONSERVATION A detecção de danos no DNA causados por contaminantes é de grande importância na conservação da diversidade das espécies. Apesar da grande maioria dos estudos serem realizados com peixes, as aves também são excelentes indicadoras da qualidade ambiental funcionando como {փdփTT ID t ABSTRACT t ID t ABSTRACT t Table of Contents detectores de mudanças na saúde e condições do ecossistema. 426 Avifauna do Parque Municipal de Maceió, um importante O presente estudo foi realizado numa área de mangue, fragmento urbano de Mata Atlântica do Nordeste do Brasil às margens da cidade de Porto do Mangue (51°3’47.28’’S, W. O. Silva1*, C. F. M. Ferreira1, T. K. Guedes1, R. Gaban-Lima1 36°46’14.29’’O). Extraiu-se o sangue da veia alar, que foi ǢW!#38!;8-3&'38(3£3+-!T-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9lmT diretamente colocado sobre a lâmina, foi feito o esfregaço. ';38&'-3&-='89-&!&'T29ধ;<;3&'-Í2$-!9-3£+-$!9'&!!&'T2-='89-&!&' Em laboratório, as lâminas foram submetidas a um período de '&'8!£&'£!+3!9c<9'<&'-9;8-!!;<8!£&!2-='89-&!&' '&'8!£&'£!+3!9 espera “overnight”, secando a temperatura ambiente para a r3£-='-8!9>-££-!19|+1!-£W$31 Ć[D©¥RGRPDWHULDO$SµVIRUDPVXEPHUVDVHPPHWDQRO POSTER SESSION: ECOLOGY & CONSERVATION durante 10 minutos, depois lavadas com água destilada e IN HUMAN MODIFIED LANDSCAPES coradas com Giemsa (5%) durante 40 minutos. Posteriormente, As áreas verdes em ambientes urbanos são importantes para foram lavadas com água destilada e secas a temperatura a manutenção da biodiversidade local, e a compreensão das ambiente. Foram analisadas em microscópio óptico com comunidades de Aves urbanas na região Nordeste é incipiente. objetiva de resolução 100x através de teste cego, seguindo Esse estudo visa inventariar a avifauna de um importante o modelo “zig-zag”. Contaram-se 2500 células por lâmina, UHPDQHVFHQWHćRUHVWDOXUEDQRR3DUTXH0XQLFLSDOGH0DFHLµ totalizando 5000 células por indivíduo. Foram analisadas 16 LQYHVWLJDQGRDHVWUXWXUDWUµĆFDGHVVDFRPXQLGDGHHDSUHVHQ©D espécies migratórias e 16 espécies residentes totalizando 32 de táxons relevantes para a conservação (endêmicos do Centro amostras observadas entre Setembro de 2014 e fevereiro GH(QGHPLVPR3HUQDPEXFRHRXDPHD©DGRVGHH[WLQ©¥R de 2015. As aves migratórias apresentaram uma média de As amostragens se iniciaram no mês de setembro de 2014 2,62Mn enquanto os indivíduos residentes apresentaram e se estenderam até abril de 2015. Considerando as aves uma média de 3,12Mn. Apesar de preliminares, este dados registradas nesse estudo (86 espécies), e aquelas registradas podem estar indicando uma possível contaminação do por Leal (2010, Guia de aves do Parque Municipal de Maceió) mangue ao ponto de causar danos a nível celular. Este local (94 espécies), foram registrados 102 espécies (em 37 famílias também pode estar funcionando como modelo para evidenciar e 17 ordens). Desses, quatro táxons são considerados possíveis diferenças nas concentrações de malformações RĆFLDOPHQWHDPHD©DGRVMomotus momota marcgravianus, celulares entre espécies migratórias e residentes. Thamnophilus caerulescens pernambucensis, Tangara fastuosa e Sporagra yarrellii, sendo os três primeiros endêmicos do Centro Pernambuco. Dessa comunidade de Aves, três são consideradas altamente sensíveis a distúrbios ambientais e 15 são medianamente sensíveis. As aves insetívoras predominaram com 34 táxons (33%), seguidos pelos onívoros com 33 (32%) Page 221, Posters {փdփTT ID t ABSTRACT t e nectarívoros com 10 táxons (10%). É notável a baixa riqueza de frugívoros (apenas 8% da comunidade), padrão esse semelhante ao observado em outros trabalhos realizados no estado. A existência de táxons endêmicos e ameaçados reforça a inquestionável relevância dessa Unidade de Conservação, e a presença de táxons altamente e medianamente sensíveis pode VHULQGLFDWLYRGHTXHHVVDćRUHVWDXUEDQDWHPDFDSDFLGDGH de manter elementos importantes para orntitofauna local. 431 Birds of a largely urbanized Neotropical city: species composition and feeding guilds Joo Carlos C. Pena1*, Ana Ustch1, Vanessa Monteiro1, Marcos Rodrigues1, Robert J. Young2 ǢW2-='89-&!&' '&'8!£&'-2!9'8!-9TǣW2-='89-;@3(!£(38& ID t ABSTRACT t Table of Contents in at least one visit were considered. We recorded a total of 83 bird species, distributed in 26 families. Tyrannidae was the most representative family with 23 species, followed by Thraupidae (12 species). Seventy-three species were recorded sitting on different substrates, as wires, trees, and sidewalks. This value represents 20% of all species previously recorded LQDUWLĆFLDODQGQDWXUDODUHDVLQ%HOR+RUL]RQWHVSHFLHV All feeding guilds previously observed in the municipality were registered in the streets: omnivorous and insectivorous being the most abundant groups, (30.14% and 23.29%, UHVSHFWLYHO\7KLVUHVXOWVVXJJHVWWKDWDVLJQLĆFDQWDVVHPEO\RI the bird species are able to survive and persist with the limited resources available through the urban landscape. Further research should assess if this assembly may play important ecosystem services such as pollination and seed dispersion. r/3!3$6'2!|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES The role of urban landscapes for biodiversity conservation has been increasingly recognized. As the expansion of urban landscapes occurs, strategies such as the conservation of habitat fragments and street trees, are needed to reconcile the development with the retention and maintenance of biodiversity. The aim of this study is to describe the bird community that are able to survive and occupy a Neotropical urban ecosystem. We selected 60 point count locations in streets distributed through the south region of Belo Horizonte, Minas Gerais, Brazil. Each point was visited three times during PLQXWHVDQGDOOVSHFLHVWKDWZHUHVLQJLQJSHUFKHGRUć\LQJ were registered. To evaluate which species really occupy the urban ecosystem, only those birds that were visualized perched Page 222, Posters 433 Molecular systematics of Microcerculus bambla/ marginatus (Aves: Troglodytidae) species complex Bernardo Prestes1*, Leonardo Miranda1, Lucas Arajo-Silva1, Alexandre Aleixo1 ǢW<9'<!8!'29'1£-33'£&r#'82!8&368'9;'9ǡ|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS This work constitutes a biogeographical analysis using mitochondrial and nuclear DNA of individuals collected throughout the Neotropical lowlands and analyzed using Bayesian approaches. Species tree analysis and divergence time inference were used to reconstruct the evolutionary history of the Microcerculus bambla / marginatus species {փdփTT ID t ABSTRACT t ID t complex. Although our analyses support the monophyly of the M. bambla / marginatus species complex, of the 10 reciprocally monophyletic lineages recovered (including single divergent samples from unique geographical areas) in the mtDNA JHQHWUHHRQO\ĆYHDUHHQWLUHO\FRQVLVWHQWZLWKFXUUHQWO\ recognized subspecies limits in this group: (1) nominate M. bambla bambla (Guiana lineage); (2) M. bambla caurensis (Imeri lineage); (3) M. bambla albigularis (the disjunct population IURPWKH$QGHDQIRRWKLOORQO\DPSOLĆHGIRUPW'1$ M. marginatus luscinia (Central America lineage); and (5) M. marginatus taeniatus (trans-Andean population sister to Napo lineage). Owing to type locality of M. marginatus marginatus are uncertain (“Bogota skins” are usually unknown), it is not possible to know to which lineage this taxon name apply; LQDQ\HYHQWDWOHDVWĆYHDSSDUHQWO\XQQDPHGOLQHDJHV currently attributed to M. marginatus marginatus can be recognized as distinct evolutionary units (Napo, Inambari, Rondônia, Tapajós and Xingu lineages). Thus, we notice the need of formally describing the unnamed evolutionary lineages mentioned above, given that they constitute, not only genetically but vocally and morphologically distinct lineages. And an integrative taxonomic approach is in course WREHWWHUHVWDEOLVKLQWHUVSHFLĆFOLPLWVDPRQJWKHVHOLQHDJHV 434 Distribution and status of an increasingly rare duck, the Page 223, Posters ABSTRACT t Table of Contents Southern Pochard (Netta erythrophthalma), in South America Juan Freile1*, Arne J Lesterhuis2, Robert P Clay2 ǢW31-;$<!;38-!23&''+-9;83982-;3£+-$39TǣW-8&-('2;'82!ধ32!£ r/(8'-£'3|@!,33W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION The Southern Pochard (Netta erythrophthalma) has a widespread but rather local distribution in South America, with EUHHGLQJSRSXODWLRQVLQWKH&DULEEHDQ$QGHDQDQG3DFLĆF regions of Venezuela, Colombia, Ecuador, and Peru, the Andes of Argentina, and the Atlantic coast of Brazil. Although never numerous in comparison to the African population, the species has been noted to decline as early as the 1970s. Its current range appears largely reduced, with scarce records that mainly LQYROYHVPDOOćRFNVH[FHSWLQJLQVRXWKHUQ%UD]LOZKHUHLW likely spread in recent years. However, as African populations are numerous and the species has a large distribution, it has not been ranked as globally threatened. Our revision of its distribution and populations in South America, based primarily on an exhaustive literature revision and collection of reliable unpublished data, suggests a remarkable decline throughout most of its range, particularly in the Andes and 3DFLĆFORZODQGV7KHUHDUHQRUHFHQWFRQĆUPHGUHFRUGVIURP Colombia and most Peru, whereas numbers are dramatically reduced in Ecuador. Its status in Venezuela is unclear and numbers in Argentina have always been low. The status of the species in Brazil is apparently less critical, with numerous records from Ceará south to Bahia and Goias. Still, numbers are reportedly low and it has even been suggested that formerly large Brazilian populations are also in decline. Habitat loss by {փdփTT ID t ABSTRACT t siltation, dredging, and destruction of riparian vegetation, along with hunting appear as major threats. Previous population estimates seem to be overestimating actual numbers, making it necessary to revise its conservation status in South America. 435 Morphometric data and banding of migratory birds on the Panaquatira Beach, São José Bay, Maranhão Reydson Rafael Rosa Reis1*, Ana Paula Silva de Sousa1, Lucyellen Rodrigues de Sousa1, Leandro Schalcher Aguiar1, Antnio Augusto Ferreira Rodrigues1 ǢW '&'8!£2-='89-;@3(!8!2,3 r8'@&9328!(!'£|,3;1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION The Panaquatira Beach (São José Bay, Maranhão - Brazil) stands out as a conservation and study site used to the catching and banding of shorebirds to obtaine data on their biology. This kind of study has contributed to the conservation of these birds worldwide. The objective of our study was banding shorebirds on the Panaquatira Beach and collect the biometric data of birds captured using mist nets during the period from April to June 2013. A number of 142 birds representing 7 species were captured: 25 Arenaria interpres, 6 Calidris canutus, 99 Calidris pusilla, 2 Charadrius collaris, 8 Charadrius semipalmatus, 1 Limnodromus griseus and a Pluvialis squatarola. Among these species C. pusilla had the most successful capture and is considered the most abundant in the Maranhão Coast. Two birds were recaptured, between these recaptures it is noteworthy a recapture of a C. pusilla (band E36823) that DFFRUGLQJWRWKH&(0$9(,&0%LR'DWDEDVHLWZDVEDQGHGLQ 0DLD¼,VODQGLQ0DUDQK¥R&RDVWRQ5HFDSWXUHV Page 224, Posters ID t ABSTRACT t Table of Contents are considered one of the main methods of study to understand the complex process of migration, provide knowledge on the stop locations, reproduction and routes. The species A. interpres, C. canutus and C. pusilla had an average weight (g) of 130.66, 31.45 and 28.00, respectively and an average wing sizes (mm) of 154.16, 174.83 and 98.61, respectively. The body mass rates and wing sizes are measures used to track the migration process. Through these data it becomes possible to infer whether populations of migrant birds will leave or stay in the wintering site. Obtaining these data is crucial in conservation and research for endangered migratory species. 439 &ROHFFLµQI¯VLFD\IRWRJU£ĆFDGHQLGRV\KXHYRVGHDYHV del Museo de Zoología, Universidad de Costa Rica Karla Conejo-Barboza1*, Luis Sandoval1, Gilbert Barrantes1 ǢW2-='89-&!&&'39;!-$! r0!£-2!#!8#3A!|+1!-£W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION El conocimiento sobre el diseño de nidos y huevos de aves representa una herramienta útil para estudios de comportamiento animal, evolución, monitoreo de especies y conservación. Hasta hace poco, Costa Rica contaba sólo con la colección del Museo Nacional. En el 2003 un estudiante comenzó a recolectar huevos y nidos los cuales se fueron acumulando en los estantes del Museo de Zoología de la Universidade de Costa Rica. En el 2009 comenzamos a FDWDORJDUGDUOHPDQWHQLPLHQWR\FRQWLQXLGDG3DUDĆQDOHVGHO 2012, propusimos realizar de manera paralela una colección IRWRJU£ĆFDGHQLGRV\KXHYRVSDUDDSR\DUODFROHFFLµQI¯VLFD Estas colecciones tienen como objetivos: 1) Asegurar la {փdփTT ID t ABSTRACT t apropiada conservación, documentación y accesibilidad GHOPDWHULDOI¯VLFR\IRWRJU£ĆFRGHODFROHFFLµQVHUYLUGH referencia o material de apoyo a la enseñanza de cursos o investigaciones relacionadas con la reproducción en aves, 3) ser depositario de material testigo y 4)promover la investigación en este campo. Actualmente la colección alberga 232 nidos de 96 especies costarricenses y 209 nidadas de 157 especies internacionales y costarricenses, como parte de la colección I¯VLFD/DFROHFFLµQIRWRJU£ĆFDFXHQWDIRWRJUDI¯DVHQSURFHVR de catalogación. La colección física de nidos brinda apoyo a XQDWHVLVGHPDHVWU¯DVREUHODYDULDFLµQLQWUDHVSHF¯ĆFDHQ el diseño de nidos y ha proporcionado material para tres publicaciones. Esperamos que más fotógrafos y conocedores del campo de la ornitología nos apoyen con su material para continuar la realización y ampliación de estas colecciones, además que nuestra iniciativa contribuya positivamente a futuros estudios sobre nidos y huevos de aves neotropicales. 441 Are small parks reducing the reproductive success of bird species in urban landscape of Santiago, Chile? Tahia Rannou1*, Jorge Prez-Quezada1, Sebastin Abades2 ǢW2-='89-&!&&',-£'T !$<£;!&&'-'2$-!9+8321-$!9T ǣW'6!8;!1'2;3&'$3£3+!'29ধ;<;3&'$3£[email protected]&-='89-&!& ID t ABSTRACT t Table of Contents and limiting reproductive success. However studies of avian reproductive success in urban landscapes are scarce. As in fragmented landscapes, urban parks represent fragments of habitat immersed in the urban matrix, hence, park size could play an important role in reproductive success. Thus, larger parks should represent higher quality habitat than small parks. During spring 2014, we selected 17 parks, grouped in threesize categories: small (< 0.99 ha), medium (between 1 and 4.99 ha) and large (> 5 ha). At each park we monitored every nest we encountered for the whole reproductive season (i.e., from September to December), every 4 days. A total of 112 nests of 7 native species were monitored. For each nest, we measured height, tree species and bird species and the nest VXFFHVV7KH0D\ĆHOGUHSURGXFWLYHLQGH[ZDVHVWLPDWHG and used as a response variable. We used generalized linear mixed models (GLMM), to analyze the effect of park size on reproductive success. Bird species identity, tree origin and nest height were assessed as random factors. In contrast WRRXUSUHGLFWLRQVZHGLGQRWGHWHFWDVLJQLĆFDQWHIIHFWRI park size on avian reproductive success. Thus, small parks did not reduce reproductive success of urban birds. Turdus falcklandii and Zenaida auriculata are common native birds in this urban landscape and represented 85% of our monitored nests, thus, those species may not be affected by park size. r;!,-!8!223<|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Urbanization is considered to be one of the largest threats to biodiversity worldwide. As often shown in urban green areas, urbanization negatively affects bird richness and abundance, through habitat loss by increasing predation rates Page 225, Posters {փdփTT ID t ABSTRACT t 445 Hierarchical distance sampling to estimate density of hyper- abundant Zenaida auriculatapopulations in central Argentina Jaime N Bernardos1*, Jeffrey J Thompson2, Andrea P Goijman1, Joaquin L Navarro3, Maria Elena Zaccagnini1 ID t ABSTRACT t Table of Contents GHYHORSLQJPDQDJHPHQWWRPLWLJDWHWKHFRQćLFWEHWZHHQ Zenaida auriculata populations and agricultural production. 