Diapositivos-Aulas 6 e 7-Aminoácidos, péptidos e proteínas (cont.)

LICENCIATURA EM BIOLOGIA
DISCIPLINA
BIOQUÍMICA
Ano Lectivo de 2013/2014
Aula nº 6
28 FEV
Ricardo Boavida Ferreira
Laboratório 46
Aminoácidos, péptidos e proteínas (cont.)
Proteínas: introdução. Breve referência às –Ómicas. Propriedades. Funções. Síntese e
processamento.
Níveis de estrutura das proteínas: estruturas de nível primário, secundário, terciário e
quaternário. Estrutura supersecundária e domínios de estrutura. Níveis de estrutura
supramoleculares: complexos multienzimáticos, ribossomas e unidades do
citosqueleto. Desnaturação, agentes desnaturantes e enrolamento espontâneo de
proteínas. Chaperones moleculares. Engenharia de proteínas.
Material de estudo: diapositivos das aulas, bibliografia recomendada e textos de apoio.
POLIPÉPTIDOS
E
PROTEÍNAS
Polipéptidos
Definição
É um polímero de aminoácidos, sintetizado ou não na dependência da informação genética (isto é, em
mono ou polissomas), ligados sequencialmente (isto é, cabeça-com-pés, ou grupo carboxilo  grupo
amina) uns aos outros por ligações peptídicas.
Proteínas
Definição
São polímeros, constituídos por uma ou mais cadeias polipeptídicas, sintetizados nos complexos mRNAribossoma (isto é, em mono ou polissomas).
Polipéptidos e outras associações de aminoácidos, quer naturais quer artificiais, que são sintetizados na
ausência de ribossomas e sem o envolvimento directo de informação genética não são considerados
proteínas.
A palavra proteína tem a sua origem na palavra Grega Protos = Primeiro, realçando o papel que
desempenham em todas as células vivas.
Sendo polímeros de aminoácidos, são constituídas por C, H, O e N, podendo ou não conter quantidades
variáveis de S, P e metais (ex: Zn, Cu, Fe, Mn, Mg, etc.).
Apresentam massas moleculares que podem variar desde cerca de 5 kDa a mais de 2 MDa.
A massa molecular de polipéptidos e proteínas é normalmente expressa em kDa
Um polipéptido é um polímero de aminoácidos ligados uns aos outros por ligações peptídicas. Pode ser sintetizado
quimicamente ou com base na informação genética, isto é, em mono ou polissomas.
Uma proteína é um polímero ou mais de aminoácidos, sintetizado na dependência da informação genética, isto é, em
mono ou polissomas. Assim, uma proteína pode ser constituída por um ou mais polipéptidos.
A distinção entre oligopéptido e proteína depende do seu DP (grau de polimerização, do Inglês Degree of
Polymerization). Considera-se proteína um polímero contendo uma massa molecular geralmente superior a cerca de 5
kDa, o que corresponde aproximadamente a 45 resíduos de aminoácidos.
A insulina, por exemplo, é uma pequena proteína constituída por 51 resíduos de aminoácidos, com uma massa
molecular de 5,8 kDa:
Microfotografia de microscópio electrónico de transmissão do
proteassoma da planta aquática lentilha de água menor (Lemna minor)
É uma proteína com uma massa molecular de 700 kDa e um tamanho de cerca de 2 nm (500.000
vezes mais pequena que 1 mm). Em baixo está representado um esquema da sua estrutura.
Funções e variabilidade.
Como é que uma só classe química de compostos, as proteínas, basicamente constituídas
por sequências diferentes do mesmo conjunto de 20 aminoácidos diferentes, pode
desempenhar tantas e tão diversas funções como
Grau de polimerização r:
20r = ~101,30r
A rough estimate indicates that a cell from the bacterium Escherichia coli has
about 5,000 different proteins.
The human genome:
24,000 genes corresponding to 1.8% of our DNA
(it is not understood why nature is so inefficient)
The human body contains ~150 different cell types
Human cells contains 7,000 to 8,000 different gene products
(exceptions are brain and testes cells, which express 12,000 to 14,000 different
gene products)
Different protein molecules, alternative splicing and co- and post-translational
modifications increase these numbers by several orders of magnitude.
Questão:
Se o genoma humano contém cerca de 24.000 genes, como pode o corpo humano ser
composto por cerca de 106 proteínas diferentes?
A rough estimate indicates that a cell from the bacterium Escherichia coli has
about 5,000 different proteins.
The human genome:
24,000 genes corresponding to 1.8% of our DNA
(it is not understood why nature is so inefficient)
The human body contains ~150 different cell types
Human cells contains 7,000 to 8,000 different gene products
(exceptions are brain and testes cells, which express 12,000 to 14,000 different
gene products)
Different protein molecules, alternative splicing and co- and post-translational
modifications increase these numbers by several orders of magnitude.
Questão:
Se o genoma humano contém cerca de 24.000 genes, como pode o corpo humano ser
composto por cerca de 106 proteínas diferentes?
- Modificações pós-tradução das proteínas;
- Splicing alternativo.
The -Omics
O genoma é a sequência completa de DNA de um organismo.
Trata-se de um conceito estático ou dinâmico?
A palavra genoma foi formada por analogia com cromossoma, a qual deriva das palavras Gregas
cor + corpo (na realidade, se esta palavra tivesse sido bem formado, teria sido cromatossoma).
Devido ao enorme sucesso dos projectos biológicos quantitativos de larga escala, tais como a
sequenciação de genomas, o sufixo “-oma” tem sido utilizado num número crescente de outros
contextos.
A genómica é o estudo das funções e interacções dos genes de um genoma.
First time in
PubMed
Temos, assim:
gene
genoma
genómica
1932
proteína
proteoma
proteómica
1995
Proteínas libertadas
para o exterior da
célula
secretoma
secretómica
2000
lectina
lectinoma
lectinómica
transcrito
transcritoma
transcritómica
1997
metabolito
metaboloma
metabolómica
1998
interacção de
proteínas
interactoma
interactómica
1999
hidrato de carbono
glicoma
glicómica
1999
Oligossacáridos da
face externa da
membrana celular
exoglicoma
exoglicómica
O transcritoma é o conjunto total de todos os mRNAs da célula que são transcritos
sob uma determinada condição fisiológica e ambiental, tendo em consideração a
abundância de cada um e, idealmente, incorporando os resultados do “splicing”.
Trata-se de um conceito estático ou dinâmico?
O proteoma, é o conjunto de proteínas expressas por um determinado tipo de célula,
tecido, orgão or organismo, num dado estado fisiológico.
O termo proteoma deriva de proteína e de genoma.
Não toma, também, em consideração a abundância de cada uma.
Trata-se de um conceito estático ou dinâmico?
O translatoma é o conjunto total das proteínas da célula expressas num dado
momento, tendo em consideração a abundância de cada uma.
O metaboloma refere-se ao conjunto completo de metabolitos (sejam eles
metabolitos primários ? ou metabolitos secundários ?, intermediários de vias
metabólicas, hormonas ou outras moléculas envolvidas em processos de sinalização)
que se encontram numa amostra biológica, como, por exemplo, um organismo.
Trata-se de um conceito estático ou dinâmico?
Metabolómica / metabonómica
-Omes and -omics glossary & taxonomy
Site: http://www.genomicglossaries.com/content/omes.asp
Any active interaction between cells or
between a molecule and a cell will
result in an “–omics” alteration
- Genomics;
- Transcriptomics;
- Proteomics;
- Interactomics;
- Lectinomics;
- Metabolomics/Metabonomics;
- Glycomics;
- Exoglycomics.
EM image of active protein synthesis in a polysome
“Degrees of Freedom” for Protein Variability
Covalent Modifications in Proteins
• Post-translational modifications (e.g., phosphorylation, glycosylation, etc.)
- more than 200 such modifications are known, and
they can occur at multiple sites in a single protein
• Alternative splicing of a primary transcript
- in extreme cases, a single gene can produce
tens of thousands of different mRNAs!
• Proteolytic processing
• Protein aging
Thus, there are probably many millions
of different proteins in our bodies!!
More Reality for Proteins
• They have “personalities”: each behaves differently
• They exist in different concentrations, ranging over a
million-fold
• It will be extremely difficult to even identify them all
(see previous slide)
Take-home message:
Proteomics presents challenges that are
orders-of-magnitude more difficult
than those presented by genomics!
Síntese de proteínas
O processamento ocorre após a tradução, ao nível do
- Aminoacil-tRNA,
- Cadeia polipeptídica nascente,
- Cadeia polipeptídica completa,
- Proteína.
Determinação do “ribosome loading”
7-day-old Arabidopsis seedlings:
Non-stress (NS)/hypoxia stress (HS)
treatments (12 h).
Tipos de processamento. Exemplos:
- Enrolamento espontâneo da cadeia polipeptídica, a associação de cadeias polipeptídicas entre si e/ou
com ligandos, para originar a conformação tridimensional nativa da proteína;
- A modificação covalente dos aminoácidos proteicos, catalisada ou não por enzimas, para originar os
aminoácidos raros das proteínas;
- A ligação covalente de estruturas não proteicas, como hidratos de carbono (glicoproteínas), lípidos
(lipoproteínas), ácidos nucleicos (nucleoproteínas), grupos heme (hemoproteínas), etc.
- A hidrólise da pró-sequência, por proteólise limitada;
Zimogénios; ex: proteases do aparelho digestivo: tripsinogénio/tripsina,
,
pepsinogénio/pepsina, quimotripsinogénipo/quimotripsina.
- A hidrólise da pré-sequência ou sequência sinal, por proteólise limitada.
The beauty of
protein structure
Normal prion (PrPC)
43% α-helix
Abnormal, diseasecausing prion (PrPSc)
30% α-helix, 43% β-sheet
“Lifeless" prion proteins, devoid of all genetic material, can evolve just like higher forms
of life. Prions can change to suit their environment and go on to develop drug resistance.
Jiali Li, Shawn Browning, Sukhvir P. Mahal, Anja M. Oelschlegel & Charles Weissmann (2010) Darwinian
Evolution of Prions in Cell Culture. Science 327, 869-872. doi: 10.1126/science.1183218
Blad-153
Blad-169
Aparece truncada no resíduo Asn171
Blad-173
Blad-185
Hierarquias no estudo da estrutura das proteínas
Dada a grande complexidade estrutural das moléculas proteicas, é frequente
Considerar quatro níveis básicos na estrutura das proteínas:
- Estrutura de nível primário;
- Estrutura de nível secundário;
- Estrutura de nível terciário;
- Estrutura de nível quaternário.
Como níveis de estrutura intermédios temos:
- A estrutura de nível supersecundário;
- Os domínios de estrutura.
Acima da estrutura de nível quaternário podem considerar-se
níveis de organização supramolecular como:
- Complexos multienzimáticos;
- Ribossomas
- Elementos do citoesqueleto; ex. microtúbulos.
Classificação das proteínas quanto à sua estrutura:
- Fibrosas
- Forma normalmente alongada
- Funções típicas: estruturais e de suporte
- Estrutura nativa conseguida essencialmente à custa das estruturas de nível primário e
secundário.
- Exemplos: colagénio, fibroína, elastina, queratinas
- Globulares
- Forma normalmente globular compacta
- Funções típicas: funções biologicamente activas – enzimas, anticorpos, hormonas
polipeptídicas
- Estrutura nativa conseguida à custa das estruturas de nível primário, secundário,
terciário e, por vezes, quaternário.
- Exemplos: álcool desidrogenase, hemoglobina, insulina
Estrutura de nível primário
É definida pela sequência de resíduos de aminoácidos da cadeia polipeptídica.
Esta sequência é, pelo menos em parte*, geneticamente determinada, pois está codificada no respetivo gene.
Forças contribuintes: ligações covalentes.
Qual o papel destas forças contribuintes a nível da
- Aquisição deste nível de estrutura;
- Estabilização e manutenção deste nível de estrutura?
*Ter em atenção fatores como o alternative splicing e o processamento.
Composição:
- Esqueleto central da cadeia polipeptídica, com os seus grupos C=O e N-H, capazes de
estabelecerem ligações de hidrogénio entre si, com moléculas de água do meio circundante ou
com cadeias laterais de resíduos de aminoácidos.
- Cadeias laterais de resíduos de aminoácidos, que podem ser apolares, polares e desprovidas
de carga eléctrica ou com carga eléctrica positiva ou negativa. Podem, por isso, participar no
estabelecimento de ligações persulfureto, de hidrogénio, electrostáticas, de Van der Waals ou
em interacções hidrofóbicas, quer entre si, com moléculas de água ou com outras moléculas.
Exemplos:
Estrutura de nível primário da
ribonuclease bovina
The 51-residue polypeptide hormone insulin,
which consists of two polypeptide chains joined
by two disulfide bonds, is derived from a singlechain, 84-residue precursor named proinsulin.
Proinsuline undergoes processing by limited
proteolysis. However, only after its disulfide
bonds have formed is proinsulin converted to
the two chained active hormone by the specific
proteolytic excision of an internal 33-residue
segment known as its C chain. The C chain
does not direct the folding of the A and B
chains but rather, simply holds them together
while they form their native disulfide bonds.
Blad, a multifunctional, fungiphobic analeptic polypeptide from
germinating Lupinus cotyledons
1
2
Sequência
resíduos
aminoácidos
Blad
Sequência
de resíduos
de aminoácidos
do precursor
da3 β–conglutina
Sequência
dede
resíduos
dede
aminoácidos
dada
PROBLAD
5´MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEWQPRRQRPQSRRE
MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEWQ
5´
MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEWQ
PRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREERE
EREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYSRRQRNPYHFSSQR
PRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREERE
QEQQQGSPSYSRRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNR
FQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLNGRA
QEQQQGSPSYSRRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNR
LENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLNGRATITIVNPDRRQAY
TITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTK
LENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLNGRATITIVNPDRRQAY
5´RRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEF
NLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTK
DQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQDEGVIVIVSKKQI
NLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTK
QSKPNTLILPKHSDADYVLVVLNGRATITIVNPDRRQAYNLEYGDALRIPA
DQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQ
QKLTKHAQSSSGKDKPSDSGPFNLRNEPIYSNKYGNFYEITPDRNPQVQDLNISLTYIKINEG
DQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQ
GSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTKDQQSYFSGFSR
DEGVIVIVSKKQIQKLTKHAQSSSGKDKPSDSGPFNLRNEPIYSNKYGNF
ALLLPHYNSKAIYVVVVDEGEGNYELVGIRDQQRQQDEQEEKEEEVIRYSARLSEGDIFVIPA
DEGVIVIVSKKQIQKLTKHAQSSSGKDKPSDSGPFNLRNEPIYSNKYGNF
NTLEATFNTRYEEIQRIILGNED
3´
YEITPDRNPQVQDLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYEL
GYPISINASSNLRLLGFGINADENQRNFLAGSKDNVIRQLDRAVNELTFPGSAEDIERLIKNQ
YEITPDRNPQVQDLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYEL
VGIRDQQRQQDEQEEKEEEVIRYSARLSEGDIFVIPAGYPISINASSNLRLL
QQSYFANGQPQQQQQQQSEKEGRRGRRGSSLPF
3´
VGIRDQQRQQDEQEEKEEEVIRYSARLSEGDIFVIPAGYPISINASSNLRLL
GFGINADENQRNFLAGSKDNVIRQLDRAVNELTFPGSAEDIERLIKNQQQ
GFGINADENQRNFLAGSKDNVIRQLDRAVNELTFPGSAEDIERLIKNQQQ
SYFANGQPQQQQQQQSEKEGRRGRRGSSLPF 3´
3´
SYFANGQPQQQQQQQSEKEGRRGRRGSSLPF
3 Ferreira, R.B., Monteiro, S., Loureiro, V. e Teixeira, A (2005) Proteína extraída de plantas do género
1 Monteiro, S.A., Freitas, R.M., Teixeira, A.N. E Ferreira, R.B. (2003) Lupinus albus β-conglutin precursor
2 Monteiro,
Lupinus, sequência
nucleotídica
que a A.N.
codifica
e sua utilização
no combate
a fungos
patogénicos
por
S.A., Freitas,
R.M., Teixeira,
e Ferreira,
R.B. (2006)
Stable protein
intermediary
of Lupinus
mRNA. 1791 nucleótidos. Accession no. AY500372, GenBank.
aplicação
directa
na forma
ou por
em
plantas no.
transgénicas.
I.N.P.I.,
albus
β-conglutin
catabolism
withrecombinante
defense properties.
519expressão
nucleótidos.
Accession
DQ142920, GenBank.
http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=46451222
submissão nº 103322 F.
Estrutura de nível secundário
É difinida pela regularidade espacial de sequências de resíduos de aminoácidos.
Forças contribuintes: ligações de hidrogénio, interacções electrostáticas e forças
de Van der Waals
Qual o papel de cada uma das forças contribuintes a nível da
- Aquisição deste nível de estrutura;
- Estabilização e manutenção deste nível de estrutura?
Exemplos:
Hélices
Helices are the most striking elements of protein 2° structure. If a polypeptide chain is twisted by the same amount
about each of its C atoms, it assumes a helical conformation.
A helix may be characterized by the number, n, of amino acid units per helical turn and by its pitch, p, the distance
the helix rises along its axis per turn. Several examples of he!ices are diagrammed below. Note that a helix has
chip
Examples of helices. These
provide definitions of the helical
pitch, p, the number of
repeating units per turn, n, and
the helical rise per repeating
unit, d = p/n. Right- and lefthanded helices are defined,
respectively, as having positive
and negative values of n. For n
= 2, the helix degenerates to a
nonchiral ribbon. For p = 0, the
helix degenerates to a closed
ring.
Note that a helix has chirality; that is, it may be either right handed or left handed (a right-handed helix turns
in the direction that the fingers of a right hand curl when its thumb points along the helix axis in the direction
that the helix rises). In proteins, moreover, n need not be an integer and, in fact, rarely is.
If a particular conformation is to have more than a transient existence, it must be more than just allowed, it
must be stabilized. The "glue“ that holds polypeptide helices and other 2° structures together is, in part,
hydrogen bonds.
A hélice α
Can a polypeptide chain fold into a regularly repeating structure? To answer
this question, Linus Pauling and Robert Corey evaluated a variety of
potential polypeptide conformations by building precise molecular models of
them. They adhered closely to the experimentally observed bond angles and
distances for amino acids and small peptides.
In 1951, they proposed two periodic polypeptide structures, called the α helix
and β pleated sheet. The α helix is a rodlike structure. The tightly coiled
polypeptide main chain forms the inner part of the rod, and the side chains
extend outward in a helical array. The α helix is stabilized by hydrogen bonds
between the NH and CO groups of the main chain. The CO group of each
amino acid is hydrogen bonded to the NH group of the amino acid that is
situated four residues ahead in the linear sequence:
Models of a right-handed α helix: (A) only the α-carbon atoms are shown on a helical thread; (B) only
the backbone nitrogen (N), α-carbon (C,,), and carbonyl carbon (C) atoms are shown; (C) entire helix.
Hydrogen bonds (denoted in part C by ... in red) between NH and CO groups stabilize the helix.
The right-handed
α helix.
Hydrogen bonds
between the N-H
groups and the
C=O groups that
are four residues
back along the
polypeptide chain
are indicated by
dashed lines.
Stereo, space-filling representation of an α-helical segment of
sperm whale myoglobin (its E helix), as determined by X-ray
crystal structure analysis. In the main chain, carbon atoms are
green, nitrogen atoms are blue, oxygen atoms are red, and
hydrogen atoms are white. The side chains are yellow.
All the main-chain CO and NH groups are hydrogen bonded. Each residue is related to the next one by a
translation of 1.5 Å along the helix axis and a rotation of 100°, which gives 3.6 amino acid residues per turn
of helix. Thus, amino acids spaced three and four apart in the linear sequence are spatially quite close to
one another in an α helix. In contrast, amino acids two apart in the linear sequence are situated on opposite
sides of the helix and so are unlikely to make contact. The pitch of the α helix is 5.4 Å, the product of the
translation (1.5 Å) and the number of residues per turn (3.6). The screw-sense of a helix can be right-handed
(clockwise) or left-handed (counterclockwise); the α helices found in proteins are right-handed.
Only one helical polypeptide conformation has a favorable hydrogen bonding pattern: the α helix, a
particularly rigid arrangement of the polypeptide chain. Its discovery through model building, by Pauling in
1951, ranks as one of the landmarks of structural biochemistry.
For a polypeptide made from L-α-amino acid residues, the α helix is right handed with n = 3.6
residues per turn, and a pitch of 5.4 Å. An a helix of D-α-amino acid residues is the mirror image of that
made from L-amino acid residues: It is left handed with n = -3.6 but with the same value of p. The hydrogen
bonds of an α helix are arranged such that the peptide N - H bond of the nth residue points along the helix
toward the peptide C=O group of the (n - 4)th residue. This results in a strong hydrogen bond that has the
nearly optimum N ... O distance of 2.8 Å. In addition, the core of the α helix is tightly packed; that is, its
atoms are in van der Waals contact across the helix, thereby maximizing their association energies. The R
groups, whose positions all project backward and outward from the helix so as to avoid steric interference
with the polypeptide backbone and with each other. Indeed, a major reason why the left-handed α helix has
never been observed (its helical parameters are but mildly forbidden) is that its side chains contact its
polypeptide backbone too closely. Note, however, that 1 to 2% of the individual non-Gly residues in proteins
assume this conformation.
The α helix is a common secondary structural element of both fibrous and globular proteins. In globular
proteins, α helices have an average span of ~12 residues, which corresponds to over three helical turns and
a length of 18 Å. However, α helices with as many as 53 residues have been found.
Nota: a hélice α é direita quando, vista de cima, desce no sentido dos ponteiros do relógio.
The α-helix content of proteins of known three-dimensional structure is highly variable. In some, such as
myoglobin and hemoglobin, the α helix is the major structural motif. Other proteins, such as the digestive
enzyme chymotrypsin, are virtually devoid of α helix. The single-stranded α helix discussed above is usually
a rather short rod, typically less than 40 Å in length. A variation of the α-helical theme is used to construct
much longer rods, extending to 1000 Å or more. Two or more α helices can entwine around each other to
form a cable. Such α-helical coiled coils are found in several proteins: keratin in hair, myosin and
tropomyosin in muscle, epidermin in skin, and fibrin in blood clots. The helical cables in these proteins serve
a mechanical role in forming stiff bundles of fibers.
The structure of the α helix was deduced by Pauling and Corey six years before it was actually to be seen in
the x-ray reconstruction of the structure of myoglobin. The elucidation of the structure of the α helix is a
landmark in molecular biology because it demonstrated that the conformation of a polypeptide chain can be
predicted if the properties if its components are rigorously and precisely known.
- O dipolo da hélice α
- A formação da hélice α é um processo cooperativo
- Hélices α anti-congelantes
Other Polypeptide Helices
Helix types and notations
The hydrogen bonding
pattern of several
polypeptide helices. In
the cases shown, the
polypeptide chain is
helically wound such
that the N-H group on
residue n forms a
hydrogen bond with the
C=O groups on residues
n-2, n-3, n-4, or n-5.
This figure shows how hydrogen bonded polypeptide helices may be constructed. The first two, the 2.27
ribbon and the 310 helix, are described by the notation, nm, where n, as before, is the number of residues
per helical turn and m is the number of atoms, including H, in the ring that is closed by the hydrogen bond.
With this notation, an α helix is a 3.613 helix.
Comparison of the two polypeptide helices that occasionally occur in proteins with the commonly occurring
α helix. (a) The 310 helix, which has 3.0 peptide units per turn and a pitch of 6.0 Å, making it thinner and
more elongated than the α helix. (b) The α helix, which has 3.6 peptide units per turn and a pitch of 5.4 Å.
(c) The π helix, which has 4.4 peptide units per turn and a pitch of 5.2 Å, making it wider and shorter than
the α helix. The peptide planes are indicated.
The right-handed 310 helix, which has a pitch of 6.0 Å, is thinner and rises more steeply than does the α
helix. Its R groups experience some steric interference and this explains why the 310 helix is only
occasionally observed in proteins, and then mostly in short segments that are frequently distorted from the
ideal 310 conformation. The 310 helix most often occurs as a single-turn transition between one end of an α
helix and the adjoining portion of a polypeptide chain.
The π helix (4.416 helix), which also has a mildly forbidden conformation, has only rarely been observed and
then only as segments of longer helices. This is probably because its comparatively wide and flat
conformation results in an axial hole that is too small to admit water molecules but too wide to allow van der
Waals associations across the helix axis; this greatly reduces its stability relative to more closely packed
conformations.
The 2.27 ribbon has strongly forbidden conformation angles and has never been observed.
A folha pregueada β
In 1951, L. Pauling and R. Corey discovered another periodic structural motif, which they named the β
pleated sheet (β because it was the second structure they elucidated, the α helix having been the first). The β
pleated sheet differs markedly from the α helix in that it is a sheet rather than a rod. The polypeptide chain in
the β pleated sheet is almost fully extended, rather than being tightly coiled as in the α helix.
The axial distance between adjacent amino acids is 3.5 Å, in contrast with 1.5 Å for the α helix.
Another difference is that the β pleated sheet is stabilized by hydrogen bonds between NH and CO groups in
different sections of the same or belonging to different polypeptide chains, whereas in the α helix the
hydrogen bonds are between NH and CO groups in the same polypeptide chain. Adjacent strands in a β
pleated sheet can run in the same direction (parallel β sheet) or in opposite directions (antiparallel β
sheet). For example, silk fibroin consists almost entirely of stacks of antiparallel β sheets. Such β sheet
regions are a recurring structural motif in many proteins. Structural units comprising from two to five parallel
or antiparallel β strands are especially common.
Folding patterns;
Beta-pleated sheet
β Pleated sheets. Hydrogen bonds are indicated by dashed lines and
side chains are omitted for clarity. (a) The antiparallel β pleated sheet.
(b) The parallel β pleated sheet.
Nonrepetitive Structures
Regular secondary structures (helices and β sheets) comprise around half of the average globular protein. The
protein's remaining polypeptide segments are said to have a coil or loop conformation. That is not to say,
however, that these nonrepetitive secondary structures are any less ordered than are helices or β sheets; they are
simply irregular and hence more difficult to describe. One should therefore not confuse the term coil conformation
with the term random coil, which refers to the totally disordered and rapidly fluctuating set of conformations
assumed by denatured proteins and other polymers in solution.
Globular proteins consist largely of approximately straight runs of secondary structure joined by stretches of
polypeptide that abruptly change direction. Such reverse turns or β bends (so named because they often connect
successive strands of antiparallel β sheets) almost always occur at protein surfaces; indeed, they partialIy define
these surfaces. Most reverse turns involve four successive amino acid residues more or less arranged in one of
two ways, Type I and Type II, that differ by a 1800 flip of the peptide unit linking residues 2 and 3. Both types of β
bends contain a hydrogen bond, although deviations from these ideal conformations often disrupt this hydrogen
bond. Type I β bends may be considered to be distorted sections of 310 helix. In Type II β bends, the oxygen atom
of residue 2 crowds the Cβ atom of residue 3, which is therefore usualIy Gly. Residue 2 of either type of β bend is
often Pro since it can facilely assume the required conformation.
Reverse turns in polypeptide chains. (a) A
Type I β bend. (b) A Type II β bend.
Variations from these ideal conformation
angles by as much as 300 are common.
Hydrogen bonds are represented by
dashed lines.
Estrutura de nível terciário
É difinida pelos enrolamentos e dobras da cadeia polipeptídica já com a estrutura de nível secundário,
resultando das interacções das cadeias laterais dos resíduos de aminoácidos entre si e com as moléculas
do meio circundante.
No caso de muitas proteínas, pode dizer-se que é geneticamente determinada, pois depende directamente
da estrutura de nível primário.
Forças contribuintes:
- Ligações de persulfureto (ligações covalentes);
- Ligações de hidrogénio;
- Interacções electrostáticas;
- Interacções hidrofóbicas;
- Forças de Van der Waals.
Qual o papel de cada uma das forças contribuintes a nível da
- Aquisição deste nível de estrutura;
- Estabilização e manutenção deste nível de estrutura?