446 ,GHQWLĆFD©¥RHELRPHWULDGHHVS«FLHVGHDYHV ǢWTǣW<@8!!8!+<[email protected]ǤW2-='8-&!&!$-32!£&'38&3#! residentes em Porto do Mangue, RN, Brasil r/!-1'W#'82!8&39|+1!-£W$31 Raphaella R.P Paiva1*, C. Calabuig1, H. Oliveira1, Ramon E.R Menezes1 POSTER SESSION: FIELD TECHNIQUES & TOOLS FOR CONSERVATION ǢW In South America population explosions of Zenaida auriculata KDYHRFFXUUHGLQPXOWLSOHFRXQWULHVDQGJHQHUDWHGFRQćLFW with agricultural production. An understanding of how land use and landscape composition drive these populations is LPSRUWDQWWRZDUGVPLWLJDWLQJWKLVFRQćLFWKRZHYHUWKH estimation of population parameters of these hyper-abundant SRSXODWLRQVLVGLIĆFXOWDVWKHLUKLJKDEXQGDQFHPDNHVPDUNLQJ DQDGHTXDWHSURSRUWLRQRIWKHSRSXODWLRQORJLVWLFDOO\GLIĆFXOW while their abundance, mobility, and high mortality rates hinder recaptures. To deal with these sampling issues related to the Zenaida auriculata population in Argentina we employed hierarchical distance sampling to 10 years of annual sampling of 2700 points over an area of ~255,000 km sq in central Argentina. Group density increased from 0.34 (95%CI 0.31, ćRFNVKDGXULQJWR&,ćRFNV KDLQ0HDQćRFNVL]HLQFUHDVHGIURPELUGVćRFNLQ WRELUGVćRFNLQ7KHPRGHOLQJLQGLFDWHGWKDW increasing proportional area of woodlands and row crops has the strongest positive effect on the density of Zenaida auriculata. Based upon our results we believe that our sampling and modeling approach adequately address the sampling issues related to hyper-abundant populations of Zenaida auriculata and serves as an important contribution towards r!)2,!6!-=!i|,3;1!-£W$31 Page 226, Posters POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION O conhecimento detalhado da biologia, status genéticos e aspectos ecológicos da avifauna da costa do Rio Grande do Norte são essenciais para que planos de proteção e conservação sejam mais bem delineados e efetivados. O SUHVHQWHHVWXGRSUHWHQGHLGHQWLĆFDUPHGLUHDFRPSDQKDU espécies de aves residentes na Área de Preservação Ambiental de Porto do Mangue ao longo do tempo já que esta área é usada por pescadores da região como fonte de renda e, WDPE«PVRIUHLQćX¬QFLDGLUHWDGDVDWLYLGDGHVGHFDUFLQLFXOWXUD e da produção de sal marinho. Para este trabalho, a coleta de dados foi realizada mensalmente durante três dias consecutivos durante maio de 2014 e fevereiro de 2015 com o auxilio de oito redes de neblina. Foram capturados 33 indivíduos de 8 espécies. Todas as aves foram anilhadas com anilhas fornecidas pelo CEMAVE. Foram capturadas as seguintes espécies: Conirostrum bicolor; Columbina passerina; Choroceryde americana; Aramides mangle; Egretta thula; Nycticorax violacea; Cyclarhis gujanensis e Lepidocolaptes angustirostris. Para cada ave foram medidas: massa corporal em g (MC) e tarso(T), cúlmem total (CT), narina- ponta (NP), largura do bico(BL), altura do bico(BA), asa (A) e cauda (C) em mm. Atualmente {փdփTT ID t ABSTRACT t é necessário conhecer a biodiversidade da fauna local e se ela apresenta variações ao longo do tempo com o intuito de avaliar se as atividades antrópicas trazem prejuízos ao ecossistema. O estudo da biometria desses animais auxilia a criação de um banco de dados para melhor avaliação do estado de conservação dos mesmos ao longo do tempo. 447 Vocal repertoire and parental care behaviors in males of Psarocolius montezumain cloud forest of central Veracruz, Mexico Ronald A. Fernndez-Gmez1*, Jorge E. MoralesMvil1, Fernando Gonzlez-Garca3 ǢW!#38!;38-3-3£3+!&'£31638;!1-'2;3T29ধ;<;3&' '<83';3£3+!T2-='89-&!&'8!$8<A!2!TǣW'&&'$3£[email protected] 329'8=!$-2&''8;'#8!&39T29ধ;<;3&'$3£3+!TWW r832!£&',-&3|+1!-£W$31 POSTER SESSION: BIOACOUSTICS Vocal communication involves endocrine, neurobiological and anatomical mechanisms; each repertoire provides valuable information for understanding ecological and behavioral aspects and its implementation in systems of protection against predators during nesting and parental care, being important for gregarious icterids like Psarocolius montezuma, specie with polygyny mating system. Despite the studies about its reproduction system, the role of vocal communication in their social systems is unknown yet. We evaluated vocal repertoires of P. montezuma males and behavioral patterns exhibited during parental care over populations in cloud forest of central Veracruz, México. We performed a focal sampling to males on FRORQ\IRUIRXUKRXUVRIFRQWLQXRXVUHFRUGLQJ:HLGHQWLĆHG Page 227, Posters ID t ABSTRACT t Table of Contents six principal behaviors described as: agonistic interactions, vigilance, feeding, grooming; territoriality and body movement displays were prevalent. We recorded vocalizations of P. montezuma in a behavioral context; subsequently we described and analyzed spectrograms with Raven software. We found two sorts of vocalizations catalogued as: calls and songs. The song is integrated for a several sequences of phrases that showed three main frequency changes with modulation (raise, top maintenance and declination) and is conformed for both fundamental and harmonics acoustic components. The structure variation was located in the middle and ending phrases of the song while length variation was in the introduction and ending. This study provides important information about the behaviors and vocalizations of P. montezuma males in the parental care of colony period. 449 A bibliometric review of Brazilian Ornithology publications between 1982 and 2015 Sara Cristina Batista1*, Jssica Cristina Castro1, Luiz A. M. Mestre1, Juliana Rechetelo2 ǢW2-='89-&!&' '&'8!£&3!8!2ÆTǣW!1'93302-='89-;@ r#9!8!$8-9ধ2!|+1!-£W$31 POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES :HTXDQWLĆHGDQGFRPSDUHGSXEOLFDWLRQVLQWKHĆHOGRI ornithology in Brazil, aiming to register temporal changes and tendencies in ornithological studies. We reviewed national and international journals. Publications were organized E\HFRV\VWHPELRPHUHJLRQDSSURDFKSRSXODWLRQ FRPPXQLW\IRFDOJURXSVSHFLHVIDPLO\FRQVHUYDWLRQ VWDWXVDQGUHVHDUFKĆHOGHJIHHGLQJLQYHQWRU\EUHHGLQJ {փdփTT ID t ABSTRACT t ID t Publications were analyzed together and then divided by decades (1982-1989; 1990-1999; 2000-2010; 2010-2015). We evaluated 1571 publications (1237 national and 334 international). Most of the studies were conducted in the Southeast (28%) and South (17%) regions; in the Atlantic Forest biome (28%). Psittacidae (11%), Accipitridae (6%) and Emberezidae (4%) were the most studied families. The most frequent publications were about “feeding” and “inventory” ERWK)RUWKHĆUVWGHFDGHSXEOLFDWLRQVZHUHPRUH frequent in the Northern region (30%), in the Amazonian Forest (30%), and the focus of the studies were “conservation biology” (23%) and “breeding” (17%). In all following decades, the predominant regions were Southeast (32%, 29% and 24%), with studies carried out in the Atlantic Forest (22%, 31% and 29%). Studies focusing on “breeding” were the most frequent in 1990-1999 (17%), “feeding” in 2000-2009 and “inventory” in 2010-2015. Publications with populations were more frequent in all decades. Studies with endangered species represent less than 15% in all decades. These results represent an overview of the last 30 years of publication in WKH%UD]LOLDQ2UQLWKRORJ\ĆHOGSRLQWLQJWKHPDLQWUHQGVRXW and therefore promoting discussion for further studies. 450 Regionally threatened bird species in protected Page 228, Posters ABSTRACT t Table of Contents areas at Rio Grande do Sul, southern Brazil Natalia Procksch1*, Jan Karel F. Mahler Jr2, Glayson A. Bencke2 ǢW2-9-239TǣW <2&!3 33#3;2-$!&3-38!2&'&3<£ r2!;!£-!683$09$,|+1!-£W$31 POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES We assessed the representativeness of regionally threatened bird species in state and federal protected areas (PAs) of Rio *UDQGHGR6XOVRXWKHUQ%UD]LO7ZHQW\ĆYHDUHDVXQGHUVWULFW protection (totaling 180,819 ha) and seven of sustainable use (totaling 534,452 ha) were considered. Bird occurrence data were compiled by ornithologists who took part in the recent review of Rio Grande do Sul redlist of threatened species 'HFUHH&RDVWDOPDULQHDQGUHJLRQDOO\H[WLQFW birds were not included in our analysis. Of the 77 species evaluated, 12 are critically endangered, 23 endangered and 42 vulnerable. Sixty-eight species (88.3%) occur in at least one PA. Despite covering a much greater territorial extension, sustainable use PAs shelter only 14 (20.5%) threatened species, no one exclusive. Twenty-six species (38.2%) are present in only one PA, 23 (33.8%) in two PAs, two (2.9%) in three PAs, LQIRXU3$VDQGVHYHQLQĆYHRUPRUH3$V Sixty six threatened species occur in the Atlantic Forest and 26 in the Pampa. Species representativeness in PAs is similar in both biomes (86.4% and 88.5%, respectively). The PAs with the highest numbers of threatened species are the Parque Estadual do Turvo (n=28), Parque Nacional Aparados da Serra (n=14) and Parque Estadual de Itapeva (n=12). Turvo (in the Atlantic Forest) and Espinilho (in the Pampa) state parks harbor the highest numbers of critically endangered and exclusive {փdփTT ID t ABSTRACT t species. Of the nine species not represented in PAs, the critically endangered Automolus leucophthalmus, Crypturellus noctivagus and Hemitriccus orbitatus should be considered priority targets for the establishment of new PAs in the state. 456 Analisis de sitios de geofagia para la Psittacara wagleriy Amazona ochrocephalaen taludes del Rio Magdalena cercanos al bosque seco tropical Nstor Peralta-Zapata <2&!$-32!;<8! ID t ABSTRACT t Table of Contents bajos de arcillas lo que puede indicar que los loros no están consumiendo suelo para absorber las toxinas que se puedan encontrar en los alimentos. Estos resultados nos permiten dar hipótesis del por que en las zonas andinas hay lugares de conglomeración con menos individuos de loros comparado con las zonas amazónicas y nos van a servir para mejorar el hábitat de estas dos especies dentro la zona de compensación ambiental del Proyecto Hidroeléctrico el Quimbo. 457 Estudio de las aves asociadas a paisajes 26'8!£;!|2!;<8!W38+W$3 ganaderos de Colombia POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY Ronald A. Fernndez-Gmez1*, Yuri RoseroMora2, Aura Fiorela Delgado-Chaves3 Estudios que han analizado la composición física y química de los lugares en que los loros consumen suelo, han permitido conocer la funcionalidad de este comportamiento para la ĆVLRORJ¯DGHORVRUJDQLVPRV6LQHPEDUJRHVWRVDQ£OLVLVVH restringen a sitios amazónicos dejando la incertidumbre de la funcionalidad de este comportamiento para loros que KDELWDQRWURVHFRVLVWHPDV&RQHOĆQGHLGHQWLĆFDU\DQDOL]DU ĆVLFRTX¯PLFDPHQWHVLWLRVGHJHRIDJLDGHODSHULFDIUHQWH roja Psittacara wagleri y la Lora Real Amazona ochrocephala en áreas cercanas a bosques secos tropical, se realizaron recorridos en lancha sobre un tramo del rio magdalena y caminatas sobre la zona de compensación ambiental del Proyecto Hidroeléctrico el Quimbo (Huila, Colombia). En ORVUHFRUULGRVUHDOL]DGRVVHLGHQWLĆFDURQFXDWURVLWLRVGH geofagia. La composición de sodio varió notablemente entre los sitios maestreados, pero siempre fue mayor a la que reporta la literatura en lugares amazónicos. Por su parte las muestras de suelo colectadas tuvieron porcentajes Page 229, Posters ǢW!#38!;38-3-3£3+!&'£31638;!1-'2;3T29ধ;<;3&''<83';3£3+!T 2-='89-&!&'8!$8<A!2!TǣW93$-!$-2TǤW!'9;8-!'2 -'2$-!9f-3£3+-!2-='89-&!&!$-32!£&'3£31#-! r832!£&',-&3|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES La ganadería ha tenido impactos negativos en los ecosistemas (deforestación, contaminación hídrica y erosión). Herramientas de paisaje que promueven la conservación y mejoran la producción como los sistemas silvopastoriles son una alternativa. El proyecto Ganadería Colombiana Sostenible, realizó un monitoreo de aves entre 2013-2014 en 5 parches de bosque asociado a ganadería de 3 departamentos (Meta, $WO£QWLFR\4XLQG¯RFRQVLGHUDQGRSXQWRVĆMRVGHPXHVWUHR (radio 50m) y 4 días de registro por parche. Quindío presento la mayor riqueza (140 especies) seguido por Meta y Atlántico con 125 y 122 especies. Considerando registros adicionales, {փdփTT ID t ABSTRACT t los valores cambian (149, 168 y 156 respectivamente). Las familias representativas fueron Tyrannidae, Trochilidae y Thraupidae. En Atlántico sobresalen Ardeidae, Cuculidae, Icteridae y Columbidae. La variabilidad en riqueza entre parches indicó que la composición de aves presenta hábitos generalistas y alta plasticidad ecológica. Aunque la abundancia y riqueza de especies fue baja entre puntos, la alta riqueza en áreas abiertas determina la importancia de conectividad entre tipos de hábitat (matorrales y rastrojos) con el bosque para establecer poblaciones que aprovechan temporalmente oferta de recursos. Bajos valores de similitud entre parches LQGLFDQXQDFRPSRVLFLµQHVSHF¯ĆFDFRPSDUWLHQGRSRFDV HVSHFLHV/RVGLIHUHQWHVLPSDFWRVGHFDGDXQLGDGUHćHMDQ las agrupaciones encontradas y su relación con aspectos GHFREHUWXUDHVWUXFWXUD\ULTXH]DćRU¯VWLFD(QHVWH sentido, mantener un monitoreo constante, permitirá evaluar el estado actual y futuro de la comunidad de aves, UHćHMDQGRODVPRGLĆFDFLRQHVJHQHUDGDVHQORVSDLVDMHV 458 Movement behavior and habitat use of frugivorous birds in a gradient of forest loss Danielle C T L Ramos1*, Marco A Pizo2, Milton C Ribeiro1 ID t ABSTRACT t Table of Contents little is known about those responses and their consequences for ecosystem processes, as seed dispersal. In an ongoing study, we aim to describe differences between the movement behavior and the use of perches by three abundant seed dispersers birds in a gradient of forest loss. We have completed 162 hours of direct observation of birds movements in six 600 x 600 m landscapes with different percentages of forest cover and cattle grazing pastures in the surroundings of a large Atlantic Forest Corridor of Southeastern Brazil. Dacnis cayanaSHUFKIRUORQJHUSHULRGVDQGć\ODUJHUGLVWDQFHVWKDQ Turdus sp. and Tangara sayaca. Birds perch longer in low forest cover landscapes. Turdus sp. and T. sayacaćLJKWGLVWDQFHVDUH larger in the most degraded and conserved landscapes and were shorter in landscapes with intermediate forest cover. The opposite was observed to D. cayanaZKRVHćLJKWGLVWDQFHV were larger in landscapes with intermediate forest cover. That can be explained by the usage of the landscape by the studied birds. While Turdus sp. and T. sayaca have not shown differences visiting distinct kinds of perches in different landscapes, D. cayana perched more in fragments and corridors in low forest cover landscapes and more in remnant trees in areas with high forest cover. Those partial results suggest that birds can play complementary roles in fragmented landscapes. ǢW'6!8;1'2;3($3£[email protected]!<£3;!;'2-='89-;@lmT ǣW'6!8;1'2;3( 33£[email protected]!<£3;!;'2-='89-;@lm r&!2-'££'$;£8|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Birds behavior depends on landscape structure, and can respond to human changes on landscape, differences in fragmentation degree and resources availability. However, Page 230, Posters {փdփTT ID t ABSTRACT t 459 )HDWKHUPLWHVIURPĆYHVSHFLHVRIVRQJELUGV (Passeriformes) at Universidad Pedagogica y Tecnologica de Colombia campus (Boyaca, Colombia) Juliana Soto-Patio1*, Alejandra Rodrguez-Abaunza1 ǢW2-='89-&!&'&[email protected]'$23£3+-$!&'3£31#-! r/<£-!2-;!W2'!|+1!-£W$31 POSTER SESSION: PARASITISM & AVIAN DESEASES Colombia is among the most diversity countries for birds with around 1879 recorded species. This great diversity has led the development of research on ecology and systematics of Colombian birds, in contrast with the scanty and fragmentary publications on symbiotic astigmatan mites $FDUL6DUFRSWLIRUPHV$VWLJPDWLQD6SHFLĆFDOO\OLWWOHLVNQRZQ about the species richness and distribution of feather mites in bird species. In this study we report feather mites associated ZLWKĆYHVSHFLHVRIUHVLGHQWDQGPLJUDWRU\3DVVHULIRUPHV (Zonotrichia capensis, Diglossa humeralis, Pheucticus aureoventris, Vireo olivaceus and Geothlypis philadelphia). Samples were taken by mist-nets captures at different stations located at campus of Universidad Pedagógica y Tecnológica de Colombia in Tunja (Boyaca, Colombia). Morphometric data were taken from each bird, and feather mites were collected from various parts of the body, placed in 70% alcohol. In the laboratory, feather PLWHVPLFURSUHSDUDWLRQVZHUHSHUIRUPHGDQGLGHQWLĆHG to the lowest taxonomic level possible. Proctophyllodidae and Trouessartidae mites were the groups most frequently REVHUYHG7KHVSHFLĆFLW\RIPLWHVZDVFRPPRQSHUELUG species, the main microhabitats found were head, body and feathers, being occuped for different stages of mites, also the type of feather and their surface have relationship with stages Page 231, Posters ID t ABSTRACT t Table of Contents and position of these mites. This study provides new data about feather mites in some species of birds sampled for Colombia. 463 Uso de hábitat urbano por 300 individuos de diferentes especies de aves en la zona central de San José del Guaviare (Guaviare, Colombia) Cristian Andrs Mur-Escobar1*, Jenifer Andrea RojasLeguizamn1, Brahyan Jimenez-Pinzon2 ǢW'6!8;!1'2;3&'-3£3+!T2-='89-&!&!$-32!£&' 3£31#-!TǣW'8=-$-3!$-32!£&'68'2&-A!/'g r$!1<8'9|<2!£W'&<W$3 POSTER SESSION: HABITAT USE En este estudio se describe la importancia de las zonas arboladas de la ciudad, con la intención de fortalecer el DYLWXULVPRHQODV£UHDVKLVWµULFDVGHFRQćLFWRHQ&RORPELD que aún conservan los ecosistemas tropicales. Estas areas YLHQHQFREUDQGRLPSRUWDQFLDHQHOPDUFRGHOSRVWFRQćLFWR colombiano. Entre los meses de marzo de 2014 y enero de 2015 monitoreamos la actividad de las aves mediante HOP«WRGRGHSXQWRVĆMRVFRQMRUQDGDVGHREVHUYDFLµQGH 06:00 a 9:00h y 16:00 a 18:30h durante una semana cada dos meses. Utilizamos binoculares Bushnell 8 X 42mm. Encontramos que sin importar las condiciones de clima 300 individuos agrupados en 21 familias de aves se desplazan entre el rio Guaviare y la ciudad, distanciadas por 2 km, y utilizan la zona arbolada del parque central (con un área de 1km2) como refugio y sitio de dormida. Entre las especies dominantes de plantas que componen el hábitat se encuentran Ficus benjamina, Guadua weberbaueri, Elaeis guineensis y en menor proporción Hibiscus rosa, Calliandra surinamensis y un {փdփTT ID t ABSTRACT t individuo de Bombacopsis quinata. Los resultados de análisis preliminar demuestran que la zona central del municipio es un refugio importante para las aves y además un sitio de especial atractivo para el turismo de observación de aves. 464 Bird Fauna of a reach of the Purus River, in Lábrea, Amazonas, Brazil Erunai P. Lima1*, Saymon Albuquerque2 ID t ABSTRACT t Table of Contents 16 species, the least abundant families were Thraupidae, Cuculidae, Cardinalidae, Turdidae, with only four species each. We recorded species not common in open areas, such as Ibycter americanus, Dendrocincla merula, Ramphastos tucanus. We also found vulnerable species, Sporophila caerulescens, Cyanoloxia cyanoides and Sporophila angolensis. The presentation of this study is intended to serve as a stimulus for further research in different parts of the Purus river, in the hope that these new efforts can be made more intense portions. ǢW'2;83&'29-233<$!9TǣW'2;83&'29-233<$!9 r'8<2!-!ǡǢ|+1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION The Braziliam bird fauna is considered one of the richest in the world, with approximately 1.901 species. In the Amazon the SUHVHQFHRIODUJHULYHUVKDVDQLPSRUWDQWLQćXHQFHRQWKHELUG richness and diversity patterns. In addition, the habitat created by rivers, such as igapós and march forest harbor approximately 15% of the regional bird fauna. The present study presents a list of bird species observed along a reach of the Purus River, in Lábrea, state of Amazonas, northern Brazil. The study area comprises 350 km of river, most of whith within the Extractive Reserve of the Middle Purus. In several parts, we observed RIIRUPDWLRQRIZDWHUERGLHVE\VRLOHURVLRQLQZKLFKćRDWLQJ vegetation had accumulated, forming a suitable environment for bird permanence and visits. The species inventory was carried out in two boat expedition in August and October 2011, in a total of 1,400 km (return trips) and 64 h of sampling. The methods used were direct observation with binoculars from 6:00 to 15:00 and sound record. We photographed the specimens whenever possible. We found 119 species of 32 families. The most abundant family was Psittacidae, with Page 232, Posters 467 Richness and abundance of Ilha do Mel coastal birds Mnica Famelli1*, Luciana Festti1, Juliana Rechetelo1, Ana L. M. Gomes1, Ricardo Krul1 ǢW!#38!;38-3&'82-;3£3+-! r132-(!1'££-|,3;1!-£W$31 POSTER SESSION: COMMUNITY ECOLOGY This study characterized and compared coastal bird richness and abundance in two different types of beaches in Ilha do Mel, Parana, South of Brazil. Censuses were carried out in two areas: Nova Brasilia (NB; exposed beach; two points: P1 and P2) and Ponta Oeste (PO, secluded beach, two points: 3DQG3GXULQJ6HSWHPEHUWR$XJXVW$UHD NB is near a small village while PO was away from any human occupations. We registered a total of 55 bird taxa (22 migratory, 31 residents, one partially migratory and one partially resident) in 460 censuses; nine out of 55 had a frequency superior of 20%, representing 76.7% of all contacts. Charadrius semipalmatus and Rynchops nigra were the most abundant species and represented, together, 57.8% of all {փdփTT ID t ABSTRACT t ID t contacts. Although frequent, the species C. collaris, Egretta caerulea, E. thula and Vanellus chilensis had low abundance. Area NB was the richest, with 50 species, and area PO with VSHFLHV%LUGULFKQHVVDQGDEXQGDQFHZHUHVLJQLĆFDQWO\ GLIIHUHQWDPRQJSRLQWV3)RUW\ĆYHVSHFLHVZHUH registered in P2, of those, 12 were recorded only in this point. The highest number of species per census was recorded in P2 (6.87 ± 0.23), while P4 had the lowest (0.91 ± 0.13). Mean number of individuals was similar in P1, P2 and P3 and it was VLJQLĆFDQWO\OHVVLQ33(QYLURQPHQWDOGLIIHUHQFHVLQ EHDFKKDELWDWDVWKHSUHVHQFHRIDULYHURUDPDQJURYHDUHD DUHOLNHO\LQćXHQFLQJWKLVGLVWULEXWLRQSDWWHUQ0DQDJHPHQW and conservation actions should consider the high richness LQ1%DVZHOODVWKHWRXULVWLFLQćXHQFHWKHUHIRUHIXUWKHU studies focusing tourism impact should be addressed. 469 Movement and home range of the Austral thrush Page 233, Posters ABSTRACT t Table of Contents (Turdus falklandii) among parks in an urban landscape Csar Muoz Varela1*, Juan Celis Diez2, Francisca Morales3, Alexis Vasquez4, Camila Bravo5 ǢW32ধ)$-!2-='89-&!&!;Õ£-$!&',-£'T'6;3W&'$3£3+Ð!g'2;83&' '9!883££38#!23<9;'2;!#£'lmT29ধধ;3&'$3£3+Ð[email protected]&-='89-&!& lmTǣW32ধ)$-!2-='89-&!&!;Õ£-$!&'!£6!8!93T9$<'£!&'+83231!g '2;83&''9!883££38#!23<9;'2;!#£'TTǤW2-='89-&!&&' ,-£'T'6!8;!1'2;3&''3+8!ऄ!TǥW2-='89-&!&&',-£'T'6!8;!1'2;3 &''3+8!ऄ!TǦW'2;83&''9!883££38#!23<9;'2;!#£'T r$'1<23A|<$W$£ POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Urbanization is tantamount to a near-permanent alteration of land use, resulting in remnants vegetation fragments and parks of different sizes immerse in an urban matrix, thus, urbanization has resulted in a reduction of bird richness and abundance. This urban matrix constitutes a barrier for animal PRYHPHQWVWKXVSDUNVL]HFRXOGLQćXHQFHPRYHPHQWV and home range of urban birds. In this context, small parks, become lower quality habitats, and species will require a larger area to supply their basic needs. Using radio-telemetry, we analyzed the movement and home range of the Austral thrush (Turdus falcklandii), a common native bird of Santiago, Chile. We assessed movements and home range in two large parks (> 6 ha) and three small parks (< 0.2 ha) contiguous to one large park. For home range, we used a Kernel Density Estimation (KDE), and also a Minimum Convex Polygon (MCP) for the total area of use. We captured and followed 9 individuals (6 on large parks and 3 on small ones) for 7 {փdփTT ID t ABSTRACT t consecutive days. Movement between small and large parks or vice versa wasn’t observed, despite small distance among parks. Contrary to our predictions, we observe a trend with large home range in large parks (mean ± SE: 16097± 3337,5 m2), compared to small parks (mean ± SE: 1874,3 ± 321,9 m2). These results suggest that, despite large differences in park sizes, they are suitable habitats for this species. 472 Comunidade de aves do centro-oeste do Rio Grande do Sul Lauren R. Teixeira1*, Jorge Reppold Marinho2, Chaiane Teila Iager2 ǢW2-='89-&!&''+-32!£2;'+8!&!&3£;38<+<!-'&!9-99'9lmT8'$,-1f TǣW2-='89-&!&''+-32!£2;'+8!&!&3£;38<+<!-'&!9-99'9lm ID t ABSTRACT t Table of Contents e Furnarius rufus com maior abundância, espécies generalistas e comuns em ambientes abertos. Foram registradas ainda Limnoctites rectirostris, Rhea americana e Anthus nattereri como “quase ameaçada” e “vulneráveis” de extinção, indivíduos que dependem diretamente de vegetação campestre. As aves IRUDPVLWXDGDVHPVHWHFDWHJRULDVWUµĆFDVVHQGRLQVHW¯YRUDV (36,3%) e onívoras (29,7%) as mais representativas em relação à riqueza de espécies. Nossos resultados permitiram conferir a importância dessas áreas para manutenção da comunidade de aves. Por isso, devem ser ampliados os esforços quanto aos conhecimentos ornitológicos do Pampa, já que a pressão da agricultura e pecuária é muito intensa, DPHD©DQGRDFRQVHUYD©¥RGDVDYHVQDĆVLRQRPLDFDPSHVWUH r£!<8'28<16'£|@!,33W$31W#8 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION O Bioma Pampa no Brasil é representado unicamente no Rio Grande do Sul, é constituído em sua maioria pela vegetação campestre, áreas que estão entre as mais afetadas mundialmente por atividades antrópicas. Portanto, estudos que ampliem o conhecimento da avifauna são essenciais para conservação da biodiversidade. Objetivo foi avaliar a estrutura da comunidade de aves campestres do centro-oeste do RS. O WUDEDOKRIRLUHDOL]DGRHP6¥R9LFHQWHGR6XO56HPGXDV£UHDV de aproximadamente 120 hectares cada, com introdução de DJURSHFX£ULDHLQćXHQFLDGDHVS«FLHH[µWLFD6XVVFURID$VDYHV IRUDPDPRVWUDGDVQDSULPDYHUDHYHU¥R)RUDP realizados 12 pontos de escuta em cada área de no mínimo 400m. Foi avaliada a riqueza e abundância, assim como a respectiva dieta alimentar. Foram registrados 830 contatos de 121 espécies. Destacamos Zonotrichia capensis, Vanellus chilensis Page 234, Posters 474 New Record of theMicrastur mintoniWhittaker, 2002 (Falconidae) in the Atlantic forest of northeastern Brazil Toms G. Capdevile1*, Letcia B. Bissoli, Gustavo R. Magnago ǢW !'9! ;31!9$!6&'=-££'|,3;1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS After its description in 2002, the cryptic forest-falcon Micrastur mintoni was rediscovered 12 years later in southeastern Brazil in Linhares, Espírito Santo, known to date as the only state to keep a relictual population in the Atlantic forest. Excluded that extinction, but in a critical situation due to the deforestation of lowland forests (tabuleiro forests), the northeastern population KDGQRW\HWEHHQFRQĆUPHGNQRZQE\VSHFLPHQVGHSRVLWHG LQVFLHQWLĆFFROOHFWLRQVVLQFHIRUPHUO\M. gilvicolis). Herein, we provide a recent documented record of Micrastur {փdփTT ID t ABSTRACT t ID t mintoni for the Atlantic forest of northeastern Brazil, pointing a new locality of the species from southern Bahia. Our record is documented by photographs from Veracel Station Private Reserve of Natural Heritage (RPPN), municipality of Porto Seguro, obtained on May 25th of 2014. While working inside the reserve, after the play-back, one adult M. mintoni quietly appeared in the middle forest stratum (about 5 m above the JURXQGDWDERXWDP2QHPLQXWHODWHUWKHIDOFRQćHZ EDFNLQWRWKHIRUHVWZLWKRXWYRFDOL]LQJ7KLVUHFRUGWKHĆUVW for Porto Seguro, occurred eight decades after the collection of the existing specimens from Itabuna and Cachoeira Grande, corroborating the current occurrence in the Atlantic forest of northeastern Brazil, being a new locality for M. mintoni. The paucity of records suggests that the species is indeed rare in the Atlantic forest, even in well preserved forests and Information about other localities of occurrence will contribute to a better understanding of the current distribution and conservation strategies for this cryptic raptor of discrete habits. 477 Secretive behavior in a large active raptor nest revealed Page 235, Posters ABSTRACT t Table of Contents by camera-traps: who is using Harpia harpyjanests Francisca Helena Aguiar-Silva1*, Olivier Jaudoin2, Tnia M. Sanaiotti1, Frederico Drumond Martins3, Jos Alves Costa-Filho5, Glucia Helena Fernandes Seixas6, Samuel Duleba6, Wilson Roberto Spironello1 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW83+8!1!&'329'8=!3 &3!=-3f8'!£TǤW29ধ;<;3,-$3'2&'9&'329'8=!3&!-3&-='89-&!&'TǦW 2-='89-&!&' '&'8!£<8!£&!1!AÖ2-!TӐW <2&!%È3'3;86-$!&38!9-£ r!+<-!89-£=!Wù|+1!-£W$31 POSTER SESSION: BEHAVIOUR Behavioral ecology of Neotropical eagles has uncertainties due to limited access to their territories and nesting trees. This study was carried out in Brazilian forests and focused on the activities on eight Harpia harpyja active nests in different nesting cycles. We monitored from Sept 2012 to May 2015 the nests by placing one camera-trap per nest. We obtained 101,767 image records in 1,421 trap days. Seventeen species occasionally used the nests. Twelve birds (Aburria cumanensis, Crax fasciolata, Urubitinga urubitinga, Pseudastur albicollis, Spizaetus ornatus, Cathartes melambrotus (scavenging), Piaya cayana, Pteroglossus castanotis, Xiphocolaptes major, Cyanocorax cyanomelas, Tangara palmarum, Psarocolius decumanus) used while adults were out; Spizaetus ornatus used the nest for FRXUWVKLSDQGFRSXOD2IWKHĆYHDUERUHDOPDPPDOVDQWHDWHU Tamandua tetradactyla, tayra Eira barbara, monkey Sapajus cay, kinkajou 3RWRVćDYXV, opossum Caluromys lanatus) two had interactions with the H. harpyja adult and one was preyed. Four of these mammal species are known as H. harpyja preys. This evidence of multi-species usage of H. harpyja nest reinforces the value of protecting nesting-tree and the forests surround {փdփTT ID t ABSTRACT t them, to ensure the ecological consumer-resource interactions. Camera-trap was a non-invasive tool for insuring continuous PRQLWRULQJDVZHOODVSURYLGLQJHIĆFLHQWWLPHHIIRUWLQYHVWPHQW and allows this large eagle to be studied with no alteration of EHKDYLRU7KLVVWXG\ZDVVXSSRUWHGE\&$3(6)*%31,13$ )'%9DOH6$'HDQ$PDGRQ*UDQW55),GHD:LOG7,2) and Cleveland Metroparks Zoo’s Scott Neotropical Fund. 478 Primeros registros de Amaurolimnas concolor(Rallidae: Aves) en el estado de Santa Catarina, sur de Brasil – los registros más australes de la especie E. S. Silva1*, E. Carrano, A. V. Grose, R. V. Mhlen, C. B. Marcon, L. Bechauser, A. Regolin, H. B. Mozerle ǢW!-638!336'8!ধ=!6!8!329'8=!3&!!;<8'A! '£9-1!8Ǣǧ|,3;1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Amaurolimnas concolor SUHVHQWDXQDGLVWULEXFLµQJHRJU£ĆFD que empieza desde el sur de México, hacia América Central, llegando a todo el norte de Sudamérica, hasta Bolivia y Brasil. En territorio brasileño, está documentada para las regiones norte, centro-oeste y este. Reportamos los registros más australes y los primeros registros para el estado de Santa Catarina, presentando ampliación de su distribución en el sur del Brasil. La especie fue detectada por su vocalización HVSRQW£QHDHQODVFLXGDGHVGH*DUXYD ,WDSR£\\6¥R)UDQFLVFRGR6XO (Q,WDMD¯IXHHQFRQWUDGRXQLQGLYLGXR muerto debido a un desbosque, el mismo está en la colección del Museo de USP (MZUSP), São Paulo. Registros más UHFLHQWHVVRQORVGH6¥R)UDQFLVFRGR6XOD Page 236, Posters ID t ABSTRACT t Table of Contents \DSRUF£PDUDWUDPSDD\ DSRUYRFDOL]DFLµQHVSRQW£QHD\UHVSXHVWD DSOD\EDFN-RLQYLOOHDGRQGH IXHHQFRQWUDGRVX£UHDGHGHVFDQVR\D SRUUHVSXHVWDDSOD\EDFN\$UDTXDULDSRU vocalización espontánea y respuesta a playback). La mayoria de los registros conocidos han sido en Joinville. La totalidad de los registros fueron en bosques atlánticos de bajada, que presentan paisajes bastante degradados. El bosque del registro más austral (Itajaí) fue casi totalmente suprimido y la especie no fue detectada nuevamente. Consideramos la pérdida de hábitat por la degradación de los bosques atlánticos de bajada, la principal amenaza a la especie. 