Alguns tipos de forças responsáveis pela estrutura de nível terciário das
proteínas: (I) – interacções electrostáticas; (II)- ligação de hidrogénio; (III)ligação de persulfureto (ligação covalente); (IV) - força de Van der Waals; (V) interacções de grupos polares com a água.
Disulfide bridges
A different set of forces are at work within the
polypeptide molecule itself. Intra-molecular forces
attract or repel parts of segments of the amino acid
chain as the various R-groups are twisted into
proximity with one another.
The strongest of these intra-molecular forces is a
covalent bond that forms, under the right
circumstances, between the two R-groups of two
cysteine amino acids.
Many proteins that are secreted from cells, or find
themselves on the surface of cells, are "spot welded"
in places along their length by crosslinks formed
between two sulfur containing amino acid R-groups.
Disulfide bridges (also called "disulfide bonds" or "S-S- bonds") are strongly stabilizing, particularly if
the protein is to be transported to the outside of the
cell.
It is thought that these kinds of crosslinks are not
essential for creating the three-dimensional protein
shape, but rather are used to hold them in the
correct shape once it has formed.
Chemical reducing agents can be used to break
these crosslinks, snapping them open, without
materially altering the overall shape of the protein.
Disulfide Bridges
Two Cysteine residues that are widely separated in the primary
sequence can become covalently linked to form a disulfide brid
Disulfide Bridges and Oxidation-Reduction
The amino acid cysteine undergoes oxidation and reduction reactions involving the -SH (sulfhydryl group). The oxidation of two sulfhydryl groups
results in the formation of a disulfide bond by the removal of two hydrogens.
An unspecified oxidizing agent (O) provides an oxygen which reacts with the hydrogen (red) on the -SH group to form water. The sulfurs (yellow)
join to make the disulfide bridge. This is an important bond to recognize in protein tertiary structure.
The reduction of a disulfide bond is the opposite reaction which again leads to two separate cysteine molecules. Remember that reduction is the
addition of hydrogen.
Disulfide bridge reaction
Ligações químicas por pontes de hidrogénio
Ligação por pontes de hidrogénio entre o
hidrogénio da água e o azoto do amoníaco
Ligações por pontes de hidrogénio
entre o oxigénio das moléculas de água
Hydrogen Bonds
Hydrogen Bonds
Hydrogen bonds form when a hydrogen atom is covalently
bonded to one electronegative atom (usually oxygen or
nitrogen) and is simultaneously attracted to another
electronegative atom. This attraction is the hydrogen bond
(shown as dashed lines below).
Electrostatic interactions, ionic bonds or salt bridges
The tetrad salt bridge showing
the distance in Å between the
residues
Ionic Bonds
A charged R-group in one part of a
polypeptide chain can attract an oppositely
charged R-group in another part of the
chain. The force of such an electrostatic
attraction is the ionic bond, sometimes
called a salt linkage, salt bridge, or
electrostatic bond.
Highlighting two salt
bridges in hemoglobin
tetramer (hemo group as
sticks at bottom-right).
Forças de van der Waals
The Nobel Prize in
Physics 1910
Johannes Diderik
van der Waals
Van Der Waals force is a
weak attractive force
between atoms or
nonpolar molecules
caused by an
instantaneous dipole
moment of one atom or
molecule that induces a
similar temporary dipole
moment in adjacent
atoms or molecules.
In simple words, Van Der
Waals forces are short
range electro magentic
forces that attract dust to
surfaces, you may have
noticed that your
television screen gets
dusty very quickly this is
partly due to van der
waals forces.
van der Waals attraction. What is it?
It is an electrostatic attraction between opposite charges. It is a weak force of attraction.
Hydrophobic Interactions
Non polar R-groups tend to cluster together in water. These weak associations
are called hydrophobic interactions. When the polypeptide chain folds, the
hydrophobic R-groups tend to be close to each other in the interior of the folded
chain, whereas hydrophilic R-groups tend to be on the outside, attracted to
water. The diagram below illustrates some hydrophobic interactions between Rgroups. Hydrophobicity of various amino acids.
Hydrophobic Interactions
The hydrophobic effect is the name given to those influences that cause nonpolar substances to minimize
their contacts with water and amphipathic molecules, such as soaps and detergents, to form micelles in
aqueous solutions. Since native proteins form a sort of intramolecular micelle in which their nonpolar side
chains are largely out of contact with the aqueous solvent, hydrophobic interactions must be an important
determinant of protein structures.
The hydrophobic effect derives from the special properties of water as a solvent, only one of which is its high
dielectric constant. In fact, other polar solvents, such as dimethyl sulfoxide (DMSO) and N,Nimethylformamide (DMF), tend to denature proteins. The thermodynamic data of the table below provide
considerable insight as to the origin of the hydrophobic effect because the transfer of a hydrocarbon from
water to a nonpolar solvent resembles the transfer of a nonpolar side chain from the exterior of a protein in
aqueous solution to its interior. The isothermal Gibbs free energy changes
ΔG = ΔH - T ΔS
for the transfer of a hydrocarbon from an aqueous solution to a nonpolar solvent is negative in ali cases,
which indicates, as we know to be the case, that such transfers are spontaneous processes (oil and water
don't mix).
What is perhaps unexpected is that these transfer processes are endothermic (positive ΔH) for aliphatic
compounds and athermic (ΔH = O) for aromatic compounds; that is, it is enthalpically more or equally
favorable for nonpolar molecules to dissolve in water than in nonpolar media.
In contrast, the entropy component of the unitary free energy change, -T ΔS, is large and negative in all
cases. Evidently, the transfer of a hydrocarbon from an aqueous medium to a nonpolar medium is
entropically driven. The same is true of the transfer of a nonpolar protein group from an aqueous
environment to the protein's nonpolar interior.
What is the physical mechanism whereby nonpolar entities are excluded from aqueous solution?
Recall that entropy is a measure of the order of a system; it decreases with increasing order. Thus the decrease
in entropy when a nonpolar molecule or side chain is solvated by water (the reverse of the foregoing process)
must be due to an ordering process. This is an experimental observation, not a theoretical conclusion.
The magnitudes of the entropy changes are too large to be attributed only to changes in the conformations of
the hydrocarbons; rather, as Henry Frank and Marjorie Evans pointed out in 1945, these entropy changes
mainly arise from some sort of ordering of the water structure.
Liquid water has a highly ordered and extensively H bonded structure. The insinuation of a nonpolar group into
this structure disrupts it: a nonpolar group can neither accept nor donate H bonds, so the water molecules at
the surface of the cavity occupied by the nonpolar group cannot H bond to other molecules in their usual
fashion. In order to recover the lost H bonding energy, these surface waters must orient themselves so as to
form an H bonded network enclosing the cavity. This orientation constitutes an ordering of the water structure,
since the number of ways that water molecules can form H bonds about the surface of a nonpolar group is less
than the number of ways that they can H bond in bulk water.
The orientational preference of water molecules
next to a nonpolar solute. In order to maximize
their H bonding energy, these water molecules
tend to straddle the inert solute such that two or
three of their tetrahedral directions are
tangential to its surface. This permits them to
form H bonds (black) with neighboring water
molecules lining the nonpolar surface. This
ordering of water molecules extends several
layers of water molecules beyond the first
hydration shell of the nonpolar solute.
Unfortunately, the complexity of liquid water's
basic structure has not yet allowed a detailed
structural description of this ordering process.
The unfavorable free energy of hydration of a
nonpolar substance caused by its ordering ot
the surrounding water molecules has the net
result that the nonpolar substance is excluded
from the aqueous phase. This is because the
surface area of a cavity containing an aggregate
of nonpolar molecules is less than the sum of
the surface areas of the cavities that each of
these molecules would individually occupy. The
aggregation of the nonpolar groups thereby
minimizes the surface area of the cavity and
therefore the entropy loss of the entire system.
In a sense, the nonpolar groups are squeezed
out of the aqueous phase by the hydrophobic
interactions. Thermodynamic measurements
indicate that the free energy change of removing
a -CH2group from an aqueous solution is about -3
kJ/mol. Although this is a relatively small amount
of free energy, in molecular assemblies involving
large
numbers
of
nonpolar
contacts,
hydrophobic interactions are a potent force.
Walter Kauzmann pointed out in 1958 that
hydrophobic forces are a major influence in
causing proteins to fold into their native
conformations.
The amino acid side chain hydropathies (indexes of combined hydrophobic and hydrophilic tendencies; Table
above) are, in fact, good predictors of which portions of a polypeptide chain are inside a protein, out of contact
with the aqueous solvent, and which portions are outside, in contact with the aqueous solvent. ln proteins, the
effects of hydrophobic forces are often termed hydrophobic bonding, presumably to indicate the specific nature of
protein folding under the influence of the hydrophobic effect. You should keep in mind, however, that hydrophobic
bonding does not generate the directionally specific interactions usually associated with the term "bond”.
Residue number
Hydropathic index pIot for bovine chymotrypsinogen. The sum of the hydropathies of
nine consecutive residues (see table previous slide) are plotted versus the residue
sequence number. A large positive hydropathic index is indicative of a hydrophobic
region of the polypeptide chain, whereas a large negative value is indicative of a
hydrophilic region. The bars above the midpoint line denote the protein's interior
regions, as determined by X-ray crystallography, and the bars below the midpoint line
indicate the protein's exterior regions.
Protein folding
To understand how protein structures form beyond the primary structure determined by
the RNA sequence requires an understanding of the role of energy and hydrophobic
interactions on the confirmation of the protein. While the hydrophobic/philic calculations
of individual amino acids may seem tedious, it actually greatly helps in the process of
determining protein structures.
Though the process of protein
conformation is not direct, and
takes a variety of different routes,
the overall pathway can be
viewed as moving down a free
energy “folding funnel”, a type of
topological (3-D) energy map that
traces a protein’s free energy as
it assumes its conformation.
As a protein proceeds in folding,
and approaches its most
energetically stable conformation,
its free energy becomes lower
and lower.
A schematic of protein energy as it moves
from its iniditial chaotic polypeptide strand
state to the native state of the protein
A 3-D visualization of the protein energy diagram as it moves from
its high energy initial state, to its lowest energy native state.
Again, there are numerous conformational routes
and cul-de-sacs a polypeptide will confront, so a
folding funnel has various peaks of free energy
within its overall downward curve. Like all
reactions, every step in a folding pathway
requires a certain activation energy, and if this
energy is not available, the polypeptide will stop
folding and dead-end against one of the free
energy hills in the folding funnel. Thus, the dips
and peaks in the folding funnel, representing
states of high free energy in the polypeptide, help
indicate where major steps in the folding process
start and stop. This information has been crucial
in figuring out the individual mechanisms - such
as secondary structure formation and
hydrophobic interactions (see below) - by which
polypeptides achieve their functional
conformation.
Though R group interactions provide specific conformations between individual amino acids, the hydrophobic
interactions drives the larger-scale framework of the entire protein fold. The 20 amino acids are commonly
divided into four categories: acidic, basic, uncharged polar, and nonpolar R groups - which can be further
generalized into hydrophobic and hydrophilic. Ionic (acidic and basic) as well as heavily polar amino acids are
soluble in polar water molecules, and are hydrophilic; nonpolar amino acids, which cannot form hydrogen bonds
with water, are not soluble, and are hydrophobic.
The black dots represent the
hydrophobic domains of the
polypeptide chain. When it moves
to its native state, the hydrophobic
domains try to bunch into the
middle. In a real protein, this
happens on a 3 dimentional scale,
making predictions a bit more
difficult.
In lowering its free energy and travelling down the folding funnel, the polypeptide optimizes the most chemically
stable interactions between hydrophobic and hydrophilic amino acids. Early on in the folding process, the
hydrophobic amino acids aggregate in order to minimize the number of disrupted hydrogen bonds between water
molecules, in the same way that oil droplets in water do. Because of their differing chemical natures, it is very
energetically unfavourable for polar water molecules to come in contact with a large nonpolar surface area; the
clumping of hydrophobic amino acids minimizes surface area, helping to avoid contact. To further complete the
energetically favourable isolation from water, the aggregated amino acids undergo the “hydrophobic collapse”,
where they are buried in the interior of the protein. The hydrophilic amino acids assume conformations on the
exterior of the protein, where they are in contact with the water molecules.
The hydrophobic collapse leads to an intermediate state in a protein’s conformation process
known as a “molten globule”. The hydrophobic collapse is represented by a major, steep dip in
the folding funnel, indicating how vital this step is to achieving a stable protein conformation.
Hydrophobic interactions are among the few large-scale steps that are common to all protein
conformation processes. They provide a stable, general outline for the following smaller-scale
folding processes. The hydrophobic collapse definitely doesn’t deal with everything - there are
certain amphipathic amino acids, such as alanine, that can be found in both the hydrophobic
interior and hydrophilic exterior of a protein. Many alpha helix structures also form so that
hydrophobic R groups extend off one side, and hydrophilic R groups the other, making the helix
itself amphipathic. Despite exceptions, however, a polypeptide will run into countless energy
barriers in folding if it cannot first undergo the hydrophobic collapse. Thus, proteins must be in
an aqueous environment in order to carry out the most efficient conformation process possible.
The folding funnel of a polypeptide in
a non-aqueous environment. Note
how the chaotic behaviour of the
energy function serves as a barrier to
further conformation change towards
the native state.
The folding funnel of a polypeptide in
an aqueous environment. This time,
the chaotic behaviour is absent.
Representations of the X-ray structure of sperm
whale myoglobin
Jack bean protein concanavavalin A
Human carbonic anhydrase
Estrutura de nível quaternário
É difinida pelo arranjo das subunidades individuais quando a proteína é constituída por mais de uma
subunidade – proteína oligomérica.
Por subunidade entende-se a unidade mais pequena cujos constituintes estão unidos por ligações
covalentes.
Assim, uma subunidade (monómero) pode ser constuída por uma ou mais cadeias polipeptídicas, desde
que estejam ligadas por ligações persulfureto.
As subunidades de uma proteína oligomérica podem ser todas do mesmo tipo (estrutura de nível
quaternário homogéneo) ou de mais de um tipo (estrutura de nível quaternário heterogéneo).
Forças contribuintes:
- Ligações de hidrogénio;
- Interacções electrostáticas;
- Interacções hidrofóbicas;
- Forças de Van der Waals.