479 Scarlet Macaw (Ara macao) landscape use in the Peruvian Amazon rainforest Gabriela Vigo Trauco1*, Janice Boyd1, Donald J Brightsmith1 ǢW'?!9{2-='89-;@ r6!883;9|$=1W;!1<W'&< POSTER SESSION: HABITAT USE Detailed knowledge of habitat use is key for successful conservation planning. The Scarlet Macaw (Ara macao) inhabits a broad array of tropical forest types from Mexico to Bolivia. As a result, detailed knowledge of landscape use is needed across its range to understand the landscape needs of the species overall and create regionally relevant conservation plans. In well protected landscapes in southeastern Peru, abundance of the species varies greatly across seasons and forest types suggesting marked but heretofore unknown habitat preferences. Due to the highly mobile nature of this species it {փdփTT ID t ABSTRACT t LVSDUWLFXODUO\GLIĆFXOWWRTXDQWLI\QRQEUHHGLQJKDELWDWXVH We used GIS analysis of 730 macaw locations (Argos satellite telemetry) from 8 birds over 6 study years in the lowlands of southeastern Peru to describe the non-breeding season landscape use. The birds ranged over an area of 7921 km2 in the post-breeding season (April – July) before returning to the breeding range. Birds remained below 380 m elevation despite the fact that the species ascends to 850 m.a.s.l. in other parts of WKHUDQJH/RFDWLRQVDYHUDJHGVLJQLĆFDQWO\FORVHUWRULYHUVWKDQ H[SHFWHGEXWFRXQWHUWRRXUK\SRWKHVHVZHUHQRWVLJQLĆFDQWO\ FORVHUWRFOD\OLFNV7KHELUGVVLJQLĆFDQWO\SUHIHUUHGVZDPS DQGćRRGSODLQKDELWDWVZKLOHDYRLGLQJDQWKURSRJHQLFDOO\ WUDQVIRUPHGDUHDV7HUUDĆUPHIRUHVWVZHUHWKHPRVW commonly used, but were used in proportion to their availability in the study area suggesting they were not preferred. Our results highlight the importance of preserving high productivity swamp environments in the face of their destruction by extensive gold mining and urban expansion in the region. 480 'LPRUĆVPRVH[XDOHPMyiothlypis nigrocristatacon base en análisis morfometicos ID t ABSTRACT t Table of Contents en la cual existe la necesidad de encontrar caracteres que permitan distinguir entre macho y hembra. Para lo anterior, se realizó un estudio morfométrico, con 22 ejemplares adultos (11 machos y 11 hembras) preservados en la colección de ornitología de la Universidad Nacional de Colombia, con el ĆQGHFRQRFHUFDUDFWHU¯VWLFDVI¯VLFDVTXHSXHGDQUHćHMDU HOGLPRUĆVPRVH[XDOHQHVWDHVSHFLH7RPDPRVYDULDEOHV morfométricas: culmen expuesto (C.E), culmen total (C.T), alto pico (A.P), ancho comisura (A.C), largo ala (A), cola (C), tarso (T) empleando un calibrador (mm), y una regla con tope PPSDUD$\&5HDOL]DPRVDQ£OLVLV7VWXGHQWTXHUHćHMDURQ GLIHUHQFLDVVLJQLĆFDWLYDVHQODVPHGLGDVGHFXOPHQWRWDO (p=0.0307) y ala (p=0.0345). En éstas medidas, las hembras tenían un valor promedio de 60.18 mm y 13.22 mm para longitud de ala y longitud de culmen total respectivamente y los machos tenían un valor promedio de 13.8 mm y de 63 mm para culmen total y longitud de ala respectivamente. Los resultados demuestran que las medidas morfométicas son una herramienta útil para diferenciación sexual de esta especie. El presente estudio es un punto de partida para futuros estudios de M. nigrocristata, pues actualmente no se reportan investigaciones relacionadas con el tema. Jenifer Andrea Rojas-Leguizamn1*, Crisrtian Andrs Mur-Escobar1 ǢW'6!8;!1'2;3&'-3£3+!T2-='89-&!&!$-32!£&'3£31#-! r/!83/!9£|<2!£W'&<W$3 POSTER SESSION: MORPHOLOGY (OGLPRUĆVPRVH[XDOHVXQDFDUDFWHU¯VWLFDLPSRUWDQWHSDUDOD LGHQWLĆFDFLµQGHOVH[RGHDOJXQDVDYHVVLHQGRGHXWLOLGDGHQ HVWXGLRVSREODFLRQDOHVRFRQĆQHVGHFRQVHUYDFLµQMyiothlypis nigrocristataHVXQDYHPRQRPµUĆFDGHODIDPLOLD3DUXOLGDH Page 237, Posters {փdփTT ID t ABSTRACT t 483 $YLIDXQDGHXPIUDJPHQWRćRUHVWDOXUEDQR Parque Estadual Sumaúma, Manaus, AM Eglaia Rubens Freitas1*, Maiana Costa Lago1 ǢW r'+£!-!i8<#'29|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES 2VSURFHVVRVGHXUEDQL]D©¥RPRGLĆFDPDV£UHDVGHćRUHVWD e estão ligados diretamente à diminuição da qualidade ambiental. A cidade de Manaus ao longo dos anos vem sofrendo com a perda e fragmentação dos habitats naturais, a partir GRDXPHQWRGHPRJU£ĆFRDVVLPRVIUDJPHQWRVćRUHVWDLV da cidade foram aumentando, e com isso a necessidade de proteção desses lugares. As unidades de conservação são £UHDVOHJDOPHQWHSURWHJLGDVFRPDĆQDOLGDGHGHFRQVHUYDU ćRUHVWDVXWLOL]DGDVFRPRUHI¼JLRGDVFRPXQLGDGHVELROµJLFDV Objetivou-se nesse trabalho apresentar uma lista das espécies de aves que utilizam o Parque Estadual Sumaúma, localizado em área urbana da cidade de Manaus, determinando sua riqueza, composição, abundância e distribuição ecológica. Foram realizados levantamentos qualitativos e quantitativos, entre os meses de dezembro de 2014 a abril de 2015. Foram amostrados 13 pontos ao longo de cinco trilhas pré-existentes no Parque. As coletas ocorreram no horário de 06:00 às 08:00. Resultando em 123 espécies, distribuídas em 36 famílias, incluindo registros em literatura. Destas, 63 foram registradas durantes os censos. Onde 11% são consideradas HVS«FLHVWLSLFDPHQWHćRUHVWDLV$IDP¯OLDPDLVDEXQGDQWH foi Tyrannidae com 12% das espécies. Foi observado um predomínio de espécies de ambientes de clareira e copa. Os Page 238, Posters ID t ABSTRACT t Table of Contents dados sugerem que o fragmento em questão apresenta formas irregulares de ambiente, visto que foram encontradas espécies de área preservada em ambiente alterado. Dessa maneira, os dados gerados auxiliam na preservação dos remanescentes ćRUHVWDLVXUEDQRVFRQWULEXLQGRFRPSODQHMDPHQWRVH estratégias de conservação para manejo de áreas protegidas. 487 &DUDFWHUL]DFLµQGHDYHVSDUDODLGHQWLĆFDFLµQ\GHOLPLWDFLµQ del complejo de Páramo los Picachos – Colombia Julian Eduardo Avila-Campos 2-='89-&!&!$-32!£&'3£31#-!f /<'!=-£!$!|<2!£W'&<W$3 POSTER SESSION: SYSTEMATICS & TAXONOMY En el marco del proyecto Insumos para la Delimitación de Ecosistemas Estratégicos: Páramos y Humedales, se llevó a cabo la caracterización de avifauna del complejo de páramos Los Picachos que hace parte de los orobiomas andino, altoandino y de páramo más aislado al sur de la cordillera oriental en Colombia. Se ubica en el municipio de San Vicente del Caguán, poseyendo alrededor de un 96% de su extensión de ecosistemas naturales. La avifauna de alta montaña de la serranía de los picachos se había mantenido inexplorada SULQFLSDOPHQWHSRUGLĆFXOWDGHVGHRUGHQS¼EOLFRTXHKDF¯DQ difícil obtener información de estas áreas y por ello cada registro proveniente de la zona se considera muy importante. No fue sino hasta el presente estudio que se pudo realizar un acercamiento al área entre los 2700 y 3100 m representando los primeros hallazgos sobre la composición de la avifauna de alta montaña de la serranía. {փdփTT ID t ABSTRACT t 6HLGHQWLĆFDURQHVSHFLHVGHODVFXDOHVFXDWURHVW£Q incluidas bajo alguna categoría de amenaza, Spizaetus isidori (EN), Hapalopsittaca amazonina (VU), Andigena nigrirostris (NT) Contopus cooperi (NT), se registraron especies como Anisognathus lacrymosus y Metallura tyrianthina que no habían sido reportados para el sur de la cordillera occidental y que pueden representar nuevas subespecies. Los registros de HVWHHVWXGLRVHUYLU£QSDUDDPSOLDU\FRQĆUPDUORVPRGHORV de distribución de algunas aves y son el primer paso para desmantelar el vacío de información que existe para esta región del país. Se requieren esfuerzos adicionales para robustecer HVWRVGDWRVHLGHQWLĆFDUSRVLEOHVQXHYDVHVSHFLHVTXHSXHGHQ hallarse en un ecosistema tan aislado y poco conocido. 488 Avifauna presente en la Zona Reservada los Humedales de Puerto Viejo – ZRHPV, durante las estaciones de invierno primavera y verano Cynthia Romero1*, Maria Zapana1 ǢW ID t ABSTRACT t Table of Contents \DEXQGDQFLDGHODDYLIDXQDSUHVHQWHDĆQGHFRQWULEXLUDO sustento técnico para el proceso de categorización, para ello se realizaron censos por sectores durante el invierno, la primavera de 2014 y el verano de 2015. Se realizaron censos por método de transecto y búsqueda intensiva de nidos. Se registraron en total 71 especies de aves, sobresaliendo Leucophaeus modestus con 17.6 %, Leucophaeus pipixcan con 9.2% y Numenius phaeopus con 6.1 % del total de individuos. Además por su estatus migratorio tenemos 54 residentes y 17 migratorias. Se establecieron los sectores: Gramadal, canal de agua, bosque, laguna y playa. El sector de Playa fue el que presentó mayor cantidad de individuos con 49.5% del total de registros, el sector con mayor riqueza fueron las Lagunas con 50 especies, representando el 70.4 % del total de especies registradas en el periodo de estudio. Así mismo se han registrado zonas de reproducción de Chroicocephalus cirrocephalus, Ardea alba, Nycticorax nycticorax, entre otros. Este humedal sigue albergando avifauna representativa de este ecosistema a pesar de los impactos antrópicos a los que ha sido expuesto. [email protected];,-!9831'83|@!,33W'9 POSTER SESSION: COMMUNITY ECOLOGY Los humedales que son de vital importancia para las aves, PXFKRVGHHOORVVHHQFXHQWUDQEDMRODLQćXHQFLDGHODDFWLYLGDG humana que pone en riesgo este ecosistema, por lo cual su registro es necesario. El área natural protegida Humedales de Puerto Viejo, se encuentra en proceso de categorización encontrándose en un estado transitorio denominado Zona Reservada, según la normativa peruana. Se encuentra al sur de Lima en la provincia de Cañete y tiene una extensión de 275,81 ha. El objetivo de este estudio fue determinar la composición Page 239, Posters 492 Richness, abundance and functional groups of forest birds in Araucaria Forest remnant in the Paraná State, Brazil Eduardo Carrano1*, Fernando de Camargo Passos2 ǢWf<893&'-Í2$-!9-3£Õ+-$!9TǣW f'6!8;!1'2;3&' 33£3+-! 'W$!88!23|6<$68W#8 POSTER SESSION: COMMUNITY ECOLOGY This study examined the richness and abundance of species and functional groups of forest birds considering two forest environments (edge and interior) and seasonality. The study {փdփTT ID t ABSTRACT t ID t area has 52 ha and is characterized as a secondary Araucaria Forest remnant located in the Metropolitan Region of Curitiba, State of Paraná. Seventeen samplings were conducted between August 2009 and April 2012 using mist nets. A total of 570 birds were captured, belonging to 63 species and 19 IDPLOLHV6LJQLĆFDQWGLIIHUHQFHV3(50$129$LQULFKQHVVDQG abundance of species and guilds between two environments and also in relation to seasonality were recorded. The most DEXQGDQWFDSWXUHGVSHFLHVZHUH7XUGXVUXĆYHQWULVDQG Poospiza cabanisi (9.84%), both showing the highest percentage contributions (SIMPER) for forest inside (60.9%) and edge samples (24, 6%) into the remnant. Species were organized in 18 functional groups. Considering both environments, the most representative guilds in relation to richness and abundance were omnivores our frugivores of forest edge and interior, and edge seedeaters, demonstrating the great ecological plasticity RIWKLVJURXSRIVSHFLHVLQUHODWLRQWRWKHćH[LELOLW\RIKDELWDW use. Differences in richness and abundance of species and IXQFWLRQDOJURXSVGLUHFWO\UHćHFWWKHHIIHFWVRIIUDJPHQWDWLRQ on the forest remnant, mostly in vegetation structure, with the forest interior increasing similarity with the edge. In the future it is probable that the remnant studied became a homogeneous ĆWRĆVLRQRP\EHQHĆWLQJHYHQPRUHIRUHVWHGJHVSHFLHVLQ relation to those regarded as primarily forest-dwellers. 493 The bird community of Acaraí State Park and adjacent Page 240, Posters ABSTRACT t Table of Contents areas, São Francisco do Sul, Santa Catarina, Brazil Eduardo Carrano1*, Alexandre Venson Grose2, Elsimar Silveira da Silva3, Ivo Rohling Ghizoni, Jr.3 ǢWf<893&'-Í2$-!9-3£+-$!9TǣW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!f TǤW!-638!336'8!ধ=!6!8!!329'8=!3&!!;<8'A! r'W$!88!23|6<$68W#8 POSTER SESSION: COMMUNITY ECOLOGY The Acaraí State Park (ASP) has an area of 6,667 ha and located between Praia Grande and Acaraí river, north coast of Santa Catarina state, Brazil. Covered by Lowland forests, restinga and mangroves. The objectives were to inventory birds ind the ASP and adjacent areas, and identify the main human impacts. Between years 2005 and 2014 were conducted YLVLWVLQWKHĆHOGDQGVDPSOLQJVXIĆFLHQF\RIK7KH LGHQWLĆFDWLRQRIWKHVSHFLHVRFFXUUHGWKURXJKYLVXDODQG vocalization, being covered trails and access during day and night. We registered 287 species and 70 families, the most representative is Tyrannidae (n = 27) and Thraupidae (n = 24). We emphasize occurrence of endangered species in Brazil (Crypturellus noctivagus, Thalassarche chlororhynchos, Procellaria aequinoctialis, Amadonastur lacernulatus, Calidris canutus, Sterna hirundinacea, Thalasseus maximus, Carpornis melanocephala, Hemitriccus kaempferi and Sporophila frontalis) DQGUDUHXQFRPPRQLQ6DQWD&DWDULQD6WDWH(Eudocimus ruber, Accipiter superciliosus, Amaurolimnas concolor, Chloroceryle aenea, Platyrinchus leucoryphus, Conirostrum bicolor and Sporophila angolensis). The main human impacts are: uncontrolled growth of houses surrounding, waste GLVSRVDOĆUHVLOOHJDOFXWWLQJRIQDWLYHVSHFLHVEuterpe edulis), {փdփTT ID t ABSTRACT t hunting, trapping wild animals, occurrence of domestic dogs and invasive exotic plant species. These impacts are compounded by lack of supervision and management plan for this area. This park has a high conservation importance, the largest protected area and further north coast of Santa Catarina state, in addition to housing rare species of birds, and occurrence restricted to that region. 494 Rastreamento VHF de Harpia harpyjadevolvida à natureza em UC na Bahia Marcus Canuto1*, Jailson S Santos2, Alexandro D Ribeiro3, Jos Teixeira3, Samuel C Silva3, Sivaldo S Oliveira3, Carlos E A Carvalho4, Tania M Sanaiotti5 ǢW !£$32-(381'9TǣW9;!3'8!$'£TǤW&3!< 8!9-£f-3TǥW83+8!1!&'Õ9f8!&<!%È3 TǦW r1$!2<;3|+1!-£W$31 ID t ABSTRACT t Table of Contents GXUDQWHGLDVFRQW¯QXRVSRUWUDQVPLVVRU9+)VDW«OLWH Sempre arisca à aproximação dos observadores, em oito dias o deslocamento linear diário médio foi 900m, com percurso linear total de 7,7 km, grande área como as duas anteriores; saiu dos limites do parque e retornou, como ocorreu com a 1ª Harpia reintegrada. No 4º dia não se deslocou, o que indica ter caçado; no 14º predou preguiça-bentinho, mesma presa das anteriores. Os remanescentes da Costa do Descobrimento são os últimos com registros de reprodução da espécie na Mata Atlântica, sua manutenção e ações que buscam conectividade destes com fragmentos menores auxiliarão na manutenção de jovens em dispersão. Financiamento: RPPN Estação Veracel; PARNA do Pau Brasil-ICMBio; ,13$)'%9$/(6$3DUFHULDVHPUHVJDWHDWHQGLPHQWR Veterinário, estudo genético, transferência e protocolos de FRQWHQ©¥RUHDELOLWD©¥R&,33$&(0(9(&(7$6,%$0$ (XQ£SROLV%$8)(65DSWRU&RQWUROH$PELHQWDOH%LRFHY POSTER SESSION: HABITAT USE O Plano de Ação Nacional para a Conservação de Aves de Rapina- PANCAR do ICMBio, determina medidas prioritárias para conservação da Harpia harpyja. O Programa de Conservação do Gavião-real no Brasil (PCGR) atua em algumas ações do PANCAR, estuda a ecologia desta espécie, propõe e executa devolver à natureza indivíduos aptos. Na Bahia desde 2004, através do Projeto multi-institucional “Harpia na Mata Atlântica”, duas harpias da região foram reabilitadas e soltas no PARNA do Pau Brasil, com 19.020ha de mata atlântica preservada e protegida. Uma terceira, jovem em dispersão resgatada em 2012, recebeu os mesmos protocolos aplicados às anteriores: reabilitação na RPPN Estação Veracel e soltura no Parque (2014), com rastreamento Page 241, Posters 495 2HIHLWRGDLGDGHGDćRUHVWDQDGLVSRQLELOLGDGHGH cavidades para aves não escavadoras na Amazônia central Carine Oliveira1*, Cintia Cornelius1, Kristina Cockle2 ǢW2-='89-&!&' '&'8!£&31!A32!9T29ধ;<;3&'-Í2$-!9-3£+-$!9TǣW3<-9-!2! ;!;'2-='89-;@T3££'+'3(+8-$<£;<8'$,33£3('2'>!#£'!;<8!£'93<8$'9 r$!8-2'#-3£3+-!|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES 2YDORUGDVćRUHVWDVVHFXQGDULDV«TXHVWLRQ£YHOHPUD]¥R de serem jovens, principalmente quando comparadas à FRPSOH[LGDGHGRKDELWDWHQFRQWUDGRHPćRUHVWDVSULP£ULDV Cavidades em árvores é um recurso importante para muitas {փdփTT ID t ABSTRACT t ID t HVS«FLHVSRU«PSRGHPVHUUDUDVRXDXVHQWHVHPćRUHVWDV secundárias. Nosso objetivo foi determinar o efeito da idade GDćRUHVWDVREUHDIRUPD©¥RGHUHFXUVRVHVVHQFLDLVSDUDD UHSURGX©¥RGHDYHVTXHH[LJHPFDYLGDGHVSDUDQLGLĆFD©¥R nas Reservas do Projeto Dinâmicas Biológicas de Fragmentos Florestais (PDBFF) próximo de Manaus(AM). Realizamos censos de cavidades e capturas de aves em 39 sitios. Utilizamos seleção de modelos para determinar a relação entre a idade GDćRUHVWDHRQ¼PHURGHFDYLGDGHVHRQ¼PHURGHDYHVQ¥R escavadora . Para avaliarmos as características das cavidades utilizamos análise multivariada. Observamos um aumento na GLVSRQLELOLGDGHGHFDYLGDGHVFRPD,GDGHGDćRUHVWDSRU«P DVćRUHVWDVVHFXQG£ULDVPDLVDQWLJDVaDQRVDLQGDQ¥R WLYHUDPRQ¼PHURGHFDYLGDGHVGDVćRUHVWDVSULP£ULDV$V características das cavidades foram menos variáveis em ćRUHVWDVVHFXQG£ULDVGRTXHQDVSULP£ULDV9HULĆFDPRVTXH o número de cavidades tem um efeito positivo sobre uma DEXQG¤QFLDGHDYHVQ¥RHVFDYDGRUDVQDVćRUHVWDVVHFXQG£ULDV $VVLPFRQFOX¯PRVTXHDVćRUHVWDVVHFXQG£ULDVFRPSHQVDP de forma parcial a perda de espécies. No entanto, mostramos que a abundância das cavidades é mais importante que a LGDGHGDćRUHVWDHPGHWHUPLQDUDDEXQG¤QFLDGHDYHVQ¥R escavadoras. Portanto, garantindo a presença desses recursos QDVćRUHVWDVVHFXQG£ULDVVHULDSRVV¯YHOWDPE«PJDUDQWLU uma comunidade mais diversa de aves que utilizam oco. 498 Bullying in the caatinga: mobbing Participation against Page 242, Posters ABSTRACT t Table of Contents Glaucidium brasilianumin the Northeastern Brazil Hevana S. Lima1*, Luciano Naka1, Flor Las-Casas1, Jonathan Ribeiro1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3 r,'=!2!9£-1!|+1!-£W$31 POSTER SESSION: BEHAVIOUR Mobbing is an anti-predatory behavior where potential preys exhibit audible and visual displays against a potential predator. This behavior has been described in different animal groups, including birds. Altruism, parental care and prey-predator communication are some of the hypotheses that explains this behavior. In the Neotropics, the Brazilian Pygmy-owl (Glaucidium brasilianum) is known as one of the most common mobbed predators. This study was conducted at the Chapada do Araripe, Ceará. Our main goals were to 1) characterize the assembly of birds that mob Glaucidium brasilianum; 2) assess if the number of individuals and the frequency of each species participating in the mobbing is related to their overall abundance in the studied area; and 3) assess if there is a phylogenetic effects behind species participation. We conducted 5-min playback experiments simulating the presence of G. brasilianum in 116 points, distributed through an area of ~1670ha. Each point was sampled twice (morning and afternoon). We recorded a total of 70 different bird species (of 6 orders and 22 families), which represents ~48% of all bird species recorded at this locality. The participation in the mobbing was not related to frequency and abundance in the area , Phaeomyias murina, Cyanoloxia brissoni and Tangara cayana were the most commonly attracted species, but, are not the most abundant birds species in the area. We found {փdփTT ID t ABSTRACT t a strong phylogenetic signal in the attraction to pygmy-owl song stimuli, as ~85% of the species recorded belong to the Passeriformes, and 24% belong to the family Tyrannidae. 499 Impacto de linha de transmissão de energia sobre a avifauna no sul do Brasil Jan Karel F. Mahler Jr.1*, Carla S. Fontana2, Marcio Repenning2, Cristiano E. Rovedder3 ǢW <2&!3 33#3;2-$!&3-38!2&'&3<£TǣWT ǤW'88!329<£;38-!1#-'2;!£;&!W r/!2f1!,£'8|(A#W89W+3=W#8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES No mundo, estima-se que a colisão com estruturas relacionadas à produção, transmissão e distribuição de energia impactem 1 bilhão de aves anualmente. Entre 2006 e 2009 e 2011 e 2012, foi realizado monitoramento mensal para avaliar o impacto de uma linha de transmissão (LT) sobre as aves e a HĆFL¬QFLDGHVLQDOL]DGRUHVQRVFDERVGD/7QRPXQLF¯SLRGH Osório, Rio Grande do Sul, Brasil. Foram registradas 171 aves de 33 espécies vítimas de colisão durante o monitoramento. Amazonetta brasiliensis, com 25 registros, Vanellus chilensis, com 23 registros, e Zenaida auriculata, com 21 registros, foram as espécies mais afetadas. A maioria das espécies registradas é comum na região de estudo e ocupam diferentes ambientes. Entretanto, espécies mais raras localmente e restritas a ambientes úmidos pontuais, como Phleocryptes melanops, foram impactadas eventualmente. Como o número de registros de aves obtido pode ser uma subestimativa do total efetivamente impactado, foi calculado um fator de correção a partir da taxa Page 243, Posters ID t ABSTRACT t Table of Contents de aves mortas não removidas por animais carniceiros (20%) e da taxa de aves detectadas pelo observador (70%). Com aplicação do fator de correção, o total de aves impactadas passa a ser de 1221,43 indivíduos. Considerando que 198,59 km foram percorridos durante o monitoramento, os valores de aves impactadas por quilômetro foram de 0,86 (valor bruto) e 7,14 (valor corrigido). Do total registrado, 97 aves (56,72%) foram encontradas em trechos de LT sinalizados e 74 (43,27%) em trechos não sinalizados, mostrando uma EDL[DHĆFL¬QFLDGRVVLQDOL]DGRUHVQDPLWLJD©¥RGRVLPSDFWRV 500 Returning home: movement strategies of Sub- $QGHDQELUGVLQDPRGLĆHGODQGVFDSH Carolina Montealegre-Talero1*, Marcela SuarezRubio2, Luis Miguel Renjifo1, Swen Renner3 ǢW32ধ)$-!2-='89-&!&!='8-!2!TǣW29ধ;<;'3( 33£[email protected]='89-;@3(!;<8!£ '93<8$'9!2&-('$-'2$'9TǤW1-;,932-!2329'8=!ধ32-3£[email protected]ধ;<;' r#-3$!83|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Forest patches in fragmented landscapes tend to be interspersed within an open-habitat matrix. The open KDELWDWLVW\SLFDOO\VLJQLĆFDQWO\GLIIHUHQWLQVWUXFWXUHDQG resources availability than forest habitat and therefore could disrupt movement. We documented movement for one individual of a long-distant migrant (Catharus ustulatus), one individual of Buarremon brunneinuchus and two individuals of Thripadectes virgaticeps, both understory resident species, in a fragmented landscape dominated by a pasture matrix in a Sub-Andean region of central Colombia. We {փdփTT ID t ABSTRACT t translocated the four individuals away from their captured sites in a landscape matrix consisting of pasture for cattle and isolated trees and tracked individuals returning to the FDSWXUHGORFDWLRQ&XVWXODWXVKDGQRGHWHFWDEOHGLIĆFXOWLHV traversing a pasture matrix and returning to the captured site. Understory resident species avoided making lengthy ćLJKWVDQGXVHGVWHSSLQJVWRQHVDQGQHDUE\FRUULGRUVWRHDVH their movement. Implementation of stepping stones like live fences and isolated trees and maintenance of corridors may contribute to the conservation of bird species by enhancing functional connectivity in regions with fragmented forests. 501 Maroon-fronted parrot (Rhynchopsitta terrisi) reproduction ID t ABSTRACT t Table of Contents Naturales Protegidas). The aim of this study was to evaluate its reproduction activities during 2011 and 2012. During three FRQVHFXWLYHGD\VRIHDFKZHHNHQGRI2FWREHUDQGWKHĆUVWRI 1RYHPEHUZHHYDOXDWHGWKHQXPEHURISDLUVDQGćHGJOLQJV production in three different nesting sites. Our results showed 38 and 26 pairs, 24 and 21 potentials nests, 8 and 6 nest, 14 DQGćHGOLQJVIRUDQGUHVSHFWLYHO\7KHUHZHUH DQGćHGJOLQJVSHUQHVWLQDQGUHVSHFWLYHO\ all of them observed in October, but not in November. The productivity between years was according to the reported in the literature. The evaluated nesting sites represent a good complement to the most important nesting site reported for the species in the Cumbres de Monterrey National Park. in the Cumbres de Monterrey National Park, Mexico Mauricio Cotera Correa1*, Laura Scott Morales1, Eduardo Estrada Castilln1, Jesus Castillo2 ǢW !$<£;!&&'-'2$-!9 38'9;!£'9T2-='89-&!&<;231!&'<'=3'2T ǣW31-9-32!$-32!£&'8'!9!;<8!£'983;'+-&!9T r1!<8-$-3i$3;'8!|@!,33W$31 POSTER SESSION: NESTING BIOLOGY & REPRODUCTION The Cumbres de Monterrey National Park avifauna include at least 206 species, some with conservation problems according to the Mexican law. One of them is the maroon-fronted parrot (Rhynchopsitta terrisi), the most representative and charismatic bird species of the park with no more 4,000 individuals. It is an endemic species to the pine forest of the Sierra Madre Oriental in northeast Mexico and is under endangered status according to the Mexican law (NOM-059-SEMARNAT-2010). Therefore the monitoring of its population is a priority by the National Protected Areas Commission (Comisión Nacional de Áreas Page 244, Posters 506 Sex-Ratio Deviation in Harpia harpyja Aureo Banhos1*, Renan Coser2, Tania M. Sanaiotti3, Francisca H. Aguiar-Silva4, Tomas Hrbek5, Izeni P. Farias5 ǢW'6!8;!1'2;3&'-3£3+-!T2-='89-&!&' '&'8!£&3968-;3!2;3T83+8!1!&' 329'8=!!3&3!=-3f8'!£TǣW83+8!1!&'Õ9f8!&<!%È3'1'2ধ$!329'8=!3 '-3£3+-!=3£<ধ=!T29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǤW29ধ;<;3 !$-32!£&''97<-9!9&!1!AÖ2-!T338&'2!3'1-3&-='89-&!&'T83+8!1!&' 329'8=!!3&3!=-3f8'!£TǥW83+8!1!&'Õ9f8!&<!%È3'1$3£3+-!T29ধ;<;3 !$-32!£&''97<-9!9&!1!AÖ2-!T83+8!1!&'329'8=!!3&3!=-3f8'!£TǦW !#38!;8-3&'=3£<3''2ধ$!2-1!£T2-='89-&!&' '&'8!£&31!A32!9 r!<8'3#9|+1!-£W$31 POSTER SESSION: BEHAVIOUR The sex-ratio is a parameter that expresses the proportion of male and female in a population. Deviation on these proportions may occur due to differential parental resource allocation towards one of the sex or to adult differential {փdփTT ID t ABSTRACT t mortality. Harpy Eagle (Harpia harpyja) presents sexual GLPRUSKLVPRQO\E\VL]HKRZHYHUWKLVLVGLIĆFXOWWRREVHUYH visually in chicks and shed feathers. We tested the sex ratio deviation from 1:1 using molecular markers for sex in three life phases: chicks in the nest (n=31), juvenile (n=29) and adults (n=33), using Chi square. DNA samples came from feather, blood and tissue from wild, hunted, rescued and collected individuals from several Brazilian forests. Chicks DQGDGXOWVSUHVHQWHGVLJQLĆFDQWVH[UDWLRGHYLDWLRQS with 1 male: 3.4 females and 1 male: 3.1 female, respectively. Juvenile presented fewer males than females, but differences ZHUHQRWVWDWLVWLFDOO\VLJQLĆFDQWS!7KHUHVXOWV indicate that sex-ratio varies slightly among lifestages, but keeps the same proportions among chicks and adults. This suggests an adaptive manipulation of the sex ratio. Financial support: CNPq, FBPN, Scott Neotropical Fund, FAPEAM, )$3(6DQGWKHSDUWQHUVKLS,13$)'%9$/(6$ 509 Phylogeography of Polioptila dumicola (Masked gnatcatcher) and P. plumbea (Tropical gnatcatcher) revealed paraphyly and a complex history Carina C. de M. Moura1*, Michael Wink1, Alexandre Aleixo2, Alexandre M. Fernandes3 ǢW'-&'£#'8+2-='89-;@TǣW<9'<!8!'29'1£-33'£&-T ǤW2-='89-&!&' '&'8!£<8!£&''82!1#<$3 ID t ABSTRACT t Table of Contents great similarity in species composition. It is believed that taxonomic similarity is due to Pleistocene climatic changes, assuming that the Amazon rainforest receded and became fragmented, facilitating biotic interchange during glacial periods. Here, we investigated the phylogeography of two closely related Neotropical bird species from open forest habitats, Polioptila dumicola and P. plumbea, to understand the KLVWRULFDOHYHQWVWKDWPLJKWKDYHGULYHQWKHGLYHUVLĆFDWLRQ of these species with disjunct distribution in open areas. We sequenced 1143 bp of the mitochondrial gene cytochrome b of 10 individuals of P. dumicola sampled in 7 localities (from Amazonas to Minas Gerais) and 19 of P. plumbea from 12 localities along northern and northeastern of Brazil (sampled in Piauí and Pará states). A striking result inferred from the Bayesian analysis was the observed paraphyly of P. plumbea populations from the caatinga dry forest with respect to the P. plumbea populations from Amazonia. Populations of P. plumbea from the state of Pará in the Amazonia group are sister to P. dumicola rather than populations of P. plumbea from the state of Piauí in the caatinga. The paraphyly of P. plumbea might be associated with events of dispersal, with later adaptation to a new habitat and differentiation. Additional samples, genes, and morphological analyses are being conducted and will provide further aspects on the evolution of these passerines from open vegetation in the Neotropics. r$!8-2!$!82'-83|@!,33W$31W#8 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS The Amazon rainforest is surrounded by two large areas of open vegetation. Between these two regions there is Page 245, Posters {փdփTT ID t ABSTRACT t 510 7KUHDWHQHGEXWFRPPRQVWDWXVRIćRRGHGIRUHVW specialized birds in the Rio Branco basin, Roraima, Brazil Thiago O. Laranjeiras1*, Alice Plaskievicz2, Marcela F. Torres3, Luciano N. Naka4 ǢW29ধ;<;3,-$3'2&'9&'329'8=!3&!-3&-='89-&!&'TǣW 832!;T2-='89-&!&' '&'8!£&'38!-1!TǤW29ধ;<;3!$-32!£&' '97<-9!9&!1!AÖ2-!TǥW2-='89-&!&' '&'8!£&''82!1#<$3 ID t ABSTRACT t Table of Contents spilogaster and Synallaxis kollari are restricted to the upper Rio Branco-Uraricuera, where the destruction of riverine forest already threatens their populations. We found that all those species remain relatively common in the region, but this may FKDQJHUDGLFDOO\LIWKHĆYHK\GURHOHFWULFGDPVSODQQHGIRU the basin are actually built. Estimates of habitat loss related to dams are essential for future conservation decisions. r;,-!+3W£!8!2/'-8!9|-$1#-3W+3=W#8 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Current Brazilian (ICMBio) and global (IUCN) red lists include $PD]RQLDQćRRGHGIRUHVWVSHFLDOL]HGELUGVXQGHUGLIIHUHQW levels of vulnerability), but data of their occupation and population are limited. Here we report on the distribution and status of 14 of these species, which we have found in the Rio Branco basin (Roraima, Brazil). We conducted 420 DYLDQVXUYH\VSRLQWFRXQWVLQORFDOLWLHVSRLQWV locality) distributed every 50 km, along the Uraricuera and Branco rivers, covering one of Amazonian’s largest rainfall gradients. Half the species were frequently found (>20% of points that included preferential habitat); and only Agamia agami, Zebrilus undulatus and Arremonops conirostris were poorly detected (<4 points). Pauxi tomentosa and the endemic Cercomacra carbonaria (one of the most detected, in 86 points) occurred throughout all localities. Neochen jubata and Stigmatura napensis also occurred widely throughout the river, in the few points (<20) that cover sandbar and sandbar scrub. Myrmotherula klagesi (the most detected, in 108 points), Myrmoborus lugubris, Thamnophilus nigrocinereus, Dendroplex kienerii and Conirostrum bicolor occurred exclusively in the lower Rio Branco, where human impacts are still few. Picumnus Page 246, Posters 512 Assimetria bilateral em Pinguins-de- Magalhães (Spheniscus magellanicus) Thaís Arruda Gonçalves 2-='89-&!&' '&'8!£&''82!1#<$3 ;!;!,!88<&!!|+1!-£W$31 A assimetria hemisférica do cérebro representa uma característica fundamental na organização e comportamento dos vertebrados, e pode ser detectada através das atividades motores. Neste trabalho buscamos analisar se existem diferenças VLJQLĆFDWLYDVQDODWHUDOLGDGHGRV3LQJXLQVGH0DJDOK¥HVS. magellanicus) através de observações comportamentais e morfológicas em indivíduos adultos. Este estudo foi realizado entre outubro de 2014 e fevereiro de 2015 em Punta Tombo, &KXEXW$UJHQWLQD(VSHFLĆFDPHQWHHVWXGDPRVSDU¤PHWros de lateralizacão: i) uso diferencial das asas (medido através do desgaste destas em 971 indivíduos); ii) preferência do lado do corpo atacado em brigas (medido em 227 indivíduos ensanguentados); iii) curvatura do esterno medido a partir de 60 ossos coletados ao longo de toda colônia); e iv) preferência na utilização dos membros posteriores para superar obstáculos DUWLĆFLDLVPHGLGRGXUDQWHDSDVVDJHPGHDQLPDLVVREUH {փdփTT ID t ABSTRACT t balanças colocadas na sua rota de passagem). Houve apenas XPDGLIHUHQ©DVLJQLĆFDWLYDQRSDU¤PHWURUHODFLRQDGR¢VOXWDV pinguins atacam preferencialmente o lado direito do corpo do inimigo. Esse comportamento agressivo pode ocorrer por disputas por melhor qualidade de ninho, melhores territórios, por fêmeas, entre outros. Estes resultados sugerem que embora não haja lateralidade em relação ao deslocamento, pode existir uma lateralidade no comportamento de S. magellanicus relacioQDGDFRPDFRPSHWL©¥RSRUI¬PHDVRXORFDLVGHQLGLĆFD©¥R 513 5HSHUWµULRYRFDOHYDULD©¥RJHRJU£ĆFDGH Myrmorchilus strigilatus(Aves: Thamnophilidae) Jonathas lins Souza1*, Luciano Nicolas Naka1 ID t ABSTRACT t Table of Contents (2 notas), longos (5-7 notas), e apelos (1 nota). Observações HPFDPSRVXJHUHPDSUHVHQ©DGHGLPRUĆVPRVH[XDOYRFDO pois apenas machos emitiram os cantos curtos e as fêmeas os cantos longos em resposta a vocalização do macho; ambos HPLWLUDPRDSHOR$DQ£OLVHGHYDULD©¥RJHRJU£ĆFDPRVWURX diferença nas populações relacionadas com a freqüência: as populações do Chaco tem freqüências mais baixas que as da Caatinga em praticamente todos os parâmetros. Uma análise de função discriminante apontou diferenças diagnosticáveis nas duas populações. Apesar das diferenças diagnosticáveis, HVWDVQ¥RVDWLVID]HPPHWRGRORJLDVUHFHQWHVSDUDGHĆQLUOLPLWHV de espécies (Isler et al., 1998, The Auk, Vol. 115). Trabalhos moleculares e morfológicos em andamento poderão ajudar a entender o grau de diferenciação destas duas populações. ǢW2-='89-&!