Qual o papel de cada uma das forças contribuintes a nível da
- Aquisição deste nível de estrutura;
- Estabilização e manutenção deste nível de estrutura?
Subunidade versus cadeia polipeptídica:
Onde está o erro?
Estrutura de nível supersecundário
Consiste numa série de elementos da estrutura de nível secundária ligados sequencialmente, não
constituindo, no entanto, nem um domínio de estrutura, nem a estrutura de nível terciária completa.
(a)
Schematic diagrams of supersecondary structures. (a) A βαβ motif, (b) a β hairpin motif, (c) an αα motif, and (d) a Greek key
motif, showing how it is constructed from a folded-over β hairpin.
Domínios de estrutura
Domínios de estrutura de uma cadeia polipeptídica são porções contíguas dessa cadeia que
adquirem frequentemente a estrutura de nível terciária (isto é, se enrolam para a conformação
nativa) em unidades locais compactas.
Constituem um nível de complexidade estrutural entre a estrutura de nível secundária e a
estrutura de nível terciária.
Se uma proteína for composta por mais do que um domínio de estrutura, então os domínios
adquirem a estrutura de nível terciária separadamente e o último passo no enrolamento da
cadeia polipeptídica será a associação entre os domínios.
Classificação dos domínios de estrutura
The simplest way to catagorize domain structures is to classify them as
- α domains, containing secondary structural elements that are exclusively α helices;
- β domains, containing only β sheets;
- α/β domains, containing both α helices and β sheets.
The α/β domain category may be further divided into two main groups:
- α/β barrels;
- open β sheets.
α domain: the globin fold, which contains 8 helices in two layers and occurs in myoglobin and in both the α
and β chains of hemoglobin.
ln another common all-α fold, two αα motifs combine to form a 4-helix bundle such as occurs in cytochrome
b562. The helices in this fold are inclined such that their contacting side chains intermesh and are therefore out
of contact with the surrounding aqueous solution. They are consequently largely hydrophobic. The 4-helix
bundle is a relatively common fold that occurs in a variety of proteins.
However, not all of them have the up-down-up-down topology (connectivity) of cytochrome b562. For example,
human growth hormone is a 4-helix bundle with up-up-down-down topology. The successive parallel helices in
this fold are, of necessity, joined by longer loops than those joining successive antiparallel helices.
The α domain of (a) E. coli cytochrome b562 and (b)
human growth hormone. The proteins are represented by
their peptide backbones, drawn in ribbon form, in which
the helices and their connecting links are colored, from Nto C-terminus, in rainbow order, from red to blue.
Cytochrome b562‘s bound heme group is shown in balland-stick form with C magenta, N blue, O red, and Fe
orange. The inset below each ribbon diagram is a
topological diagram indicating the connectivity of the α
helices in each 4-helix bundle. Cytochrome b562 (106
residues) has up-down-up-down topology, whereas human
growth hormone (191 residues) has up-up-down-down
topology. Note that the N- and C-terminal helices of human
growth hormone are longer than its other two helices, so
that, at one end, these longer helices associate as an
αα motif.
β domain: β domains contain from 4 to >10 predominantly antiparallel β strands that are arranged into two
sheets that pack against each other to form a β sandwich. For example, the immunoglobulin fold, which
forms the basic domain structure of most immune system proteins, consists of a 4-stranded antiparallel β
sheet in face-to-face contact with a 3-stranded antiparallel β sheet. Note that the strands in the two sheets
are not parallel to one another, a characteristic of stacked β sheets. The side chains between the two
stacked β sheets are out of contact with the aqueous medium and thereby form the domain's hydrophobic
core. Since successive residues in a β strand alternately extend to opposite sides of the β sheet, these
residues are alternately hydrophobic and hydrophilic.
The β domain of the
immunoglobulin fold. The Xray structure of the Nterminal domain of the
human immunoglobulin
fragment Fab New shows its
immunoglobulin fold. The
peptide backbone of this
103-residue domain is drawn
in ribbon form with its β
strands represented by flat
arrows pointing toward the
C-terminus and colored,
from N- to C-terminus, in
rainbow order, from red to
blue. The inset is the
topological diagram of the
immunoglobulin fold showing
the connectivity of its
stacked 4-stranded and 3stranded antiparallel β
sheets.
α/β domain: α/β barrels. In α/β domains, a central parallel or mixed β sheet is flanked by α helices. The α/β
barrel is a remarkably regular structure that consists of 8 tandem β units (essentially 8 overlapping βαβ
motifs) wound in a right-handed helical sense to form an inner 8-stranded parallel β barrel concentric with an
outer barrel of 8 α helices. Each β strand is approximately antiparallel to the succeeding α helix and all are
inclined at around the same angle to the barrel axis. Chicken triose phosphate isomerase (TIM), determined
by David Phillips, consists of an α/β barrel. This is the first known structure of an α/β barreI, which is therefore
also called a TIM barrel.
The side chains that point inward from the α helices interdigitate with the side chains that point outward from
the β strands. A large fraction (-40 %) of these side chains are those of the branched aliphatic residues Ile,
Leu, and VaI. The side chains that point inward from the β strands tend to be bulky and hence fill the core of
the β barrel (α/β barrels, with one known exception, do not have hollow cores). Those side chains that fill the
ends of the barrel are in contact with solvent and hence tend to be polar, whereas those in its center are out
of contact with solvent and are therefore nonpolar. Thus, α/β barrels have four layers of polypeptide backbone
interleaved by regions of hydrophobic side chains. In contrast, both α domains and β domains consist of two
layers of polypeptide backbone sandwiching a hydrophobic core.
Around 10% of known enzyme structures contain an α/β barrel, making it the most common fold assumed by
enzymes. Moreover, nearly all known α/β barrel proteins are enzymes. Intriguingly, the active sites of α/β
barrel enzymes are almost all located in funnel-shaped pockets formed by the loops that link the C-termini of
the β strands to the succeeding α helices and hence surround the mouth of the β barrel, an arrangement that
has no obvious structural rationale.
Thus, despite the observation that few α/β barrel proteins exhibit significant sequence homology, it has been
postulated that all of them descended from a common ancestor and are therefore (distantly) related by
divergent evolution. On the other hand, it has been argued that the α/β barrel is structurally so well suited for
its enzymatic roles that it independently arose several times and hence that α/β enzymes are related by
convergent evolution (i.e., nature has discovered the same fold on several occasions). The nature of the
evolutionary relationships among the α/β barrel enzymes remains an open question.
The X-ray structure of the 247-residue enzyme triose phosphate isomerase (TIM) from chicken muscle. The protein is viewed
approximately along the axis of its α/β barrel. The peptide backbone is shown as a ribbon diagram with its successive βα
units colored, from N- to C-terminus, in rainbow order, red to blue. The inset is its topological diagram (with α helices
represented by rectangles).
α/β domain: open β sheets. Examples of open β sheet may be encountered in the structures of the enzymes
lactate dehydrogenase (N-terminal domain) and adenylate kinase. Such folds consist of a central parallel or
mixed β sheet flanked on both sides by α helices that form the right-handed crossover connections between
successive parallel β strands.
X-Ray structures of open β sheet-containing enzymes. (a) Dogfish lactate dehydrogenase, N-terminal domain (residues 20-163 of
this 330-residue protein) and (b) porcine adenylate kinase (195 residues). The peptide backbones are shown as ribbon diagrams
with successive βα units colored, from N- to C-terminus, in rainbow order, red to blue. In Part b, structural elements that are not
components of the open β sheet are gray. The insets are topological diagrams of these proteins, with the thin black vertical arrows
marking their topological switch points.
Níveis de organização supramolecular
- Complexos multienzimáticos;
- Ribossomas;
- Elementos do citosqueleto – ex: microtúbulos.
Desnaturação de proteínas
É a alteração estrutural das moléculas dos biopolímeros que destrói a sua conformação nativa,
essencial à expressão da sua atividade biológica. Em estruturas oligoméricas, a desnaturação
pode envolver também a dissociação das moléculas nos seus protómeros, com ou sem
alteração da conformação destes.
É normalmente produzida por temperaturas elevadas, por valores extremos de pH ou por
compostos químicos (como, p. ex., ureia, detergentes, metais pesados ou solventes
orgânicos), que recebem, por isso, a designação de agentes desnaturantes.
A desnaturação é um processo cooperativo. A passagem de uma molécula do estado nativo ao
estado desnaturado é, quase sempre, uma transição brusca, i. é, ocorre abruptamente em
consequência de um pequeno incremento do agente desnaturante.
Devido aos mecanismos moleculares distintos com que diferentes agentes desnaturantes
actuam sobre os biopolímeros, a desnaturação tem sido utilizada no estudo dos tipos de
ligações químicas responsáveis pela estrutura nativa de proteínas e ácidos nucleicos.
A desnaturação de uma molécula pode ser reversível ou irreversivel, consoante se dê a sua renaturaçâo
completa (molécula biologicamente activa) ou incompleta (molécula biologicamente inactiva),
respectivamente, após remoção do agente desnaturante.
O estudo da desnaturação assume uma importância particular no caso das proteínas globulares e dos ácidos
nucleicos.
A conformação nativa das proteínas globulares é termodinamicamente mais estável do que a conformação
que conduz à sua forma desnaturada, mas apenas por uma margem pequena - normalmente, cerca de 3,5 a
14 kcal/mol. Não admira, por isso, que as proteínas possam ser, na maioria dos casos, facilmente
desnaturadas por acção de uma grande variedade de agentes desnaturantes. O efeito mais facilmente
detectável na desnaturação das proteínas é a redução da sua solubilidade. Contudo, a consequência mais
significativa da desnaturação é a perda da actividade biológica característica da proteína considerada, o que,
no caso das enzirnas, leva à destruição da sua capacidade catalítica. A grande maioria das proteínas
globulares sofre desnaturação quando aquecidas acima de 60 a 70 °C. A formação de um coágulo branco
insolúvel, quando a clara do ovo é fervida, é um exemplo comum de desnaturação proteica. Contudo,
algumas proteínas podem ser desnaturadas por exposição a temperaturas baixas.
Diagrama ilustrando a desnaturação (I) de
uma proteína, a sua completa renaturação
(II) e a sua incompleta renaturação (III)
(proteína biologicamente inactiva).
(■) Áreas onde se exercem as forças que
mantêm a estrutura de nível terciário.
Enrolamento espontâneo de proteínas
Chaperones moleculares
YouTube video on protein folding:
http://www.youtube.com/watch?v=gFcp2Xpd29I
 Protein-folding researchers have until now focused on a
unique group of small, fast-folding proteins that fold in
hundreds of nanoseconds or microseconds.
 In January 2012, scientists have simulated protein folding at
a timescale that begins to be relevant to biology: the
millisecond.
 The 39-amino acid residue chain called NTL9 is the slowest
folding protein yet studied—a 1.5 millisecond fold.
 NTL9 follows not just one or two pathways but many
different paths to get to the final folded state.
A Markov State Model illustrates how NTL9 progresses from a fully unfolded state (a) to a
fully folded state (n) through many different pathways. This simple 14-state model illustrates
only the most frequented folding pathways. The larger the arrow, the more a path is traveled.
The larger the circle, the greater a state’s stability.
Journal of the American Chemical Society (2010) 132: 1526-1528
O Dogma de Anfinsen
Anfinsen's dogma (also known as the thermodynamic hypothesis) is a postulate in molecular biology
championed by the Nobel prize laureate Christian B. Anfinsen. The dogma states that, at least for small
globular proteins, the native structure is determined only by the protein's amino acid sequence. This amounts
to say that, at the environmental conditions (temperature, solvent concentration and composition, etc.) at
which folding occurs, the native structure is a unique, stable and kinetically accessible minimum of the free
energy. The three conditions:
- Uniqueness: Requires that the sequence does not have any other configuration with a comparable free
energy. Hence the free energy minimum must be unchallenged.
- Stability: Small changes in the surrounding environment cannot give rise to changes in the minimum
configuration. This can be pictured as a free energy surface that looks rather like a funnel (with the native
state in the bottom of it) than like a soup plate; the free energy surface around the native state must be
rather steep and high, in order to provide stability.
- Kinetical accessibility: Means that the path in the free energy surface from the unfolded to the folded
state must be reasonably smooth or, in other words, that the folding of the chain must not involve highly
complex changes in the shape (like knots or other high order conformations).
A recent study from Harvard-MIT provided compelling evidence in support of Anfinsen's dogma that
information dictating the native structural fold of protein domains is encoded in its amino acid sequence. This
study examined the entire protein universe of ~ 1018 folds on a fold-by-fold basis to show that a significant
portion of the fold-dictating information is encoded by the atomic interaction network in the solventunexposed core of protein domains (termed protein core atomic interaction network or PCAIN).
How the protein reaches this structure is the subject of the field of protein folding, which has a related dogma
called Levinthal’s paradox. The Levinthal paradox states that the number of possible conformations available
to a given protein is astronomically large. Effectively, this makes computational prediction of protein structure
by evaluating all possible conformations unfeasible even for relatively small proteins.
Also, some proteins need the assistance of another protein called a chaperone protein to fold properly. It has
been suggested that this disproves Anfinsen's dogma. However, the chaperones do not appear to affect the
final state of the protein; they seem to work primarily by preventing aggregation of several protein molecules
before the protein is folded.
Hydrophilic
exterior
Enrolamento
espontâneo das
proteínas para
adquirirem a sua
conformação
biologicamnente
activa
Hydrophobic
Interior
Polipéptidos e Proteínas
Questões:
1 – Com base nas definições apresentadas, identifique dois aspectos fundamentais que podem
distinguir proteínas de polipéptidos.
2 – Ao longo do processo evolutivo, algumas proteínas adquiriram uma estrutura de nível
quaternário. Indique três vantagens que essa alteração trouxe às células.
3 – Defina subunidade de uma proteína oligomérica.
4 – Identifique os três tipos de forças que contribuem para a estrutura de nível secundário das
proteínas, indicando o papel desempenhado por cada uma na (1) aquisição e na (2)
estabilização desse tipo de estruturas.
5 – Indique, justificando, se a insulina, composta por 51 resíduos de aminoácidos distribuídos
por duas cadeias polipeptídicas (A e B) unidas por duas ligações persulfureto, é uma proteína
dimérica.