&' '&'8!£<8!£&''82!1#<$3 r/32!;,!9i£-29|3-W$31W#8 POSTER SESSION: BIOACOUSTICS Populações de aves em alopatria podem desenvolver mecanismos de isolamento reprodutivo, sendo as vocalizações associadas ao desenvolvimento de barreiras pré-zigoticas. Myrmorchilus strigilatus«XPDHVS«FLHHQG¬PLFDGDVćRUHVWDV secas que apresenta duas subespécies alopátricas, uma na Caatinga (M. s. strigilatus), e outra no Chaco (M. s. suspicax). Neste estudo, descrevemos o repertório vocal de M. strigilatus SDUDYHULĆFDUDH[LVW¬QFLDGHGLIHUHQ©DVYRFDLVHQWUHDV populações. Para avaliar a existência de diferenças vocais entre as duas populações, utilizamos 55 gravações (29 da Caatinga e 26 do Chaco) obtidas em campo e arquivos acústicos, nas quais analisamos oito parâmetros vocais usando o Programa Raven 3UR,GHQWLĆFDPRVWU¬VWLSRVGHYRFDOL]D©·HVFDQWRVFXUWRV Page 247, Posters 516 ,QćX¬QFLDGRPDQHMRćRUHVWDOVREUHDDVVHPEOHLDGHDYHVHP uma área de Caatinga na Chapada do Araripe, Ceará, Brasil Jonathan R. Ribeiro1*, Flor M. G. Las-Casas1, Weber A. G. Silva2, Luciano N. Naka1 ǢW TǣW7<!9-9 r/32!;,!2W8!139|<(6'W#8 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES 2PDQHMRćRUHVWDOQD&DDWLQJDVXUJHFRPRDOWHUQDWLYDDRXVR não-sustentável da terra na região. Porém, pouco se sabe sobre RVLPSDFWRVGRPDQHMRQDVćRUHVWDVVHFDV2REMHWLYRGHVWH WUDEDOKRIRLDYDOLDURHIHLWRGRPDQHMRćRUHVWDOQD)D]HQGD3DX D’arco, localizada na APA da Chapada do Araripe, Ceará, Brasil, sobre a composição, riqueza e abundância da avifauna. Censos padronizados (pontos de escuta) com 5 minutos de duração {փdփTT ID t ABSTRACT t ID t ABSTRACT t Table of Contents foram realizados em 162 pontos, localizados sistematicamente 519 Untangling the phylogenetic relationships in a cada 250 m, cobrindo uma área de 1670 ha. Registramos the Neotropical becards (Pachyramphus) 103 espécies de aves e 7.340 indivíduos durante os censos. Lukas J. Musher1*, Joel Cracraft1 A riqueza de espécies e o número de indivíduos registrados ǢW1'8-$!2<9'<13(!;<8!£-9;[email protected]'6!8;1'2;3(82-;,3£[email protected] diferiram estatisticamente entre as áreas manejadas e não r£1<9,'8|!12,W38+ manejadas. Menos espécies e indivíduos foram registrados, POSTER SESSION: SYSTEMATICS & TAXONOMY em média, nos censos realizados em áreas manejadas. Esta The Neotropical genus, Pachyramphus, has perplexed diferença é ainda maior entre as espécies de aves dependentes systematists for decades, and current evidence places GHćRUHVWD$FRPSRVL©¥RGDDVVHPEOHLDGHDYHVWDPE«P them within Tityridae. Traditional molecular markers have diferiu entre a área manejada e a área controle. Analisando been unable to resolve phylogenetic relationships within uma crono-sequência de 10 anos de manejo, não observamos Pachyramphus, and species limits have not been evaluated uma tendência de recuperação da composição em relação with phylogeographic sampling. We are sequencing two as áreas controle. Analisando o efeito do manejo sobre a mitochondrial genes, cytB and ND2, as well as using target avifauna endêmica da Caatinga, vimos que este é espéciecapture and massively parallel sequencing technologies in order HVSHF¯ĆFRHQTXDQWRDOJXPDVHVS«FLHVHQG¬PLFDVFRPR to produce high-resolution phylogenetic hypotheses, document Thamnophilus capistratus ou Synallaxis hellmayri aumentam GLYHUVLW\DWDĆQHUVFDOHDQGGHWHUPLQHWKHELRJHRJUDSKLF sua ocorrência em áreas manejadas, outras como Sclerurus IDFWRUVWKDWFRQWULEXWHGWRGLYHUVLĆFDWLRQLQPachyramphus. cearensis e Hylopezus ochroleucus diminuem nestas áreas. Using preliminary data we computed a well-supported &RQFOX¯PRVTXHDVHVS«FLHVGHSHQGHQWHVGDćRUHVWDV¥R parsimony tree based on 34 Pachyramphus samples (including DIHWDGDVQHJDWLYDPHQWHSHORPDQHMRćRUHVWDOHTXHXPSHU¯RGR 12 species and 19 subspecies) of cytB. We found phylogenetic GHDQRVQ¥RSDUHFHVHUVXĆFLHQWHSDUDTXHDFRPSRVL©¥R structure at the species level mostly matches patterns seen da avifauna recupere sua estrutura e composição inicial. in previous studies, and this structure is fairly concordant with current taxonomy. However there is some potential paraphyly within the tree. Individuals of P. validus validus, P. polychopterus spixii and P. marginatus nanus do not cluster with other individuals assigned to those taxa. For example, there are two evolutionarily independent lineages of P. m. nanus from opposite sides of the Amazon River that show high genetic divergence and are non-monophyletic. Because two monotypic taxa, P. minor and P. marginatus nanus, are widespread Page 248, Posters {փdփTT ID t ABSTRACT t within Amazonia, additional sampling may show that these taxa actually represent multiple evolutionary lineages. 520 A taxonomic revision of Cyphorhinus thoracicusand Cyphorhinus phaeocephalusshows the underestimation of Cyphorhinusgenus diversity Fernanda Bocalini1*, Lus Fbio Silveira1 ǢW'3&'='9T<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3l m ID t ABSTRACT t Table of Contents thoracicus and C. dichrous). Vocal analysis was not informative to C. phaeocephalus complex, although it has showed great variability within C. thoracicus complex, the song of C. dichrous is a short set of haunting whistles while the song of C. thoracicus also includes trills and squeaks. These results together with Cyphorhinus arada revision show that the diversity of Cyphorhinus genus has always been underestimated; it has increased from 3 species to 14 after taxonomic revisions. r('('#3$!|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY Cyphorhinus thoracicus typically inhabits humid mountains forests discontinuously from the Colombian to the Peruvian Andes, mostly at elevations above 1,300 m, currently it comprises two subspecies: C. t. thoracicus and C. t. dichrous. Cyphorhinus phaeocephalus occurs from Central America (Honduras) to Colombia, inhabits humid lowlands forests, always below 700 m, and comprises six subspecies: C. p. richardsoni, C. p. infuscatus, C. p. lawrencii, C. p. propinquus, C. p. chocoanus and C. p. phaeocephalus. In both species-complexes no taxonomic revision has been done so far, despite the phenotypic variability detected. Here we revise the taxonomy of C. thoracicus and C. phaeocephalus based on morphological and vocal characters. A total of 90 specimens and 27 voice samples of C. phaeocephalus and 66 specimens and 40 voices samples of C. thoracicus were analyzed, including all forms and the entire distribution of the taxa. Our results of morphological analysis found diagnostic features that allowed us to propose recognition of eight valid taxa and we suggest treating them as full species (C. phaeocephalus, C. chocoanus, C. propinquus, C. lawrencii, C. infuscatus, C. richardsoni, C. Page 249, Posters 521 Relationship between the macrophyte cover and the aquatic bird distribution on Parque estadual do Rio Doce, Minas Gerais Pedro Henrique V.B.P. Silva1*, Rayana M. Souza1 ǢW2-='89-&!&' '&'8!£&'-2!9'8!-9 r6'&83,'28-7<'=#69-£=!|+1!-£W$31 POSTER SESSION: HABITAT USE The organization of aquatic bird communities is frequently related to environmental variables and biological factors. The presence of macrophytes determines a retention of OLPQLFRUJDQLVPVFORVHWRHGJHGHĆQLQJDUHJLRQZLWKODUJH amounts of biomass and high productivity. In lacustrine systems, aquatic birds have an important role in ecological processes such as nutrient cycling and other organisms’ biogeographical distribution as they transport them in many ways, as an example in the feathers. As so, our objective was to investigate the possible relationship between the macrophyte cover and the aquatic bird distribution on the Dom Helvécio lagoon, located at Parque estadual do Rio Doce, Minas Gerais. The data collection was done through {փdփTT ID t ABSTRACT t direct observation, with 10 minutes of observation on each spot, over the whole extension of the lagoon during 3 days. With a total of 40 sampling spots, in an effort of 6,7 hours of observation. The macrophyte cover was measured through FDWHJRUL]DWLRQE\SHUFHQWDJHRIFRYHULQĆYHFODVVHV1R VLJQLĆFDQWUHODWLRQVKLSEHWZHHQDTXDWLFELUGGLYHUVLW\DQG macrophyte cover was found at the studied lagoon. A total of 16 species of aquatic birds were observed throughout the lagoon, among these the more abundant were Crotophaga major and Egretta thula. While the rarest species were Rostrhamus sociabilis and Cairina moschata. In conclusion, it is necessary to add another strategy to measure the macrophyte coverage of the system and to add other environmental factors in the analysis such as edges average depth and seasonality. These measures will help to improve the analysis of this study. 523 Turdus serranus, T. fuscater y T. chihuanco, especies clave para la diseminación de Tripodanthus acutifoliusen Prunus serotinaen Cajamarca - Perú Manuel Salomn Roncal Ordoez1*, Manuel Roberto Roncal Rabanal1 ǢW2-='89-&!&!$-32!£&'!/!1!8$! r1!2<'£832$!£|<2$W'&<W6' POSTER SESSION: DIET & TROPHIC INTERACTIONS Prunus serotina Ehrhart ssp. capuli, es un árbol nativo y cultivado GHODćRUDSHUXDQDSURVSHUDHQORV$QGHVHQODYHUWLHQWH occidental entre 2 500 y 3 200 m de altitud (Calzada, 1980); protege el suelo agrícola y sirve como barrera viva, material de protección y confección de muebles, nutrición, además de tener propiedades medicinales. Este árbol muestra suceptibilidad a Tripodanthus acutifolius (Loranthaceae). Ensayos de germinación Page 250, Posters ID t ABSTRACT t Table of Contents de las semillas de T. acutifolius procedentes de las excretas de tres especies de zorzales del género Turdus, tuvieron un resultado de 100% de poder germinativo, a diferencia de las semillas que no pasaron por el tracto digestivo de las especies de Turdus, donde se registro el 0% de germinación de semillas. En el presente estudio, se determinó que Turdus serranus, T. fuscater y T. chihuanco, actúan como los principales agentes de diseminación de Tripodanthus acutifolius en cinco distritos de la región de Cajamarca en Perú que están causando un 61,8% de incidencia y un 30% de severidad patógena en 1627 plantas de Prunus serotina evaluadas. 524 Uso del hábitat rural fragmentado por el ensamble de aves del bosque templado de Sudamérica Silvina Ippi1*, Juan Luis Celis-Diez2, Daniel Salinas3, Mary Willson4, Juan J. Armesto5 ǢW'2;83'+-32!£2-='89-;!8-3!8-£3$,'T2-='89-&!&!$-32!£&'£ 31!,<'fT29ধ;<;3&'$3£[email protected]&-='89-&!&lmTǣW 9$<'£!&'+83231Ð!T32ধ)$-!2-='89-&!&!;£-$!&'!£6!8!Ð93TǤW <2&!$-2'2&!!8>-2TǥW <2&!$-2'2&!!8>-2TǦW6;3W&'$3£3+-! f2-='89-&!&!;£-$!&',-£'T29ধ;<;'3($3£[email protected]!2&-3&-='89-;@ r9-£=-66-|@!,33W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Los bosques templados del sur de Sudamérica se han visto H[SXHVWRVDXQDLQWHQVDPRGLĆFDFLµQGHOFDPELRGHXVRGHO suelo, producto de la actividad agropecuaria y forestal. Así, el paisaje rural actual está compuesto por fragmentos de bosques y matorrales inmersos en una matriz de praderas, tierras de FXOWLYR\SODQWDFLRQHVGHHXFDOLSWXV(VWDPRGLĆFDFLµQGU£VWLFD {փdփTT ID t ABSTRACT t ID t de la cobertura arbórea y de su continuidad ha afectado a la comunidad de aves de bosque. En este estudio, se evaluó cómo la composición de los distintos grupos funcionales de aves de bosque varía en tres hábitats (bosque, hábitat ribereño y matorral) que componen el paisaje rural del norte de la isla de Chiloé (Chile), y qué grado de similitud existe entre estos hábitats. Este estudio forma parte del monitoreo a largo plazo que se lleva a cabo en la Estación Biológica Senda Darwin (42°S) a partir del 2010. La riqueza total fue de 39 especies, incluyendo rapaces y aves acuáticas. Las especies más abundantes fueron Elaenia albiceps y Turdus falcklandii, ambos importantes dispersores de semillas, y Sephanoides sephaniodes, probablemente el principal polinizador. La ULTXH]DGHHVSHFLHVQRGLĆULµVLJQLĆFDWLYDPHQWHHQWUHORV hábitats, pero sí la abundancia, siendo ésta máxima en el hábitat ribereño. Los hábitats bosque y ribereño fueron más similares entre sí en cuanto a las especies dispersoras de semillas y polinizadores, mientras que las aves insectívoras usaron de forma más errática los hábitats muestreados. Nuestros resultados resaltan la importancia de los hábitats ribereños como corredores biológicos y hábitat para las aves en un paisaje rural dominado por praderas. 526 Record of Thrush-like Wren Campylorhynchus Page 251, Posters ABSTRACT t Table of Contents turdinus(Aves: Troglodytidae) for the state of Rio Grande do Sul, Southern Brazil Dilson Vargas-Peixoto1*, Mariane Bosholn2 ǢW2-='89-&!&' '&'8!£&'!2;!!8-!TǣW29ধ;<;3 !$-32!£&''97<-9!9&!1!AÖ2-! r--<2-i0!2;!£|+1!-£W$31 POSTER SESSION: SYSTEMATICS & TAXONOMY The Thrush-like Wren Campylorhynchus turdinus (Lafresnaye, 1846) is a species of Troglodytidae with distribution in Argentina, Bolivia, Colombia, Ecuador, Peru, Paraguay and Brazil. The only record in the extreme south of Brazil was held in the state of Paraná. However, after observing one individual in the wild, on April 26th, 2015, we report the ĆUVWUHFRUGVRIWKHCampylorhynchus turdinus unicolor for the state of Rio Grande do Sul, in the urban area of city of Santa Maria, southern Brazil. Therefore, we extended the known distribution range of the species, and establish a new southern limit for its geographic distribution. {փdփTT ID t ABSTRACT t 527 Comparação entre o comportamento reprodutivo do tangará-dançador, entre leques principais e secundários, ao longo dos meses Mariane Bosholn1)UDQFKHVFR'HOODćRUD2, Michele Brodt2, Nilton Cceres2 ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!T ǣW2-='89-&!&' '&'8!£&'!2;!!8-! r#39,3£2W1|+1!-£W$31 POSTER SESSION: BEHAVIOUR Machos do tangará-dançador Chiroxiphia caudata (Aves: Pipridae) se agregam em leques principais e secundários. Entretanto, não se sabe se há uma variação comportamental por parte dos machos, e se a preferência de fêmeas é afetada diferentemente entre leques principais e secundários. Como o período reprodutivo do tangará-dançador é longo, é possível que o comportamento de machos e fêmeas desta espécie também variem ao longo dos meses. Por isso, investigamos se a duração das exibições de treino, exibições de corte, e duração das visitas das fêmeas variam entre leques principais e secundários do tangará-dançador, e se estes comportamentos sofrem variação temporal. Para tanto, observamos o comportamento de machos e fêmeas em leques principais e secundários, ao longo de três estações reprodutivas. Embora as danças de treino dos machos de tangará-dançador tenham sido mais duradouras no leque secundário, o tempo de duração das danças de corte dos machos, assim como a duração das visitas de fêmeas foram similares em ambos os tipos de leque. Além disso, observamos que a duração das danças de treino e de corte não sofreram variação temporal, embora a duração das visitas das fêmeas tenha variado. Esses resultados Page 252, Posters ID t ABSTRACT t Table of Contents podem ter implicações sobre a evolução dos leques principais e secundários, o uso de leques secundários pode ser uma estratégia adotada por machos subordinados que tem pouca oportunidade de copular com as fêmeas nos leques principais. 528 Presença de moluscos na dieta de aves passeriformes em uma área de várzea Amazônica Gisiane Rodrigues Lima1*, Luciano Nicols Naka2, Thiago Mahlmann3, Mario Cohn-Haft3 ǢW2-='89-&!&' '&'8!£&31!A32!9TǣW2-='89-&!&' '&'8!£&' '82!1#<$3TǤW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-! r+-9-!2'W#-3£3+-!|+1!-£W$31 POSTER SESSION: BEHAVIOUR ,GHQWLĆFDURVLWHQVDOLPHQWDUHVGDVDYHV«IXQGDPHQWDOSDUD entender como são utilizados os recursos, as interações entre as espécies e como se estruturam dentro de comunidades. O HVWXGRGDGLHWDGHDYHVDLQGDSHUPLWHLGHQWLĆFDUHFRQKHFHU DVUHOD©·HVHFROµJLFDVĆVLROµJLFDVHFRPSRUWDPHQWDLV3RU«P existem lacunas sobre o conhecimento da dieta de aves Neotropicais, inclusive de aves passeriformes de ambientes de várzea. O objetivo do trabalho foi realizar uma análise do conteúdo estomacal de espécies de passeriformes pertencentes às comunidades de várzea coletadas ao longo do Rio Branco no Estado de Roraima, Brasil. Foram analisados, até o presente momento 123 estômagos de 81 espécies coletadas no baixo 5LR%UDQFR7RGRRFRQWH¼GRIRLWULDGRHLGHQWLĆFDGRTXDQWRDR tipo de dieta ou, quando possível, o menor nível taxonômico do espécime encontrado. O conteúdo estomacal de três indivíduos de famílias diferentes surpreendeu pela presença de espécimes GRĆOR0ROOXVFDQDGLHWD$VHVS«FLHVIRUDPMyrmotherula {փdփTT ID t ABSTRACT t assimilis (Thamnophilidae), associada a ambientes de várzea, apresentou três moluscos aquáticos semelhantes (Classe %LYDOYLDLGHQWLĆFDGRVHPQ¯YHOGHJ¬QHUREupera). Cranioleuca gutturata (Furnariidae) e Dendroplex picus (Dendrocolaptidae) apresentaram em sua dieta espécies de moluscos terrestres, HVWHVLGHQWLĆFDGRVDSHQDVHPQ¯YHOGHFODVVH*DVWURSRGD Assim, a presença de moluscos na dieta das aves levanta várias questões acerca da dieta das espécies da várzea Amazônica, o segundo maior tipo de habitat dentro do bioma. As aves poderiam estar em busca de cálcio ao ingerir moluscos na dieta ou estariam sendo simplesmente oportunistas? 530 (VS«FLHVHQG¬PLFDVH£UHDVSULRULW£ULDV para a conservação da Caatinga Daniele Mariz1*, Flávia Pinto2, Manuella Andrade Souza3, Helder Farias Pereira de Araujo4, Weber Andrade de Giro e Silva5, Luciano Nicolas Naka1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3f TǣW9$3£!!$-32!£&'3;2-$! 836-$!£fc2;W'97WU!#38!;8-3&'$3£3+-!96!$-!£'329'8=!3f cf-3£!83TǤWc-3TǥW2-='89-&!&' '&'8!£&!!8!Ð#!T ǦW7<!9-9l993$-!3&''97<-9!'329'8=!3&'$39-9;'1!97<ধ$39m r&!2-1!8-AW6'|+1!-£W$31 ID t ABSTRACT t Table of Contents GDGRVELEOLRJU£ĆFRVHSRQWRVGHRFRUU¬QFLDREWLGRVDSDUWLU GHHVS«FLPHVJUDYD©·HVHIRWRJUDĆDVJHRUHIHUHQFLDGDV Produzimos modelos de nicho ecológico no programa BioEnsembles para gerar modelos de consenso de vários algoritmos, utilizando variáveis bioclimáticas de Wordclim, e GHWRSRJUDĆD$£UHDFRQVLGHUDGDQDPRGHODJHPIRLGH NPDRUHGRUGROLPLWHRĆFLDOGD&DDWLQJDHVXDVHFRUUHJL·HV Foram listados 56 taxa (35 espécies e 21 sub-espécies) endêmicos, pertencentes a 7 Ordens e 22 Famílias. Segundo a mais recente lista de espécies ameaçadas do Brasil, 6 destas taxa estão em perigo de extinção, 5 são vulneráveis e 2 estão criticamente ameaçadas (uma delas, Cyanopsitta spixii, provavelmente extinta na natureza). Segundo os modelos, quatro ecorregiões da Caatinga concentram a maior quantidade de taxa endêmicos: a Depressão Sertaneja Setentrional e o Raso da Catarina (com 27 taxa endêmicos), e o Planalto da Borborema e a Depressão Sertaneja Meridional (26 taxa endêmicos). Estas áreas são importantes estrategicamente para a conservação da avifauna da Caatinga, entretanto, vêm sofrendo com a pressão de uso antrópico e abrangem poucas XQLGDGHVGHFRQVHUYD©¥RFRQĆUPDQGRDQHFHVVLGDGHGHD©·HV e políticas públicas para a preservação da biodiversidade local. POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION Espécies endêmicas possuem distribuições restritas e requerem atenção especial nas estratégias de conservação. A Caatinga apresenta um alto grau de endemismo, mas vem sofrendo um extenso processo de degradação ambiental. O objetivo deste trabalho é apresentar uma lista dos taxa de aves endêmicos da Caatinga, e determinar as áreas prioritárias para a sua conservação. Para determinar os taxa endêmicos, utilizamos Page 253, Posters {փdփTT ID t ABSTRACT t 531 Niche divergence in two alopatric populations of a Dry Forest avian specialist: the case of Myrmorchilus strigilatus(Thamnophilidae) in the Caatinga Lays V. Freitas1*, Mariana Jaramillo1, Jonathas Souza1, Luciano; Naka1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3 r£!!£'W(8'-;!9|+1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS No abstract available. 533 Uso de polígonos de distribuição para modelagens de nicho ecológico Lilia D. N. Santos1*, Mariana Jaramillo1 ǢW2-='89-&!&' '&'8!£&''82!1#<$3 r£-£-!2<2'9ǡǡǣ|,3;1!-£W$31 POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY & POPULATION GENETICS A modelagem de nicho ecológico (MNE) é uma ferramenta utilizada para avaliar a distribuição das espécies, e os fatores TXHLQćXHQFLDPVXDRFRUU¬QFLDQDSDLVDJHP1RHQWDQWR 01(SUHFLVDPGHSRQWRVGHRFRUU¬QFLDFRQĆUPDGRV normalmente obtidos de coleções zoológicas, literatura, e bancos de dados online. Dependendo da espécie em questão, o número de localidades pode ser reduzido, e não satisfazer os valores mínimos necessários para correr os MNE. Uma alternativa à coleta de dados reais é o uso de polígonos de distribuição disponíveis na literatura. Neste caso, pontos aleatórios são obtidos a partir dos polígonos. Nosso objetivo foi determinar se os MNE de pontos retirados aleatoriamente de Page 254, Posters ID t ABSTRACT t Table of Contents polígonos podem substituir MNE realizados com localidades FRQĆUPDGDV3DUDUHVSRQGHUHVWDSHUJXQWDXWLOL]DPRVGXDV espécies de aves Sittasomus griseicapillus e Xiphocolaptes falcirostris (família Dendrocolaptidae), cujas distribuições foram modeladas usando MaxEnt e variáveis climáticas na Caatinga. Os pontos de ocorrência dessas espécies foram obtidos a partir de bancos de dados, totalizando 574 e 91 pontos para as duas espécies, respectivamente. A partir dos polígonos publicados por Ridgely et al. (2005), extraímos 100 pontos aleatórios para cada espécie no ArcGIS, os quais foram utilizados para as MNE. Após as MNE, construímos mapas binários de probabilidade de ocorrência das espécies. Análises preliminares apontam que os MNE produzidos a partir de localidades aleatórias são semelhantes aos obtidos por localidades reais nas espécies testadas, sugerindo que estes possam estimar corretamente a ocorrência das HVS«FLHVHPORFDLVRQGHQ¥RK£UHJLVWURVFRQĆUPDGRV 535 Calidad del nectar de Hamelia patens(Rubiaceae) \VXUHODFLRQFRQORVYLVWDQWHVćRUDOHV Liliana Yisela Quispe Flores 2-='89-&!&!$-32!£+8!8-!!3£-2! @-9'£!7*38'9|+1!-£W$31 POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS /DVSODQWDVFRQćRUHVKDQGHVDUUROODGRGLYHUVDVHVWUDWHJLDV para atraer insectos y aves como agentes polinizadores, asegurando repetidas visitas que conduciran a la polinización. El objetivo fue determinar la relación entre la calidad de néctar y el número de visitas de las aves nectarívoras. Realicé {փdփTT ID t ABSTRACT t el estudio en febrero del 2014, en la Estación Biológica La Selva, Costa Rica, seleccionando cuatro arbustos de Hamelia SDWHQVFXEULHQGRODVLQćRUHVFHQFLDVFRQXQDWHODGHDSHUWXUD de maya de 0,1cm. La extracción del néctar se realizó con un tubo capilar de 10 µl y el porcentaje de sacarosa fue medido FRQXQUHIUDFWµPHWURHQFXDWURćRUHVSRUDUEXVWRGHVGH las 6 hasta las 16 horas. Hamelia patens fue visitada en 30 ocasiones por tres especies de aves, Amazilia tzacatl (83,3%), Cyanerpes lucidus (10%) y &RHUHEDćDYHROD (6,7%) un polinizador y dos robadores de néctar. Las visitas están relacionadas con el volumen de néctar (r=0.90, p< 0.0001) que se encuentren HQODVćRUHV\HOSRUFHQWDMHGHVDFDURVDWDPEL«QIDYRUHFHDO número de visitas (r=0.84, p=0.036). Todas las aves observadas fueron más activos durante las horas pico de la producción de néctar (6:00 ? 7:30 h) al llegar al medio día, decrece la actividad de las aves, cuando la producción del néctar disminuye. A diferencia de los robadores, Amazilia tzacatl fue observado en horas de la tarde, pero en menor frecuencia TXHHQODVPD³DQDVHQEXVFDGHćRUHVTXHQRIXHURQYLVLWDGDV durante el día y aprovechar a consumir el néctar restante. 539 Efeitos de borda, restrições geométricas e a diversidade GHDYHVHPUHPDQHVFHQWHVćRUHVWDLVGH0DWD$WO¤QWLFD Eduardo Cansi1*, Marcus Vieira1 ǢW2-='89-&!&' '&'8!£&3-3&'!2'-83l m r'&<!8&3W#-3£3+-!|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES ID t ABSTRACT t Table of Contents ćRUHVWDLVFRPFRQVHT¾¬QFLDVGHOHW«ULDVSDUDDPDLRU SDUWHGDELRWDćRUHVWDOQDWLYD$IUDJPHQWD©¥RH[S·HRV organismos que permanecem no fragmento a condições de um ecossistema diferente circundante, chamado de “efeito de borda”. O presente estudo objetiva estudar os efeitos de borda sobre padrões de riqueza e composição de aves em IUDJPHQWRVćRUHVWDLV$KLSµWHVHSULQFLSDOGHWUDEDOKR«TXH HVS«FLHVćRUHVWDLVVHU¥RPHQRVDEXQGDQWHVHPIUDJPHQWRV com mais efeito de borda, somando-se que existem espécies generalistas e de borda, que serão mais abundantes. Medidas de temperatura e umidade serão feitas da borda para o interior dos fragmentos para caracterizar aspectos abióticos do efeito de borda. Serão amostrados 20 fragmentos que YDULDPGHDKHFWDUHVORFDOL]DGRVDEDFLDKLGURJU£ĆFD do rio Macacu, nos municípios de Guapimirim e Cachoeiras de Macacu, no Estado do Rio de Janeiro. Para a amostragem das DYHVVHU¥RXWLOL]DGRVP«WRGRVGHSRQWRVĆ[RVDPRVWUDJHQV esporádicas e capturas em redes de neblina. O efeito das restrições geométricas, o Efeito de Borda Geométrico, será avaliado através de simulações para cada fragmento, utilizando estimativas de área de movimento para cada espécies baseadas na literatura ou medidas morfológicas. Os resultados preliminares deste estudo mostram uma ocupação de 86% GDVDYHVFRQFHQWUDGDQDSRU©¥RERUGDLQWHUWHUPHGL£ULDGR fragmento, tendo um domínio de Manacus manacus (Linnaeus, 1766) com 48%. Inferindo que o interior dos fragmentos GHPDWDDWO¤QWLFDQ¥RSRVVXHPHVS«FLHVćRUHVWDLV $IUDJPHQWD©¥RćRUHVWDO«DVXEVWLWXL©¥RGHJUDQGHV£UHDV GHćRUHVWDQDWLYDSRURXWURVHFRVVLVWHPDVGHL[DQGRPDQFKDV Page 255, Posters {փdփTT ID t ABSTRACT t 540 Strigiformes como potenciais reservatórios de EDFW«ULDVPXOWLUUHVLVWHQWHVGRJ¬QHUREnterococcus Andre Freitas1*, Jeferson Pires2, Daniel Neves3, L. M. Teixeira1 ǢW2-='89-&!&' '&'8!£&3-3&'!2'-83l mT ǣW2-='89-&!&'9;$-3&'TǤW ID t ABSTRACT t Table of Contents 10,8 %; cylA, 33,8%; gelE, 61,5%. A localização dos Strigiformes na cadeia alimentar alerta para a possibilidade de atuarem como reservatórios que propiciem a circulação ambiental de amostras de Enterococcus apresentando características similares àquelas encontradas no ambiente hospitalar. r!2&8'!!8(8'-;!9|,3;1!-£W$31 POSTER SESSION: PARASITISM & AVIAN DESEASES Os Enterococcus pertencem a microbiota de humanos e animais, embora alguns atuem como importantes patógenos responsáveis por infecções graves. Foram caracterizadas 65 amostras de Enterococcus isoladas das fezes de 27 Strigiformes, encaminhadas ao CETAS-RJ e a CRAS-UNESA. As amostras IRUDPLGHQWLĆFDGDVIHQRWLSLFDPHQWHHVXEPHWLGDVDWHVWHV de susceptibilidade a 18 antimicrobianos (disco- difusão). A SHVTXLVDGHJHQHVIRLUHDOL]DGDSRU3&5)RUDPLGHQWLĆFDGDV as espécies E. faecalis (66,1%); E. hirae (18,5%); E. faecium (9,2%); E. gallinarum (3,1%) e E. avium (3,1%). Os percentuais de Q¥RVXVFHSWLELOLGDGHIRUDPDPSLFLOLQDFLSURćR[DFLQD FORUDQIHQLFROHQURćR[DFLQDHULWURPLFLQD 56,9%; estreptomicina, 10,8%; fosfomicina, 3,1%; gentamicina, OHYRćR[DFLQDOLQH]ROLGDQLWURIXUDQWR¯QD QRUćR[DFLQDSHQLFLOLQDTXLQXSULVWLQD dalfopristina, 7,7%; rifampicina, 60%; tetraciclina, 23,1% e vancomicina, 7,7%. A multirresistência (? 3 antimicrobianos) foi observada em 27,7% das amostras. Os genes detectados entre as amostras não suscetíveis foram: tet(M), 100%; tet(L), 33,3%; aph(2’)-Id, 75%; aph(3’)-IIIa, 75%; ant(6?)-Ia, 71,4%; ant(9?)-Ib, 14,3%; vat(D), 40% das amostras não-E. faecalis; erm(B), 21,6% e mef(A), 13,5%. Foram observados os genes de virulência ace, 64,6%; aggA, 41,5%; asa1, 56,9%; efaA, 66,1%; eeP, 61,5%; esp, Page 256, Posters 544 Monitoramento populacional de espécies de DYHVHQG¬PLFDVHDPHD©DGDVGHH[WLQ©¥RGR cerrado no Triângulo Mineiro (MG) G. A. Ferreira1*, L. P. M. Paniago1, E. H. M. Campos1, C. Melo1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r+-!2#-3<(<|+1!-£W$31 POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES Conhecer os requerimentos ecológicos de uma espécie é pré-requisito para que estratégias de conservação tenham sucesso, especialmente nos trópicos, onde as alterações antrópicas vêm reduzindo diversos habitats naturais e a falta GRFRQKHFLPHQWRELROµJLFRGRVRUJDQLVPRVGLĆFXOWDPDLQGD mais a conservação efetiva das espécies. Assim o objetivo deste estudo foi monitorar populações de espécies de aves endêmicas do Cerrado (Melanopareia torquata e Saltaricula atricollis) e ameaçadas de extinção (Culicivora caudacuta, Alectrurus tricolor e Coryphaspiza melanotis) que utilizam áreas de cerrado sensu stricto e campestres, determinando locais estratégicos na conservação destas, na fazenda Nova Monte Carmelo, Triângulo Mineiro, Minas Gerais, Brasil. O estudo foi realizado em áreas de cerrado sensu stricto e áreas campestres, HQWUHDJRVWRHMDQHLUR)RUDPIHLWRVUHJLVWURV de cinco espécies, sendo elas C. caudacuta (N=124), A. tricolor (N=32) e C. melanotis (N=12), todas ameaçadas de extinção, {փdփTT ID t ABSTRACT t FODVVLĆFDGRVFRPRYXOQHU£YHOGHDFRUGRFRPD,8&1HGXDV endêmicas, M. torquata (N=15) e S. atricollis (N=2). Do total de registros, 180 foram de adultos e cinco de jovens, sendo quatro de A. tricolor, registrados em dezembro e janeiro e um de C. melanotis, registrado em janeiro. A princípio observa-se que as áreas de estudo podem desempenhar papel importante na reprodução de algumas espécies de aves ameaçadas de extinção como C. caudacuta e A. tricolor. Além disso, este estudo torna-se fundamental no âmbito conservacionista dessas espécies em relação à sua conservação dentro da área de estudo. Apoio: Empresa DURATEX S.A e FAPEMIG. 548 Efeito da estrutura do habitat urbano e da perturbação humana sobre a avifauna Renata R. Leal-Marques1*, Liliane Martins-Oliveira1, Carlos Henrique Nunes1, Alexandre Gabriel Franchin1, Oswaldo Maral Junior1 ǢW2-='89-&!&' '&'8!£&'#'8£Æ2&-! r8'2!;!#-3<(<|+1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Atualmente, paisagens urbanas devem ser consideradas para a conservação da biodiversidade. Nossas hipóteses são que praças com maior área e arborização e menor perturbação humana apresentarão maior riqueza de aves e que as variáveis associadas a essas características determinarão a composição e as atividades de forrageamento e reprodução das aves. Objetivou avaliar a relação entre a estrutura de hábitat com a riqueza, composição e comportamento da avifauna em praças S¼EOLFDVGH8EHUO¤QGLD0*)RUDPLQYHVWLJDGDVSUD©DVGH março a novembro de 2009, totalizando 412h. Foi realizada Page 257, Posters ID t ABSTRACT t Table of Contents caminhada em zig-zag, na qual toda praça era percorrida e inspecionada com varredura detalhada e considerados apenas registros visuais. Foram feitas medidas de estrutura do hábitat e utilizadas regressão linear múltipla e NM-MDS para análises. Foram registradas 121 espécies, sendo as mais abundantes: Zenaida auriculata, Passer domesticus e Patagioenas picazuro. A riqueza de aves correlacionou positivamente com: número de espécies e de indivíduos de plantas (> 6m); proporção de cobertura arbórea no entorno; distâncias ao remanescente de vegetação nativa e ao centro da cidade e negativamente com o número de pedestres. As aves utilizaram as praças especialmente para abrigo, alimentação e reprodução. A composição da avifauna e as atividades de forrageamento e de reprodução foram relacionadas às características da vegetação (riqueza, abundância e altura das plantas). Concluise que o número de espécies e indivíduos de plantas e a complexidade da vegetação em praças são fatores da estrutura de hábitat essenciais para a riqueza, composição e manutenção da avifauna no meio urbano. Agradecimento: Fapemig. 552 Blood parasites, ectoparasites, and stress response in birds of ecuadorian dry forests in relation to habitat disturbance Gustavo Tomás1*, Leonardo Ordóñez1, Carlos I. Espinosa1 ǢW2-='89-&!&Ì$2-$!!8ধ$<£!8&'3/!lm r+;31!9|''A!W$9-$W'9 POSTER SESSION: PARASITISM & AVIAN DESEASES Richness of parasite community is a key indicator of conservation status of an ecosystem. Several studies have pointed out variations in parasite community in relation to {փdփTT ID t ABSTRACT t ID t habitat disturbance. In general, those ecosystems in better conservation state can allow the existence of a more diverse parasite community than more degraded ecosystems, though contradictory results have been found. We are exploring the effect of habitat disturbance on the parasite community of birds living in dry forests of south-west Ecuador, comparing three levels of disturbance (degraded forest, semidegraded forest, and conserved forest). We are evaluating abundance and prevalence of ectoparasites and blood parasites, and also the level of physiological stress response as measured with stress protein levels or HSPs. Moreover, we are exploring the possible relationship between ectoparasite and blood parasite loads and physiological stress levels in birds. We are sampling birds with mist nets in several plots representative of the different disturbance levels. We are collecting ectoparasite samples, and a blood simple to determine prevalence and intensity of infection by blood parasites by means of both microscopy and molecular techniques. We are also estimating stress protein levels from blood samples of birds by means of Western-blot. We present preliminary results describing incidence of several blood parasites and ectoparasites in the different bird species sampled. 