6 - Considere as seguintes proteínas, com os pontos isoeléctricos (pI) indicados:
Albumina do soro humano – 4,9
Colagénio humano - 6,6
Hemoglobina humana – 7,1
Insulina bovina – 5,4
Lisozima de galinha - 11,0
Mioglobina equina – 7,0
Ovalbumina de galinha – 4,6
Se uma solução de pH = 6,6 contendo estas proteínas for submetida a um campo eléctrico,
indique, para cada proteína, qual a carga eléctrica global que possui e em que direcção de
desloca (ânodo ou cátodo).
7 - Considere a estrutura de nível primário da ribonuclease bovina, uma enzima que catalisa a
hidrólise das ligações fosfodiéster do mRNA.
“Christian Boehmer Anfinsen, Jr. (1916–1995) was an
American biochemist. He was awarded the 1972 Nobel
prize for his work on ribonuclease. In 1961 he showed that
ribonuclease could be refolded after denaturation while
preserving enzyme activity, thereby suggesting that all the
information required by protein to adopt its final
conformation is encoded in its primary structure.”
a) Defina nível de estrutura primário de um polipéptido. Quais as forças contribuintes para este
tipo de estrutura?
b) Para desnaturar a ribunuclease, C. Anfinsen tratou uma solução desta enzima na forma nativa
com uma concentração elevada de ureia e de 2-mercaptoetanol, de modo a desenrolar
completamente o polipéptido. Qual o efeito de cada um destes agentes desnaturantes.
c) Uma vez desenrolado o polipéptido e removidos os agentes desnaturantes, a ribonuclease
recupera a sua estrutura de nível terciário e, consequentemente, a sua actividade catalítica.
Explique, sucintamente, recorrendo a conceitos termodinâmicos, como é que de entre um
número de conformações possíveis extremamente elevado, ela se enrola sempre para a
conformação que exibe actividade biológica.
d) Indique o tipo de forças que mais contribui para a aquisição da estrutura de nível terciário da
ribonuclease e qual o que mais contribui para a sua manutenção.
e) Poder-se-á dizer que a estrutura de nível terciário da ribonuclease já se encontra definida pela
sequência de nucleótidos do gene que a codifica?
f) Como coaduna a resposta à alínea e) com a existência de uma família de proteínas com
actividade de chaperones moleculares?
8 - A hélice α é um elemento estrutural das proteínas.
a) O que é uma hélice α e em que nível de estrutura participa?
b) Porque é que a formação de uma hélice α é um processo cooperativo?
c) O que é o dipolo da hélice α?
d) Explique o papel desempenhado pelas ligações de hidrogénio, interacções electrostáticas e forças de Van
der Waals na estabilização da hélice α.
e) Como explica a actividade anticongelante de algumas proteínas ricas em hélices α?
LICENCIATURA EM BIOLOGIA
DISCIPLINA
BIOQUÍMICA
Ano Lectivo de 2013/2014
Aula nº 7
12 MAR
Ricardo Boavida Ferreira
Sala 40
Aminoácidos, péptidos e proteínas (cont.)
Interactómica. As interacções proteína-proteína e o dogma central da biologia
molecular. Agregados de proteínas e neurodegeneração. Priões e corpos de Lewy.
Glicoproteínas e o exoglicoma. Lectinas. Lipoproteínas.
Aminoácidos, péptidos e proteínas como mecanismos de defesa. Introdução.
Aminoácidos: aminoácidos como análogos de aminoácidos proteicos; latirismo.
Péptidos: péptidos antifúngicos; faloidinas e amanitinas. Proteínas: sistema
imunológico humano; lectinas; ricina; proteínas antifúngicas e proteínas PR.
Material de estudo: diapositivos das aulas, bibliografia recomendada e textos de apoio.
Interactómica:
Protein-protein interactions
Protein-protein interactions often involve what may be considered as
information transfer:
1 – Cristian Anfinsen – Molecular chaperones
2 – Prions
3 – Protein aggregates
Protein-protein interactions often involve what may be considered as information
transfer:
1 – Cristian Anfinsen – Molecular chaperones
2 – Prions
3 – Protein aggregates
Christian Boehmer Anfinsen, Jr. (1916–1995) was
an American biochemist. He was awarded the 1972
Nobel prize for his work on ribonuclease. In 1961
he showed that ribonuclease could be refolded
after denaturation while preserving enzyme activity,
thereby suggesting that all the information required
by protein to adopt its final conformation is encoded
in its primary structure.
Como a estrutura de nível primário está codificada no gene, então poder-se-ía concluir que a
conformação biologicamente activa da proteína já se encontra determinada no gene.
Estrutura de nível primário da ribonuclease
bovina, uma enzima que catalisa a hidrólise
das ligações fosfodiéster do mRNA.
Mais recentemente, observou-se que muitas proteínas requerem, para assumirem
a conformação biologicamente activa, outras proteínas, por isso denominadas
chaperones moleculares. São exemplos os proteassomas 20 S e 26 S e a
ribulose bisfosfato carboxilase (Rubisco).
Nestes casos, a estrutura de nível terciário depende não só de informação contida
no gene da proteína, como também nos genes das outras proteínas que participam
no seu processamento.
Protein-protein interactions often involve what may be considered as information
transfer:
1 – Cristian Anfinsen – Molecular chaperones – Rubisco activase RuBP! Estranho; CA1-P – estranho!
2 – Prions
3 – Protein aggregates
Prions:
- Creutzfeldt-Jacob disease in
humans
- Bovine spongiform encephalitis
(BSE, mad cow disease)
- Scrapie in sheep
The notion that the only way for
diseases to pass from one
organism to another is by
genetic information has been an
undisputed postulate until
recently. Even viruses, although
not technically alive, still possess
genetic information in the form of
DNA or RNA.
A normal prion (left), compared to an aberrant, disease-causing prion (right).
According to the prion model, the
disease progresses when a
misfolded PrPSc molecule comes
in contact with cellular form PrPC of
this protein and converts them. The
appearance of a misfolded
molecule can be either
spontaneous, or caused by
feeding an animal with food
containing the meat of diseased
animals. Both modes of infection
have exhaustive experimental
confirmation.
The problem with the spontaneous
appearance of prions stems from
the fact that the formation of the
infectious form of the prion is
thermodynamically unfavorable.
If forming one molecule is
unfavorable, then how can this one
molecule survive in the body
without reverting back into a ‘good’
cellular form, let alone convert other
molecules against the
‘thermodynamic gradient’?
A ‘nucleation theory, one of
several, offers the answer to this
question by suggesting that the
process is very slow at first, with
only a handful of molecules
undergoing conversion. The
misfolded molecules stabilize
each other when they aggregate.
After a very long time, the
aggregate reaches a certain
number ‘n’, at which point it is
called a nucleus, thus the name for
this theory. The nucleus is very
stable and can quickly convert the
rest of the ‘good’ molecules in their
misfolded PrPSc forms. The
presence of plaque-like clusters of
the protein in infected cells
supports this hypothesis.
Endogenous PrPC
'Lifeless' prion proteins are 'capable of evolution'
“Lifeless" prion proteins, devoid of all genetic
material, can evolve just like higher forms of
life. Prions can change to suit their
environment and go on to develop drug
resistance.
Prions are associated with 20 different brain
diseases in humans and animals. In a study
published in the journal Science, prion
populations were transferred from brain cells
to other cells in culture and the prions that
adapted to the new cellular environment outcompeted their brain-adapted counterparts.
When returned to the brain cells, the brainadapted prions again took over the
population. It seems that exactly the same
process of mutation and adaptive changes
seen in viruses also occur in prions.
In viruses, mutation is linked to changes in
nucleic acid sequence that leads to
resistance. This adaptability has moved one
level down - to prions and protein folding and it's clear that nucleic acids are not
required in this process of evolution.
Mammalian cells normally produce cellular prion protein or PrPC. During infections, such as the human
form of mad cow disease known as vCJD, abnormal or misfolded proteins convert the normal host prion
protein into its toxic form by changing its conformation or shape. It was generally thought that once cellular
prion protein was converted into the abnormal form, there was no further change. However, it has been
observed that when prions are transmitted from sheep to mice, they become more virulent over time.
The abnormal prions are known to replicate, and create variants, perhaps at a low level initially. But once
they are transferred to a new host, natural selection will eventually choose the more virulent and aggressive
variants.
Li et al. (2009) Darwinian Evolution of Prions in Cell Culture. Science DOI: 10.1126/science.1183218
Published Online 31 December 2009
Science 12 February 2010:
Vol. 327 no. 5967 pp. 869-872
DOI: 10.1126/science.1183218
Darwinian Evolution of Prions in Cell Culture
Deer transmit prion proteins to
one another via their droppings.
Nature doi:10.1038/nature08289
Protein-protein interactions often involve what may be considered as information
transfer:
1 – Cristian Anfinsen – Molecular chaperones – Rubisco activase RuBP! Estranho; CA1-P – estranho!
2 – Prions
3 – Protein aggregates
From a structural (and thus thermodynamic) point of view, abnormal proteins are
most often potentially toxic to cells not because they are incapable of performing
their biological function, but most often because they are incorrectly folded,
frequently exposing hydrophobic surfaces to the external hydrophilic cellular
millieux, instead of being buried inside the hydrophobic core that characterizes the
protein native conformation.
Such exposed hydrophobic surfaces constitute aggregation nuclei, to which partial
unfolded proteins may be successively added, resulting in the buil-up of large
macromolecular protein aggregates. Reactive oxygen species (ROS), thermal
mobility and polypeptide movements resulting from the expression of the protein
biological activity further complicate this scenario.
Large protein aggregates are immune to proteolytic attack. In the aggregates, the
proteins may be held together by
- Hydrophobic interactions;
- Electrostatic interactions;
- Covalent bonds.
Formação da coalhada no fabrico do queijo - Interacções hidrofóbicas
No leite, as caseínas ocorre conjuntamente com o fosfato de cálcio, na forma de complexos esféricos fortemente
hidratados denominados micelas. Estes complexos apresentam um tamanho variável, com diâmetros a variarem
entre 20 e 600 nm e massas moleculares médias da ordem dos 100 MDa. O leite possui
c. 1015 micelas por litro. Uma micela típica contém qualquer coisa como 2 x 104 moléculas de caseína.
Cada micela é um agregado de subunidades, cada uma das quais consiste de 25 a 30 moléculas de α-, β-, e κcaseína em proporções semelhantes às que ocorrem no leite. A γ-caseína é um artefacto, na medida em que é
um fragmento da β-caseína, que resulta de proteólise limitada por acção de proteases presentes no leite. Cada
tipo de caseína apresenta uma forma alongada, do tipo de bola de rugby.
Cada uma das suas moléculas possui uma extremidade com uma predominância de resíduos de aminoácidos
hidrofóbicos e a outra extremidade com uma predominância de resíduos de aminoácidos polares. As
extremidades hidrófobas ficam viradas para o interior, longe do contacto com a água, e as extremidades polares
para o meio hidrofílico do exterior.
A extremidade polar da α-caseína possui 8 resíduos de serina com grupos fosfato esterificados. A extremidade
polar da β-caseína contém 4 destes resíduos de fosfosserina. Finalmente, a extremidade polar da κ-caseína não
apresenta resíduos fosfato, mas 1 ou + dos seus resíduos de treonina contêm cadeias oligossacarídicas. Os
grupos fosfato das caseínas α e β reagem com Ca2+ para ligar as submicelas entre si, quer directamente quer em
cadeias que envolvem a participação de mais grupos fosfato ou de citrato. Nas zonas onde ocorre a κ-caseína
não se observa ligação cruzada entre as submicelas, devido à incapacidade da extremidade polar desta proteína
em ligar o cálcio. Na formação das micelas, à medida que o número de submicelas que se associam vai
aumentando, a tendência é para as zonas polares da κ-caseína, que não participam na associação das
submicelas, dominarem a superfície exterior da micela, o que impede o seu crescimento indefenido.
Estrutura proposta para a micela de caseína. (A) Estrutura de uma
submicela típica, ilustrando a associação entre os três tipos de moléculas
de caseína envolvidas. As zonas predominantemente hidrofóbicas
encontram-se sombreadas. (B) Estabelecimento de ligações cruzadas
entre as submicelas de caseína. As regiões que não ligam cálcio,
correspondentes às extremidades polares das moléculas de κ-caseína,
estão representadas a negro: P - fosfato; Ca - cálcio; Cit - citrato. (C)
Formação de uma micela. À medida que a curvatura da micela diminui,
com o aumento do seu tamanho, menor oportunidade há para a ligação
entre submicelas.
O fabrico do queijo envolve a adição de enzimas proteolíticas ao leite para formar a coalhada. As enzimas
mais utilizadas são a quimosina (EC 3.4.23.4), também denominada renina, obtida do quarto estômago dos
animais ruminantes, algumas proteases de fungos (essencialmente de espécies de Mucor), a pepsina de
porco e as cardosinas da flor do cardo.
A renina catalisa especificamente a hidrólise de uma única ligação peptídica na κ-caseína, a ligação
que une os resíduos 105 e 106:
Esta reacção corta a κ-caseína em dois fragmentos polipeptídicos:
a) O segmento C-terminal da κ-caseína, que representa um terço da sua molécula, é denominado
macropéptido da κ-caseína e fica no soro. É fortemente aniónico e contém as cadeias oligossacarídicas.
b) Os restantes dois terços da molécula, a para-κ-caseína, são fortemente hidrófobos e permanecem na
constituição da submicela. A perda dos resíduos oligossacarídicos na κ-caseína significa que se podem
agora estabelecer ligações cruzadas fortes entre as submicelas, com o consequente crescimento
indefinido das micelas e a resultante formação rápida da coalhada. A coalhada deve ser mantida durante
várias horas, durante as quais aumenta a acídífícação produzida por microrganismos, o que confere uma
firmeza apropriada à coalhada.
Packaging of the seed storage proteins inside the legume protein storage
vacuoles - Electrostatic interactions
The Ca and/ou Mg induced self-aggregation of soybean seed storage proteins with Nigari® (calcium and
magnesium carbonates) leading to TOFU.
Proposed mechanism for the release of the storage proteins during germination.