555 8UXEXVGRVJ¬QHURVCoragyps e Cathartes Page 258, Posters ABSTRACT t Table of Contents PRUWRVSRUDWURSHODPHQWRHPWU¬V£UHDV da Caatinga, Rio Grande do Norte H. Oliveira1*, N. N. Rosa1, C. Calabuig1 ǢW2-='89-&!&' '&'8!£<8!£&3'1-f8-&3 r,<+2'-&'93<A!|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES Por serem indivíduos necrófagos, os urubus são observados ao longo das estradas a procura de carcaças, apesar disso, há poucos estudos sobre atropelamentos de urubus. Este estudo foi realizado entre setembro de 2013 e março GHFRPRREMHWLYRGHLGHQWLĆFDUHFROHWDUPHGLGDV morfométricas de espécimes de urubus atropelados em estradas circundantes a três Unidades de Conservação Federais no bioma Caatinga. Foram registrados 58 espécimes de urubu, desses, 53 Coragyps atratus (urubu-de-cabeçaSUHWDFRPXPDWD[DGHPRUWDOLGDGHGHLQGNPGLD e cinco do gênero CathartesFRPLQGNPGLD'HQWUR do gênero CathartesIRLLGHQWLĆFDGRXPFRPRC. burrovianus (urubu-de-cabeça-amarela) e um C. aura (urubu-de-cabeçavermelha). A morfometria foi realizada em 27 indivíduos de C. atratus, com escala em milímetros e apresentaram médias de 106,7 para o comprimento cabeça ponta do bico (CPB), 55,3 cúlmem total (CT), 42,9 narina ponta do bico (NP), 22,7 altura do bico (BA), 18,3 largura do bico (BL), 77,3 tarso (T), 169,2 cauda (C) e 402,9 asa (A). O gênero Cathartes sp. apresentou médias de 93,1 CPB, 48,4 CT, 34,3 NP, 30,0 BA, 18,0 BL, 65,5 T, 237 C e 453,2 A. Os gêneros são facilmente distinguidos morfologicamente (e.g. formato e coloração da {փdփTT ID t ABSTRACT t cabeça, primarias da asa diferentes). No presente estudo, a maior mortalidade ocorreu em C. atratus para todas as áreas do estudo e o gênero Cathartes foi registrado em duas áreas. Durante os monitoramentos, a espécie mais avistada se alimentando de animais atropelados foi C. atratus que costuma andar em bandos ao contrário dos do gênero Cathartes. Isso explicaria a maior mortalidade dessa espécie. 556 Estudo preliminar sobre a dieta alimentar de Crotophaga ani (Aves: Cuculidae) oriundos de atropelamentos em duas regiões da Caatinga, RN H. Oliveira1*, V. Morlanes1, B. K. A. Silva1, A. G. Lima1, M. S. Godoy1, C. Calabuig1 ǢW2-='89-&!&' '&'8!£<8!£&3'1-f8-&3 ID t ABSTRACT t Table of Contents observado. A ordem Araneae apresentou 40%, Coleoptera 80%, Hemiptera 80%, Hetenonemiidae 20%, Hymenoptera 20%, Lepidoptera 60%, Mantodea 20%, Orthoptera 100%; ovos de origem insecta 20% e material de origem vegetal 20%. A dieta analisada e pertencente à região da FLONA de Assú apresentou baixa diversidade de itens pertencentes apenas às ordens Lepidoptera, Orthoptera, Hemiptera e Coleóptera. As dietas da região da ESEC do Seridó apresentaram maior diversidade com a presença de todas as ordens citadas. Estes dados são interessantes quando comparados a outros estudos para essa espécie já que não foram encontrados vertebrados (e.i., anfíbios, cobras ou lagartos). Apesar de dados preliminares, a diferença existente entre a diversidade alimentar entre as duas áreas estudadas pode estar relacionada com a disponibilidade de recursos alimentares. r,<+2'-&'93<A!|,3;1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS A dieta alimentar em aves pode variar de acordo com o ambiente onde está inserida e a sua posição na cadeia WUµĆFD(VWHWUDEDOKRWHYHFRPRREMHWLYRFRQKHFHUDGLHWD alimentar do Anu-preto (Crotophaga ani) através de cinco conteúdos estomacais coletados entre março a agosto de 2014 oriundos de atropelamentos em estradas circundantes a duas Unidades de Conservação Federal no bioma Caatinga. A triagem do conteúdo alimentar foi feita com lupas (x1.6) HORJRFRQVHUYDGRHP£OFRRO$LGHQWLĆFD©¥RGRVLWHQV alimentares ocorreu em nível de ordem e, quando possível, de espécie, com ajuda de chaves taxonômicas. Para todos os conteúdos foi obtido o peso úmido em balança analítica de 0.0001g de precisão. A frequência de ocorrência foi calculada como a proporção de moelas em que determinado item foi Page 259, Posters 566 Reprodução cooperativa e cuidado parental de Gubernatrix cristata, no Brasil Andr Pereira1*, Christian Beier1, Mrcio Repenning1, Carla S. Fontana1 ǢW!#38!;8-3&'82-;3£3+-!T<9'<&'-Í2$-!9''$23£3+-!&! 32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£ r!2&8'W6'8'-8!Wǡǡǣ|!$!&W6<$89W#8 POSTER SESSION: BEHAVIOUR OO cardeal-amarelo (Gubernatrix cristata) ocorre no Uruguai, centro da Argentina e extremo sul do Brasil, e está ameaçado em toda sua distribuição. Reprodução cooperativa não era descrita para a espécie. Nosso objetivo é investigar o cuidado parental e avaliar o papel de machos, fêmeas e ajudantes no cuidado de ninhegos. Monitoramos três ninhos no Parque Estadual do Espinilho, Barra do Quaraí, Rio Grande do Sul, {փdփTT ID t ABSTRACT t ID t GHDDWUDY«VGHĆOPDJHQVWRWDOL]DQGRK GHREVHUYD©¥R&ODVVLĆFDPRVRSHU¯RGRGHQLQKHJRVHP IDVHLQLFLDO) GLDVHĆQDO) GLDVSDUDPHGLU a frequência de visitação (FV) em diferentes estágios de desenvolvimento da ninhada. Para medir a contribuição de cada indivíduo no cuidado parental utilizamos Wilcoxon signed-rank. A FV realizada comparando F1 e F2 de machos, I¬PHDVHDMXGDQWHVDXPHQWRXVHPGLIHUHQ©DVVLJQLĆFDWLYDV3" 0,05). Comparando a FV de machos em relação às fêmeas (z = 1,014; P = 0,155), assim como fêmeas em relação a ajudantes (z = 1,60; P = 0,054), também não apresentaram diferença VLJQLĆFDWLYDQD)(QWUHWDQWRKRXYHGLIHUHQ©DVLJQLĆFDWLYD na FV de machos e ajudantes (z = 2,497; P = 0,006) na F1. 1D)KRXYHGLIHUHQ©DVVLJQLĆFDWLYDVQD)9SDUDPDFKRVH fêmeas (z = 2,157; P = 0,014); fêmeas e ajudantes (z = 2,366; P=0,009) e machos e ajudantes (z = 1,825; P = 0,033). Esses resultados parciais indicam que machos, fêmeas e ajudantes aumenta a frequência de visitação (cuidado parental) de forma similar durante o desenvolvimento dos ninhegos. Porém o cuidado parental de machos e femêas foi superior em relação aos ajudantes ao longo do período de ninhegos. 567 Descrição da vocalização de Melanopareia torquata Page 260, Posters ABSTRACT t Table of Contents bitorquata (D Orbigny & Lafresnaye, 1837) em Vila Bela da Santíssima Trindade, Mato Grosso, Brasil Cintia O. M. Palhares1*, Leonardo E. Lopes1 ǢW2-='89-&!&' '&'8!£&'-39!f!16<9 £38'9;!£ r$-2ধ!W1'2'9'9|<(=W#8 POSTER SESSION: BIOACOUSTICS A bioacústica tem se mostrado útil em estudos taxonômicos sobre Passeriformes Suboscines. Estudos preliminares sobre a taxonomia de Melanopareia torquata (Wied, 1830) a partir de caracteres morfológicos externos sugeriram elevar a subespécie M. t. bitorquata ao status de espécie independente, com distribuição restrita aos campos do leste da Bolívia e sudoeste do Brasil. Este estudo objetiva descrever a estrutura de vocalização de longo alcance de M. t. bitorquata, fornecendo subsídios para investigações taxonômicas futuras. Os registros sonoros analisados (n = 11) foram obtidos em dezembro de 2009 e novembro de 2014 no município de Vila Bela da Santíssima Trindade, Mato Grosso. Para isso foi utilizado o software Raven Pro 1.5, para mensuração das variáveis: duração (ms), energia (dB), frequência máxima (Hz) das notas; intervalo entre notas e entre séries (ms); frequência do primeiro harmônico (Hz) e número de notas por série. O canto apresentou estrutura harmônica, sendo possível visualizar até sete harmônicos nas gravações de melhor qualidade. O harmônico de maior energia foi o primeiro (frequência média de 2,587 kHz ±0,128; n=304), seguido pelo TXLQWR9HULĆFRXVHPRGXOD©¥RGHVFHQGHQWHHPDW« Hz no primeiro harmônico de algumas notas. Houve variação expressiva nos valores de intervalo entre séries (867,41 ms {փdփTT ID t ABSTRACT t ±1222,49; n=78; CV=104,9%) e número de notas por série (2,81 notas ±1,76; n=68; CV=62,5%). Os resultados sugerem que a duração e frequência das notas, bem como valores de energia e frequência dos harmônicos, podem ser medidas de interesse na comparação com as demais subespécies, tendo potencial para compor um estudo taxonômico do grupo. 586 Itens alimentares de Formicariidae, Scleruridae e Dendrocolaptidae, Donacobiidae, Polioptilidae, Turdidae, Mimidae e Motacillidae (Aves: Passeriformes) Leila Santos Belini1*, Thais G. Marcon1, Thaynara C. dos S. Rocha Rocha1, Sergio R. Posso1 ǢW r£'-£!#'£-2-|,3;1!-£W$31 POSTER SESSION: DIET & TROPHIC INTERACTIONS O cerrado é um bioma dominado por formações vegetacionais abertas ou campestres e possui 837 espécies de aves sendo 22 endêmicas. Entretanto não há uma base de consulta sobre os itens alimentares consumidos pelas aves neste bioma. 7DOEDVHIRUQHFHLQIRUPD©·HVVREUHDHVWUXWXUDWUµĆFDGD comunidade avifauna e suas interações com os demais táxons no cerrado. O presente trabalho tem como objetivo descrever o itens alimentares das famílias Formicariidae, Sclecuridae e Dendrocolaptidae, Donacobiidae, Polioptilidae, Turdidae, Mimidae, Motacillidae e do cerrado brasileiro através de UHYLV¥RELEOLRJU£ĆFD7DOUHYLV¥RIRLUHDOL]DGDFRPDX[¯OLR do google scolar e consideradas dentro de uma categoria alimentar aquelas espécies cuja literatura concorda em pelo menos 75% das citações, caso contrário foram consideradas onívoras. Em Dendrocolaptidae 26,08% são onívoros Page 261, Posters ID t ABSTRACT t Table of Contents (Dendrocincla fuliginosa, Sittasomus griseicapillus, Xyphorhynchus picus, X. guttatus, Glyphorhynchus spirurus e Campylorhamphus trochilirostris) e 73,91% insetívoras. As espécies das famílias Formicariidae, Scleruridae, Donacobiidae (Donacobius atricapilla), Polioptilidae (Ramphocaenus melanurus, Polioptila plumbea e P. dumicola) e Motacillidae (Anthus lutescens) são consideradas insetívoras. Todas as espécies do cerrado de Mimidae (Mimus gilvus, M. saturninus e M. triurus) e Turdidae (n = 11) são consideradas onívoras pela literatura. Não foram encontrados estudos dos itens alimentares de Xyphorhynchus elegans, Dendrocincla pallescens e Anthus hellmayri, indicando a prioridade deste tipo de estudo nestas espécies. 588 Reproductive Success and Survival of Tyrannus melancholicus (Vieillot, 1819) (Aves: Tyrannidae) in a Area of Restinga in Southeastern Brazil Hermes Daros1*, Charles Duca1 ǢW2-='89-&!&'-£!'£,!lm r&!839W,'81'9|,3;1!-£W$31 POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY (VWLPDWHVRISRSXODWLRQSDUDPHWHUVLVWKHĆUVWVWHSWR understand population dynamics. This study analyzed Tyrannus melancholicus demographic attributes in a protected area of Southeast Brazil, evaluating breeding success, causes of nest loss, survivorship, fecundity and population growth rate. We found twenty-four nests that were checked in intervals of 2-3 days. Of them, 31.5% were successful, 1.9% was abandoned and 66.7% were predated. Therefore, predation was the main cause of nest loss. Daily survival rate (DSR) of the nests was 0.96 d-1, with a breeding success of 30.9% {փdփTT ID t ABSTRACT t being these values considered high when compared with other studies of neotropical passerines. The annual survival rate was 0.51 y-1, considered low for neotropical birds. The fecundity was m = 0.33. With high breeding rates and low survival, it is likely that the population of T. melancholicus is sensitive to variations in fecundity. Four models used to estimate population growth suggest different results: r = -0.159 (stable), or ranging between 0.555 and 0.684 GHFOLQLQJ6KRZLQJQRYLVLEOHSRSXODWLRQGHFOLQHWKURXJKĆHOG observations over the years, it is possible that other variables LQćXHQFHWKLVG\QDPLF$SODXVLEOHK\SRWKHVLVLVWKDWXUEDQ populations with high population growth are cushioning the decline of the reserve’s population through emigration. 590 Composição e riqueza de aves sobre efeito de borda em remanescentes de Mata Atlântica Eduardo Cansi1*, Marcus Vieira1 ǢW2-='89-&!&' '&'8!£&3-3&'!2'-83 r'&<!8&3W#-3£3+-!|,3;1!-£W$31 POSTER SESSION: ECOLOGY & CONSERVATION IN HUMAN MODIFIED LANDSCAPES $IUDJPHQWD©¥RćRUHVWDOHXPDVXEVWLWXL©¥RGHJUDQGHV £UHDVGHćRUHVWDQDWLYDSRURXWURVHFRVVLVWHPDVćRUHVWDLV deixando manchas, com consequências deletérias para uma PDLRUSDUWHGDELRWDćRUHVWDOQDWLYD$IUDJPHQWD©¥RH[S·H os organismos que permanecem no fragmento à condições de um ecossistema diferente circundante, chamado de “efeito de borda”. O presente estudo objetivou estudar os efeitos GHERUGDFDXVDGRVHPDYHVHPIUDJPHQWRVćRUHVWDLVVH fragmentos com maior efeito de borda teriam menor riqueza Page 262, Posters ID t ABSTRACT t Table of Contents e equitabilidade de aves. Avaliando se as espécies de aves ćRUHVWDLVVHOHFLRQDPRVGLIHUHQWHVHOHPHQWRVGHSDLVDJHQV fragmentadas, de acordo com a disponibilidade ou em função do efeito de borda existente em 15 fragmentos que variam de 50 a 225 hectares, nos municípios de Guapimirim e Cachoeiras de Macacu, no estado do Rio de Janeiro. A hipótese principal GHWUDEDOKRIRLTXHHVS«FLHVćRUHVWDLVV¥RPHQRVDEXQGDQWHV em fragmentos com maior efeito de borda, somando-se que existem espécies generalistas e de borda, que seriam mais abundantes. Para a amostragem das aves, foram utilizados métodos de capturas de aves através de redes de neblina, procurando avaliar o efeito de borda geométrico. Os resultados preliminares deste estudo mostram uma ocupação de 86% GDVDYHVFRQFHQWUDGDQDSRUF¥RERUGDLQWHUWHUPHGL£ULDGR fragmento, testadas através de um modelo não-paramétrico, o teste de Kruskal-Wallis ANOVA, sendo o p <0,05. Inferindo que o interior dos fragmentos de mata atlântica não possuem espécies especialistas, e sim generalistas. Ou ainda, que fragmentos de mata atlântica possuem uma borda mais atrativa. 601 Distribuição de aves frugívoras e nectarívoras em XPDćRUHVWDXUEDQDQDFLGDGHGH0DQDXV Welliton Martins1*, Urnia C. Ferreira1 ǢW2-='89-&!&' '&'8!£&31!A32!9 r>'££-;321!8ধ29Ǥǣ|,3;1!-£W$31 POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION A distribuição dos organismos no espaço está geralmente relacionada a distribuição dos recursos alimentares. Nosso REMHWLYRIRLYHULĆFDUDGLVWULEXL©¥RGDGLYHUVLGDGHHDEXQG¤QFLD {փdփTT ID t ABSTRACT t ID t ABSTRACT t Table of Contents de espécies de aves pertencentes a dois grupos funcionais (frugívoros e nectarívoros) com relação a áreas ripárias e não ULS£ULDVHPXPDćRUHVWDXUEDQDQDFLGDGHGH0DQDXV1RVVD hipótese foi que áreas ripárias seriam mais produtivas ao oferecerem água e nutrientes de forma mais constante para plantas que oferecem recursos para estas aves. Portanto esperávamos uma maior abundância e riqueza de espécies destes grupos funcionais nas zonas ripárias que nas não ripárias. Para a amostragem da avifauna, utilizamos redes de neblina dispostas em 10 transectos de 120 m cada, em zonas ripárias, e 10 em zonas não ripárias. No total capturamos 10 espécies do interesse desse estudo, sendo seis espécies frugívoras e quatro espécies nectarívoras. Observamos que não houve diferença entre as zonas ripárias e não ripárias com relação ao número de indivíduos capturados tanto para frugívoros como nectarívoros. No entanto, quando YHULĆFDPRVDGLYHUVLGDGHPHGLGDSHOR¯QGLFHGH6LPSVRQ separadamente para cada grupo, encontramos diferenças entre áreas ripárias e não ripárias. Portanto, este estudo PRVWUDTXHQRIUDJPHQWRćRUHVWDOGD8QLYHUVLGDGH)HGHUDO do Amazonas há diferença quanto à diversidade de aves frugívoras e nectarívoras entre as zonas riparias e não riparias. Page 263, Posters {փdփTT
Documentos relacionados
BOLETÍN DE EL IUCN/ BIRDLIFE/ WPA GRUPO ESPECIALISTAS
Piping-guan (Pipile jacutinga) was not recorded at any of these sites, and the population
within San Rafael must at best be small and fragmented. Consequently, the only large
forest block in
Paragu...
abstract book cover.psd
European Atlas, and the Global Biodiversity Information Facility (GBIF). Databases were homogenised, deleting all
information except species names and coordinates, projected to the sa...
programa herpetologia 2010 final mod 2.indd
se están produciendo afectan de forma determinante a anfibios y reptiles poniendo en grave
peligro su conservación, por lo que este Congreso tiene un especial interés en debatir como
anfibios y rep...