Lewy bodies (Parkinson’s Disease) - Covalent bonds
Covalent aggregates between α-synuclein and ubiquitin, a characteristic biochemical hallmark of
Parkinson’s disease in neuronal cells.
Transmission electron micrograph of a pathological inclusion,
Lewy body, from the brain of a Parkinson disease patient.
Prepared from a formalin fixed paraffin section. (Kunihiro Uryu
and John Trojanowski of the University of Pennsylvania)
For all these reasons, cells are under permanet surveillance by the
proteolytic systems
In eukaryotic cells, the ubiquitin-proteasome pathway assumes a primordial
importance.
Ultimately, these processes may me regarded as information passed on
between proteins.
Do prions and other protein aggregation processes invalidate the Central
Dogma for Molecular Biology?
Neurotic Yeast – Saccharomyces cerevisiae and α-synuclein
Tiago Fleming Outeiro - IMM
α-syn-GFP: α-synuclein – green fluorescence protein fusion
Most proteins must fold into
defined three-dimensional
structures to gain functional
activity. But in the cellular
environment, newly synthesized
proteins are at great risk of
aberrant folding and
aggregation, potentially forming
toxic species. To avoid these
dangers, cells invest in a
complex network of molecular
chaperones, which use
ingenious mechanisms to
prevent aggregation and
promote efficient folding.
Because protein molecules are
highly dynamic, constant
chaperone surveillance is
required to ensure protein
homeostasis (proteostasis).
Recent advances suggest that
an age-related decline in
proteostasis capacity allows the
manifestation of various proteinaggregation diseases, including
Alzheimer's disease and
Parkinson's disease.
Interventions in these and
numerous other pathological
states may spring from a
detailed understanding of the
pathways underlying proteome
maintenance.
(Hartl FU, Bracher A & Manajit
GLICOPROTEÍNAS
Glycome enhancement of the molecular and functional diversity of the proteome
Targeting Carbohydrates:
The Exoglycome
Targeting carbohydrates: the fungal exoglycome
GLICOPROTEINS
• Glycosylation represents one of
the most frequently occurring
postranslational modifications of
proteins.
•About 0.5-1% of the human genes
encode proteins related with
biosynthesis, function and
degradation of sugar chains.
Anchors the glycoprotein to the
membrane
Proposed functions for the oligosaccharides that
compose the exoglycome
Carbohydrates
Outside of cell
Cytosol
Poorly specific roles:
• Protection of the peptide axis from protease action;
• Improvement of water solubility;
• Correct positioning of the glycoprotein.
Highly specialized roles:
• Regulation of cell–cell interactions;
• Regulation of cell–matrix interactions;
• Regulation of cell–molecule interactions;
• Quality control of proteins critical to the development
and function of complex multicellular organisms;
• Receptors for viruses, bacteria and (?) fungi
Proposed functions for the oligosaccharides that
compose the exoglycome
3
0
Carbohydrates
Outside of cell
Cytosol
Poorly specific roles:
• Protection of the peptide axis from protease action;
• Improvement of water solubility;
• Correct positioning of the glycoprotein.
Highly specialized roles:
• Regulation of cell–cell interactions;
(discrimination between self and non-self)
• Regulation of cell–matrix interactions;
• Regulation of cell–molecule interactions;
(oligosaccharide-lectin interactions)
• Quality control of proteins critical to the development
and function of complex multicellular organisms;
• Receptors for viruses, bacteria and (?) fungi.
To provide such highly specific functions, oligosaccharides
display an extremely high coding capacity
THE SUGAR CODE
or
The third alphabet of life
The original concept of the Central
Dogma by Francis Crick ignored
posttranslational modifications (such
as protein glycosylation) that greatly
magnify the functions of a single protein
encoded by a particular gene.
There are three major classes of
biological macromolecules, all of
which encode information essential
for the life of the organism. Nucleic
acids, proteins and glycans.
The biosynthesis of nucleic acids
and proteins is carried out by
relatively simple template
mechanisms, glycans require a
complicated non- template
assembly line.
Monosaccharides: versatility for oligomer formation
The phosphodiester
bond in nucleic acid
biosynthesis to yield
linear oligomers
The peptide
bond in protein
biosynthesis to
yield linear
oligomers
The glycosidic linkage in
oligosaccharides can
involve any hydroxy
group, opening the way
to linear and also
branched structures.
The Coding Capacity of the Sugar Code
A quantitative measure of this characteristic is the total number of 'words‘
(isomers) built from a set of 'letters' (monomers).
The following parameters need to be considered:
1 - The sequence of monosaccharides;
2 - The anomeric configuration;
3 - The ring size (pyranose or furanose);
4 - The linkage-points;
5 - The branching patterns;
6 – Introduction of site-specific modifications.
Consideration of these factors sets glycans far apart from nucleic
acids and proteins in terms of coding capacity.
In actual numbers, and considering a DP = 6,
- only 4096 (46) hexanucleotides are possible with the four letters in
the DNA language,
- 6.4 x 107 (206) hexapeptides from 20 proteinogenic amino acids,
- but the staggering number of 1.44 x 1015 hexasaccharides from 20
monosaccharides.
Glycome enhancement of the molecular and functional diversity of the proteome
Lectins
Targeting exoglycome oligosaccharides with lectins
Lectins are proteins of non-immune origin (thus excluding antibodies), devoid of
catalytic activity (thus excluding enzymes), which recognize and bind in a stable
manner (thus excluding enzymes) to specific carbohydrate structures.
Lectins are present in all cells. Their physiological functions remain largely to be
uncovered. They were first discovered in plants where they are widely present,
especially in legume seeds.
Lectins on particle surfaces interact with sugars on cell surfaces
Schematic examples
of major types of
animal lectins, based
on protein structure.
The emphasis is on the
extracellular domain
structure and topology.
The following are the
defined carbohydratebinding domains (CRDs)
shown: (CL) C-type lectin
CRD; (GL) S-type lectin
CRD; (MP) P-type lectin
CRD; (IL) I-type lectin
CRD. Other domains are
(EG) EGFlike domain;
(IG2) immunoglobulin C2set domain; (TM)
transmembrane region;
and (C3) complement
regulatory repeat. The
number of domains
underlying the CRD can
vary among family
members.
This legume lectin
is concanavalin A,
a flexible tetramer,
bound to
trimannoside,
which is
represented by the
red and silver
space-filling
models. The
green spheres
depict calcium
ions and the pink
spheres depict
manganese ions
This
representation of
a C-type trimer
lectin depicts a
cluster of three
carbohydrate
recognition
domains bound
to mannose,
shown as a red
stick model. The
adjacent neck
region of helices
is also
evident. The
green spheres
represent bound
calcium
The xylome
The xylem has always been considered as a transport system for water and mineral
salts absorbed by the root system to the aerial parts of the plants.
The recent discovery of proteins in the xylem sap was therefore surprising.
It turned out that some of the xylem
proteins are lectins.
What are grapevine lectins doing in
the plant xylem?
Could they be patrolling the xylem
in the search for invading
microorganims?
Agüero et al. 2008. Xylem Sap Proteins from Vitis vinifera L.
Chardonnay. Am. J. Enol. Vitic. 59: 306-311.
Pathogenesis: a changing exoglycome
Example 1: It has long been known that malignant transformation is associated with
abnormal glycosylation, resulting in expression of altered carbohydrate determinants.
Representation of the
multi-step process of
hematogenous metastasis
of cancer.
The process starts with the
intravasation of cancer cells
into the bloodstream in the
primary tumor lesion.
Cancer cells then travel
through the bloodstream,
where they interact with
various blood cells such as
leukocytes and platelets,
finally adhering to
endothelial cells somewhere
in the peripheral vessel
walls. Cell adhesion
mediated by the interaction
of E-selectin on endothelial
cells and sialyl Lewisa/x
determinant on cancer cells
is involved in this step.
Sialyl Lewisa/x determinants
Sialyl Lewisa and sialyl Lewisx are
composed of four monosaccharide
residues: neuraminic acid (NeuAc), Dgalactose (Gal), N-acetyl-Dglucosamine (GlcNAc), and L-fucose
(Fuc). The glycosidic linkages are
shown.
Carbohydrate structures for sialyl Lewisa (top)
and sialyl Lewisx (bottom) oligosaccharides.
Example 2a: How does influenza virus infect a host cell?
Hemagglutinin (HA), a viral coat glycosylated
lectin, binds to specific sialylated glycan
receptors in the respiratory tract, allowing the
virus to enter the host cell.
Hemagglutinin (HA) promotes
virus binding and entry whereas
neuraminidase (NA), allows virus
budding and release.
Example 2b: How does the influenza virus mutates and escapes the host immune system?
If measles is caused by a virus and it can only be caught once in a life time, why do we catch
the flu every year?
The two largest viral targets of the antibodies
are the HA and NA, since they are the most
exposed proteins of the virus. When the
antibodies bind to them, in addition to
signaling to macrophages and other types of
defense cells to attack the foreign body (the
virus), it can still prevent the functioning of the
virus.
Sialic
acid
Cell
Cell membrane
Antibody
The antibody connected to HA
prevents it from linking itself to
the sialic acid of the host cell.
Thanks to this immune response, after a few
days the influenza is unable to infect us. But
how is the virus able to return?
When it replicates its genome, the polymerase
of the influenza causes mutations which
change the composition of the viral proteins This process is called gradual antigenic drift.
Example 2c: How avian flu may become human?
The highly pathogenic H5N1 and the 2009 swine-origin
influenza A (H1N1) viruses have caused global outbreaks
and raised a great concern that further changes in the
viruses may occur to bring about a deadly pandemic.
Human respiratory cells have glycan receptors classified as
α-2,6; avian respiratory cells' glycan receptors are known as
α-2,3. This classification is based on how the sugars are
linked together when they are displayed on cells.
To cross the species barrier and infect the human population,
avian HA must change its receptor binding preference from a
terminally sialylated glycan that contains α-2,3 (avian)-linked
to α-2,6 (human)-linked sialic acid motifs, and this switch
could occur through only two mutations, as in the 1918
pandemic.
Influenza virus structure:
details of HA structure.
Targeting fungal exoglycome with lectins
Working hypothesis:
Are there host-induced changes in the exoglycome of Alternaria
alternata?
If so, the altered oligosaccharides may be used as targets to find
specific lectins or to develop specific monoclonal antibodies,
with potential applications in both therapy and/or diagnosis
Fungal pathogens are capable of modulating host gene expression to their
own benefit. This is dramatically demonstrated by the green island effect.
6
A detached barley leaf was inoculated
with Blumeria graminis formae specialis
hordei on one side and then placed in
darkness to accelerate senescence of
the leaf. The uninoculated (a) and
inoculated (b) sides are shown. The
cells underneath the colony remained
green, indicating that the fungus actively
suppressed senescence of host tissue.
Schulze-Lefert P and Vogel J (2000) Closing the ranks to
attack by powdery mildew. Trends in Plant Science 5, 343-348.
Pathogenesis: a changing fungal cell wall
It seems unlikely that fungal pathogens are capable of changing their cell wall carbohydrate
polymers to circumvent or avoid plant defences. However, some rust fungi do just that!
Barley powdery mildew (Blumeria graminis
formae specialis hordei) life cycle.
(Schulze-Lefert & Vogel. 2000. Trends in
Plant Science 5, 343-348).
During invasive growth of biotrophic rust fungi, the surface hyphae that grow within host leaves contain
chitosan, a deacetylation product of chitin (Ferreira et al. 2007. Molecular Plant Pathology, 8 : 677-700).
The ‘wolf intrudes in sheep’s
clothing’ (Schulze-Lefert &
Panstruga. 2003. Annu. Rev.
Phytopathol. 41, 641–667).
Targeting fungal exoglycome with lectins
Working plan:
- Determine the structure of host-free A. alternata exoglycome
- Isolate the fungal cell membrane
- Isolate the cell membrane proteome
- N-Glycan release from N-linked glycoproteins: peptide-N-glycosidase F
- Glycan – protein separation: protein precipitation with ethanol
- Glycan desalting: Hypercab cartridges
- Glycan structure: MALDI-TOF-MS
- Infect human macrophages and tomato cell cultures with A. alternata
- Compare the fungal exoglycomes
- Determine the structure of potentially-new host-induced oligosaccharides
A
B
(A) Strategies for N-glycan analysis of porcine
kidney membrane proteins. (B) Specificity of
exoglycosidase used in arrays. abs, A. ureafaciens
sialidase; cbα, green coffee bean α-galactosidase;
btg, bovine testis β-galactosidase; guh, S.
Pneumoniae β-N-acetylhexosaminidase.
Key to symbols: filled star: NeuAc; filled square:
GlcNAc; open circle: mannose; open diamond:
galactose; open diamond with spot: fucose; solid
connecting line β-linkage; broken connecting line α
-linkage. Linkage positions are shown in the box
by the lines connecting the symbols.
(a)
Positive
ion
MALDITOF
mass
spectrum of the glycans
present in extracts of
porcine kidney following
removal of the sialic
acids with A. ureafaciens
sialidase.
(b–d) MALDITOF mass
spectra of the same
glycans after additional
incubations with bovine
testis
β-galactosidase,
green coffee bean αgalactosidase and S.
Pneumonia
β-Nacetylhexosaminidase,
respectively. The highmass section of the
spectrum
has
been
magnified vertically.
Glossary of terms
ES: electrospray
GC-MS: gas chromatography-mass
spectrometry
LC-MS: liquid chromatography-mass
spectrometry
MALDI: matrix-assisted laser desorption
ionisation
MS/MS: tandem mass spectrometry,
whereby a molecular ion is selected and
fragmented
PNGase F: peptide N-glycosidase F, an
enzyme that cleaves between the
reducing-end carbohydrate and the
asparagine residue in N-linked glycans
Q-TOF: quadrupole/orthogonal acceleration
time-of-flight
TOF-TOF: two time-of-flight analysers
arranged in tandem
Glicoproteínas
São proteínas que possuem uma ou mais porções de hidrato de carbono (ou glicana) ligadas
covalentemente à cadeia polipeptídica através dos grupos laterais de resíduos de aminoácidos. Portanto, as
glicoproteínas são proteínas glicosiladas que adquiriram essa forma através do processo de glicosilação,
que é um dos conhecidos mecanismos de modificação pós-traducional das proteínas.
Há, assim, uma distinção marcante entre glicoproteínas e peptidoglicanas (que se consideram um grupo
distinto), pois que nestas estruturas, a componente hidrato de carbono é a fracção dominantes, que se
encontram interligados (cross-linked) por cadeias relativamente curtas de polipéptidos sintetizados por
processos independentes dos ribossomas e do rnRNA. Além destes aspectos, e dada a conhecida estereoselectividade que caracteriza o centro activo das enzimas, a presença de aminoácidos da série D nas
peptidoglicanas da parede celular de bactérias pode ser encarada como um mecanismo de fuga à acção
destrutiva das proteases do hospedeiro.
As glicoproteínas são glicósidos e, tal como estes, podem ser do tipo N- ou do tipo O- (N-glicoproteínas e Oglicoproteínas, portanto portadores de N- ou O-glicanas), dependendo do átomo do resíduo de aminoácido
a que as glicanas estão ligadas. Embora usualmente uma dada glicoproteína possua glicanas apenas de
um dos tipos, conhecem-se algumas que são simultaneamente do tipo N- e O- (p, ex., a fetuína bovina e a
imunoglobina humana A).
Existem várias diferenças marcantes entre glicoproteínas, nomeadamente se são de células procarióticas
ou eucarióticas e, por outro lado, se são do tipo N- ou O-. Considerando as glicoproteínas de eucariotas, as
N-glicoproteínas e as O-glicoproteínas começam logo por diferir no tipo de ligação e na natureza do resíduo
de aminoácido, da cadeia polipeptídica, a que a glicana se liga. Isso encontra-se exemplificado na figura
abaixo, onde se mostra a ligação entre o aminoácido e o hidrato de carbono nas glicoproteínas dos dois
tipos, N- e O-.
Nas N-glicoproteínas o aminoácido é sempre asparagina e o monossacárido que a ela se liga, a Nacetilglucosamina (GluNAc), em ligação amida de configuração β.
Além disso, nas N-glicoproteínas é necessário verificar-se uma adequada sequência de resíduos de
aminoácidos (sequência de ligação) para que o hidrato de carbono se possa ligar à cadeia polípeptídíca, é
ela N-X-T ou N-X-S, em que N = asparagina; T = treonina, S = serina e X um qualquer aminoácido.
Nas O-glicoproteínas, o aminoácido é frequentemente a serina ou a treonina (mas pode ser a
hidroxilisina, no colagénio, ou a hidroxiprolina, nas glicoproteínas das plantas) e o monossacárido é
frequentemente a N-acetilgalactosamina, em ligação éter, de configuração α, mas pode ser galactose, no
colagénio, N-acetilglucosamina, em glicoproteínas do núcleo e do citoplasma, manose, em glicoproteínas
das leveduras, e arabinose, em glicoproteínas de plantas (nas proteoglicanas é xilose).
Sugar residues of
glycoproteins and
glycolipids are
usually located on
the outside surface
of mammalian
plasma membranes.
Membranes of eukaryotic cells are usually between 2% and 10% carbohydrate, in the form of glycolipids
and glycoproteins.
One possible role of carbohydrate groups is to orient glycoproteins in membranes. Because sugars are
highly hydrophilic, the sugar residues of a glycoprotein or of a glycolipid will tend to be located at a
membrane surface, rather than in the hydrocarbon core. The cost in free energy of inserting an
oligosaccharide chain into the hydrocarbon core of a membrane is very high. Consequently, there is a
high barrier to the rotation of a glycoprotein from one side of a membrane to the other. The carbohydrate
moieties of membrane glycoproteins help to maintain the asymmetric character of biological
membranes.
Carbohydrates on cell surfaces may also be important in intercellular recognition. The interaction of
different cells to form a tissue and the detection of foreign cells by the immune system of a higher
organism are examples of processes that depend on the recognition of one cell surface by another.
Carbohydrates have the potential for great structural diversity. An enormous number of patterns of
surface sugars is possible because (1) monosaccharides can be joined to each other through any of
several hydroxyl groups, (2) the C-1 linkage can have either an α or a β configuration, and (3) extensive
branching is possible. lndeed, many more different oligosaccharides can be formed from four sugars
than oligopeptides from four amino acids.
Uma questão muito debatida é a da importância e função da porção glicana das glicoproteínas. No que
respeita às propriedades físicas, a desglicosilação leva frequentemente, mas não sempre, à alteração das
propriedades das glicoproteínas. Em muitos casos observa-se uma maior susceptibilidade à degradação
pelas proteases ou à desnaturação pelo calor, podendo suceder que a ausência da glicana impeça a
glicoproteína de adquirir a estrutura de nível terciária correcta e conduza à sua destruição pela célula.
Há muitos casos em que é notória a importância das glicanas das glicoproteínas, como nas interacções
que se exercem entre diversos componentes celulares, no encaminhamento de certas proteínas para os
locais celulares correctos e nas interacções célula a célula, inclusive na ligação de agentes patogénicos
humanos (bactérias, vírus, micoplasmas) às células que infectam.
Referem-se, a seguir, alguns exemplos:
- No aparelho de Golgi, receptores de manose-6-fosfato ligam proteínas com porções que contêm manose6-fosfato e encaminham-nos para os lisossomas.
- No sangue dos mamíferos, as glicoproteínas que têm resíduos de galactose ou GluNAc na extremidade
são retiradas pelos hepatócitos.
- No rato, as interacções espermatozóide/óvulo resultam da ligação de um receptor do espermatozóide a
O-glicanas do óvulo.
- No ser humano, o vírus da gripe liga-se a resíduos do ácido siálico da superfície das células que infecta.
- O exoglicoma da célula desempenham importantes funções biológicas, a nível da adesão célula-a-célula
e da interacção, sinalização e reconhecimento entre células.
- Disease development and progression is often associated with changes in the glycome – this has been
demonstrated in cancer cells.
Glicoproteínas
Questões:
1 – Descreva quatro diferenças principais que permitem distinguir glicoproteínas de
peptidoglicanas.
2 - Justifique as seguintes afirmações, modificando-as para a forma correcta quando não
forem verdadeiras:
a) A ligação peptídica apresenta carácter parcial de dupla ligação.
b) A ligação isopeptídica estabelece-se entre o grupo α-carboxilo de um aminoácido e o
grupo α–amina do aminoácido adjacente.
c) A hélice α é um tipo de estrutura de nível secundário das proteínas.
d) As interacções hidrofóbicas são as principais forças responsáveis pela aquisição da
estrutura de nível terciário das proteínas.
e) Glicoproteínas e peptidoglicanas são sinónimos.
LIPOPROTEÍNAS
São complexos entre lípidos e proteínas. Encontram-se, p. ex., no envelope bacteriano e no plasma
sanguíneo.
Nas bactérias, uma das mais frequentes é a que está associada à mureína e que é designada por
lipoproteína de Braun, com massa molecular de 7,2 kDa e a forma de vareta. Associa-se ao folheto interno
da membrana externa, existindo, no caso de Escherichia coli, c. 750.000 cópias por célula. Um terço deste
número está covalentemente ligado à peptidoglicana através do grupo ε-amina do resíduo de lisina presente
na extremidade COOH da proteína. Um resíduo de cisteína da extremidade NH2 da lipoproteína foi
modificado, tendo o grupo sulfidrilo sido substituído por um diacilglicerol e o grupo amina por um ácido
gordo. A principal função desta lipoproteína é manter a integridade estrutural do complexo de peptidoglicana
da membrana externa.
No plasma sanguíneo existem várias lipoproteínas, cuja função é o transporte e a distribuiçâo de Iípídos
(lipidos absorvidos dos alimentos, vitaminas lipossolúveis, hormonas), através dos sistemas sanguíneo e
linfático. Costumam classificar-se de acordo com a sua densidade, em lipoproteínas VLDL (very low density
Iipoprotein), de muito baixa densidade, as LDL, de baixa densidade, e as HDL (high density), de alta
densidade.
Têm a importante função de transportar, na forma solúvel, os Iípidos de outro modo insolúveis no plasma.
As partículas de lipoproteínas contêm um núcleo hidrofóbico de estéres de colesterol e triacilgliceróis,
rodeado por uma monocamada de fosfolípidos a que se associam colesterol, na forma livre, e as
apolipoproteínas. Estas desempenham tanto a função de cofactores das enzimas, envolvidas no
metabolismo dos Iípidos presentes no núcleo das partículas lipoproteicas, como o papel de factores de
reconhecimento, durante os processos de secreção e de regulação da absorção das lipoproteínas.
Aminoácidos, péptidos e
proteínas como
mecanismos de defesa
Na batalha química permamente que ocorre entre organismos, seja para o estabelecimento de patogénese,
seja numa competição para determinados recursos (alimento, território, luz, etc.), existe um sem-número de
substâncias que, embora sejam compostos naturais, podem exibir um nível elevadissimo de toxicidade.
Uma questão central que se coloca é como é que o organismo ou célula produtora
do composto tóxico evita, ela própria, ser intoxicada pelo seu produto tóxico?
Incluem-se compostos que não são naturalmente tóxicos para o organismo produtor, como por exemplo,
várias plantas produzem e acumulam hormonas sexuais de mamíferos (ex. os estrogénios estrona e
estradiol, bem como outras moléculas com actividade estrogénica) numa tentativa de evitar ou diminuir a
predação por ovelhas.
Noutras situações, a substância tóxica pode ser excretada para o meio circundante, como é o caso do
aminoácido não-proteico canavanina.
É relativamente frequente alguns aminoácidos não-proteicos estarem presentes nalgumas plantas em
concentrações muito elevadas. As sementes de certos géneros de leguminosas podem conter 10 a 15% da sua
massa em 5-hidroxitriptofano, canavanina e 3,4-di-hidroxifenilalanina.
A canavanina foi incialmente detectada em Canavalia ensiformis, mas ocorre em várias espécies de leguminosas.
A presença de 13% de canavanina em sementes de Dioclea megacarpa sugere que a função da canavanina é de
armazenar azoto, até porque é rapidamente metabolizada durante a germinação.
Mas a função de armazenamento não explica, por si só, porqure razão se acumula a canavanina e não um
aminoácido proteico igualmente rico em azoto como, por exemplo, a arginina.
A explicação parece residir no facto de a canavanina ser tóxica para roedores e insectos, os quais, na ausência
de canavanina, poderiam destruir as sementes de Dioclea megacarpa.
A produção de um aminoácido não-proteico por uma espécie pode também favorecâ-la, em termos competitivos,
contra outras espécies vegetais – função alelopática. As sementes de Glycine wightii em germinação libertam
canavanina para o meio, em concentrações que inibem o crescimento de plântulas de outras espécies.
A canavanina pode, assim, desempenhar três funções biológicas: proteger as sementes dormentes do ataque de
predadores, inibir a germinação/crescimento de outras plântulas vizinhas durante a germinação da espécie que a
produz e fornecer uma reserva de carbono, azoto e enxofre orgânicos para a plântula em crescimento.
Canavanina
(ácido 2-amino-4-guanidino-hidróxibutírico )
Arginina (Arg, R)
(ácido 2-amino-5-guanidovalérico)
Contudo, a regra mais geral é a substância tóxica inibir ou, pelo menos, perturbar também o metabolismo
celular do organismo produtor. E neste caso foram adoptadas várias estratégias, a grande maioria das
quais estão ainda por descobrir ou esclarecer.
Dentro dos casos aparentemente mais simples, pode citar-se a compartimentação celular, como são os
casos, por exemplo, dos taninos e dos glicósidos cianogénicos.
Assim, muitas plantas acumulam nas suas células taninos, em compartimentos celulares distintos daqueles
onde se encontram as proteínas do seu metabolismo normal (as chamadas housekeeping proteins). Deste
modo, os taninos não de ligam às suas proteínas, excepto quando as estruturas celulares são destruídas
após ingestão por um animal herbívoro, situação em que se complexam com as proteínas, tornando-as
indigeríveis para o predador.
Também as plantas cianogénicas, como por exemplo a mandioca, armazenam glicósidos cianogénicos,
desprovidos de toxicidade, num compartimento celular distinto daquele onde se localiza a respectiva
glicosidade. Ao ser destruída a compartimentação celular, na sequência de predação, a glicosidase é posta
em contacto com o glicósido cianogénico, o que resulta na hidrólise da ligação que liga o açúcar ao ácido
cianídrico e na expressão do efeito tóxico deste último.
Cyanogenic glycosides in plants
The cyanogenic glycosides may be defined chemically as glycosides of the α-hydroxynitriles and belong to
the secondary metabolites of plants. They are amino acid-derived plant constituents. The biosynthetic
precursors of the cyanogenic glycosides are different L-amino acids, which are hydroxylated, then the Nhydroxylamino acids are converted to aldoximes and these are converted into nitriles and hydroxylated to αhydroxynitriles and then glycosylated to cyanogenic glycosides. All known cyanogenic glycosides are βlinked, mostly with D-glucose.
There are at least 2650 species of plants that produce cyanogenic glycosides and usually also a
corresponding hydrolytic enzyme (beta-glycosidase), which are brought together when the cell structure of
the plant is disrupted by a predator, with subsequent breakdown to sugar and a cyanohydrin, that rapidly
decomposes to hydrogen cyanide (HCN) and an aldehyde or a ketone. The glycosides, cyanohydrins and
hydrogen cyanide are collectively known as cyanogens. This combination of cyanogenic and hydrolytic
enzyme is the means by which cyanogenic plants are protected against predators.
There are approximately 25 cyanogenic glycosides known with the major cyanogenic glycosides found in the
edible parts of plants being: amygdalin (almonds); dhurrin (sorghum); linamarin (cassava, lima beans);
lotaustralin (cassava, lima beans); prunasin (stone fruit); and taxiphyllin (bamboo shoots).
The toxicity of a cyanogenic plant depends primarily on the potential concentration of hydrogen cyanide that
may be released upon consumption. If the cyanogenic plant is inadequately detoxified during processing or
preparation of the food, the potential hydrogen cyanide concentration which may be released can still be
high. Upon consumption of a cyanogenic plant, β-glycosidase will be released during digestion and remain
active until deactivated by the low pH of the stomach. This enzyme will hydrolyse the cyanogenic glycoside
and release at least part of the potential hydrogen cyanide content of the plant.
GLYCOSIDE CONTENT OF CASSAVA
The actual level of cyanogenic glycosides of a cyanogenic plant is influenced by various factors, both
developmental (endogenous) and ecological (exogenous). The development cycle of cyanogenic plants
shows characteristic changes in cyanogenic glycoside (and HCN) content.
Cassava
In cassava, the major cyanogenic glycoside is linamarin, while a small amount of lotaustralin (methyl
linamarin) is also present, as well as an enzyme linamarinase. Catalyzed by linamarinase, linamarin is
rapidly hydrolysed to glucose and acetone cyanohydrin and lotaustralin hydrolysed to a related cyanohydrin
and glucose. Under neutral conditions, acetone cyanohydrin decomposes to acetone and hydrogen
cyanide. This reaction for linamarin is shown below.
If the cassava plant is not adequately detoxified during the processing or preparation of the food, it is
potentially toxic because of the release of this preformed hydrogen cyanide. The hydrogen cyanide is readily
removed during processing of cassava, however, the presence of residual linamarin and its acetone
cyanohydrin in cassava-based food products has the potential to cause adverse health effects.
There are many varieties of cassava and the cyanide content differs as well as the suitability for different
growing and consumption conditions. Usually higher cyanide content is correlated with higher yields. During
periods of drought the cyanide content of both sweet and bitter cassava varieties increases. Bitter cassava
varieties are more drought resistant and thus more readily available and cheaper. However, owing to food
shortage in times of drought, less time is available for the additional processing required.
Values from 15 to 400 mg/kg of hydrocyanic acid in cassava roots on a fresh weight basis have been
mentioned in the literature. Sweet varieties of cassava will typically contain approximately 15 to 50 mg/kg of
hydrogen cyanide on fresh weight basis. Cassava leaves contain approximately 10% more linamarin than
cassava roots.
Aminoácidos
São numerosos os casos conhecidos em que os aminoácidos não proteicos interferem com o crescimento
e/ou o metabolismo em plantas, animais e microrganismos. Está bem documentada a toxicidade de vários
aminoácidos não-proteicos. De entre os aminoácidos não proteicos que exibem toxicidade, muitos possuem
estruturas muito parecidas das de aminoácidos proteicos, isto é, são análogos estruturais de aminoácidos
proteicos. A canavanina, por exemplo, tem uma configuração molecular que pouco difere da da arginina. Outro
exemplo, a mimosina, tem um carácter aromático e uma estrutura semelhante às da fenilalanina e tirosina.
Também o ácido azetidina-2-carboxílico é um iminoácido análogo do iminoácido proteico prolina, enquanto a
albizina é um análogo bda glutamina.
O facto de uma molécula análoga possuir uma forma e uma polaridade muito similar ao de um aminoácido
proteico sugere que o antagonismo metabólico resulta do análogo imitar o comportamento do composto
normal nos processoa metabólicos.
A toxicidade dos aminoácidos não-proteicos que são análogos de aminoácidos proteicos pode resultar de
três mecanismos disitntos:
Inibição da absorção de aminoácidos. A molécula análoga compete com o substrato normal na ligação à
permease responsável pela absorção do aminoácido.
Ex. o ácido azetidina-2-carboxílico afecta (e acaba por conduzir à morte de) plântulas de Phaseolus aureus
por inibir a absorção de prolina, ao competir com o iminoácido proteico para a permease responsável pela
sua entrada nas células.
Inibição a nível da biossíntese de aminoácidos. O análogo de aminoácido pode agir com inibidor da síntese
do aminoácido proteico, quer competindo directamente com o substrato normal em relação ao centro activo
de uma enzima ou por imitar o papel do produto final de uma via de síntese de aminoácidos na sua inibição
por “feedback” sobre um dos primeiros passos da via.
Um exemplo do primeiro caso é fornecido pela albizina, um análogo da glutamina, produzida por Acacia
farnesiana e por Albizzia lophantha, sobre a enzima asparagina sintetase. Um exemplo do segundo caso é
dado pela S-aminoetilcisteína, um análogo da lisina que contém um átomo de enxofre em vez do grupo
metilénico do átomo 4 da lisina. Inibe o crescimento de, por exemplo, cevada, porque imita o papel do
produto final que conduz à formação do aminoácido proteico, neste caso a lisina. Limita assim a
quantidade de lisina sintetizada numa situação em que esta não se encontra em excesso.
Incorporação de aminoácidos não proteicos em proteínas. Um análogo estrutural de um aminoácido
proteico pode competir com o aminoácido proteico no processo de activação catalisado pelas aminoaciltRNA sintetases, a reacção inicial da sequência responsável pela incorporação dos aminoácidos em
moléculas de proteína. A molécula análoga pode comportar-se como um inbidor competitivo mas, mas
frequentemente, é aceite pela sintetase como um substrato alternativo e é incorporado numa forma
anómala da proteína.
Incorporação de aminoácidos não proteicos em proteínas
As proteínas são construídas a partir dos 20 aminoácidos proteicos, os quais são incialmente activados por
uma reacção com o ATP catalisada por 20 aminoacil-tRNA sintetases. Cada uma destas enzimas é
fortemente específica para cada um dos aminoácidos proteicos e catalisa duas reacções:
Reacção de activação:
Aminoácido + ATP  aminoacil-AMP + PPi
Reacção de transferência para o tRNA:
Aminoacilo-AMP + tRNA  aminoacil-tRNA + AMP
Os resíduos de aminoacilo são reguladamente transferidos dos complexos activados formados na 1ª reacção
para moléculas específicas de tRNA (2ª reacção). É nestes dois passos, catalisados pela mesma enzima,
que ocorre fase crítica de selecção dos aminoácidos, pois, aparentemente, pouca discriminação tem lugar
nos passos posteriores associados à incorporação dos resíduos de aminoácidos nos polipéptidos em
alongamento.
A grande especificidade das aminoacil-tRNA sintetases assegura uma selecção quase perfeita dos
substratos, dentro dos aminoácidos proteicos. Contudo, certos aminoácidos não proteicos podem actuar
como substratos alternativos com certas enzimas e, então, podem ser anormalmente inroduzidos em
molécuilas de proteína.
A azetidina-2-carboxilato é um bom exemplo deste tipo de comportamento.
A inibição do crescimento de plântulas ou de culturas de bactérias causada pela azetidina-2-.carboxilato
resulta, em larga medida, da sua introdução em proteínas celulares, em substituição da prolina.
Uma vez que a presença de prolina num polipéptido conduz a uma interrupção da estrutura em hélice α e a
uma alteração na orientação do eixo da cadeia, tais resíduos desempenham um papel importante na
determinação da estrutura de nível terciário final da proteína.
Os rizomas da liliácea Polygonatum muiltiflorum
conêm cerca de 6% de azetidina-2-carboxilato.
A substituição de um resíduo de prolina por um resíduo de azetidina-2-carboxilato produz, inevitavelmente,
diferentes ângulos de ligação nestas importantes regiões intramoleculares. Uma substituição extensiva de
prolina numa mesma molécula de proteína produzirá uma marcada alteração na sua conformação final e, em
consequência, uma modificação na reactividade das proteínas enzimaticamente activas.
Foram estudadas as propriedades cinéticas de prolil-tRNA sintetases isoladas de espécies formadores
(Polygonatum multiflorum, uma liliácea) e de espécies não-formadoras (Phaseolus aureus, uma leguminosa)
do análogo.
Nas espécies não formadoras de azetidina-2-carboxilato, a prolil-tRNA sintetase activava o análogo a uma taxa
que era de 38% da taxa a que a prolina era activada. Nas espécies produtoras, a enzima não exibia afinidade
para o análogo
Esta capacidade da espécie produtora em fazer uma discriminação enzimática contra o seu próprio produto
tóxico, assegura que o análogo não seja incorporado nas suas proteínas, evitando a síntese de enzimas
ineficazes e estruturalmente anómalas.
Outros estudos demonstraram que este fenómeno é de ocorrência frequente. Espécies como a beterraba
sacarina, que contêm apenas quantidades vestigiais de azetidina-2-carboxilato, comportam-se
enzimaticamente como não-produtoras.
As observações feitas permitem inferir que nas espécies produtoras de azetidina-2-.carboxilato, o centro de
ligação para o substrato da prolil-tRNA sintetase pode acumular uma molécula ligeiramente mais volumosa do
que a maioria das espécies não-produtoras. A azetidina-2-carboxilato, sendo menos volumosa que a prolina,
encaixa muito frouxamente no centro de ligação e, por tal razão, não é activada.
Estudos similares foram feitos com as glutamil-tRNA sintetases relativamente aos análogos do glutamato, γhidroxi-L-glutamato e γ-metil-L-glutamato e com as fenilalanil-tRNA sintetases em relação aos análogos da
fenilalanina.
O latirismo
Há dois tipos de latirismo:
Lathyrism or neurolathyrism is a neurological disease of humans and domestic animals, caused by eating
certain legumes of the genus Lathyrus. This problem is mainly associated with Lathyrus sativus (grass pea)
and to a lesser degree with L. cicera, L. ochrus and L climenum containing the toxin β-oxalyl-L-α,βdiaminopropionic acid (ODAP).
L-Glutamic
acid
β-Oxalyl-L-α,β-diaminopropionic acid (ODAP). is the
neurotoxin responsible for lathyrism
β-Oxalyl-L-α,β-diaminopropionic acid (ODAP), also known as β-N-oxalyl-amino-L-alanine (BOAA), is a nonprotein amino acid neurotoxin, that is a structural analogue of L-glutamic acid.
The consumption of large quantities of Lathyrus grain containing high concentrations of the ODAP, causes
paralysis, characterized by lack of strength in or inability to move the lower limbs. A unique symptom of
lathyrism is the emaciation of gluteal muscles (buttocks). ODAP is a poison of mitochondria leading to
excess cell death, especially in motor neuros.
The first mentioned intoxication goes back to ancient India and also Hippocrates mentiones a neurological
disorder 46 B.C. in Greece caused by Lathyrus seed where lathyrism was occurring on a regular basis.
The lathyrism resulting from the ingestion of Lathyrus odoratus seeds (sweet peas) is often referred to as
odoratism or osteolathyrism, which is caused by a different toxin (β-aminopropionitrile) that affects the
cross-linking of collagen, a protein of connective tissues.
The importance of cross-linking to the normal functioning of collagen is demonstrated by the disease
lathyrism, which occurs in humans and other animais as a result of the regular ingestion of seeds from the
sweet pea Lathyrus odoratus. The symptoms of this condition are serious abnormalities of the bones, joints,
and large blood vessels, which are caused by an increased fragility of the collagen fibers. Since lathyris peas
form part of the diet of some peoples, the condition is well-known in humans and often causes curvature of
the spine and rupture of the aorta.
The biochemical problem/causative agent of lathyrism has been traced to the presence in the seeds of βcyanoalanine (a non-protein amino acid) and of its decarboxylation product, β-aminopropionitrile:
β-Aminopropionitrile, inactivates lysyl oxidase by covalently binding to its active site. This results in
markedly reduced cross-linking in the collagen of lathrytic animais.
Péptidos
Péptidos com actividade anti-fúngica
Ver textos de apoio
Referência:
De Lucca, A.J. and Walsh, T.J. (1999) Antifungal peptides: novel therapeutic compounds against
emerging pathogens. Antimicrobial Agents and Chemotherapy 43, 1–11.
Faloidinas e Amanitinas
The Death Cap, Amanita phalloides
This species causes most of the fatal
poisoning cases. First of all, there are
breathing problems and dizziness. Then
comes severe vomiting, diarrhoea and
dehydration. After three days, you begin
to feel better, but actually your liver is
being destroyed. Death usually happens
at least 6 days after consumption. The
Death Cap is not uncommon under oak.
Faloidinas e Amanitinas
As amanitinas, também designadas por amatoxinas, formam um grupo de actapéptidos bicíclicos,
constituídos por dois resíduos de leucina, um de isoleucina, um de di-hidroxi-isoleucina, um de asparagina, um
de hidroxiprolina, um de triptofano e um de cisteína. Incluem a α-amanitina, a β-amanitina, a δ-amanitina, a
amanina e a amanulina. São responsáveis, conjuntamente com as falotaxinas, pela toxicidade de certas
espécies de cogumelos do género Amanita, designadamente de Amanita phalloides.
A sua toxicidade deriva de inibirem a enzima RNA polimerase II (EC 2.7.7.6) das células eucariotas, o que
conduz ao desenvolvimento de necroses nas células da fígado e rins dos animais. Mais de 90% das mortes
por envenenamento causadas por cogumelos são devidas à ingestão de fungos do género Amanita.
As falotoxinas são heptapéptidos cíclicos que, conjuntamente com as amanitinas, são responsáveis pela
toxicidade de certas espécies de cogumelos do género Amanita, designadamente de Amanita phalloides. As
principais falotoxinas são a faloidina, a faloína e a falacidina.
A falacidina apresenta uma estrutura semelhante à faloidina, mas em que o grupo D-treonina-alanina se
encontra substituído por ácido valil-D-eritro-β-hidroxiaspártico.
As falotoxinas não são tão tóxicas como as amanitinas, mas actuam
mais rapidamente. Do ponto de vista estrutural, a sua toxicidade
depende da estrutura cíclica formada pelo heptapéptído e da ligação
tioéter característica que se estabelece entre o grupo indole do resíduo
de triptofano e o grupo mercapto da cisteína.
Os valores de LD50 para ratinhos são, expressos em mg por kg de peso,
de 1,35 para a faloína, de 1,85 para a faloidina e de 2,5 para a
falacidina.
O seu efeito tóxico é contrariado pela antamanida, um decapéptido
cíclico que ocorre com as falotoxinas em A. phalloides. Contudo, a
antamanida não anula totalmente o efeito tóxico global produzido por
envenenamento faloídico, o qual pode ser eficazmente contrariado com
ácido α-lipóico. As falotoxinas têm sido utilizadas nos estudos dos
microfilamentos do citosqueleto pela utilização de alguns seus análogos
fluorescentes.
Proteínas
As proteínas per si
Os polipéptidos são sintetizados nos polissomas numa forma desenrolada, adquirindo posteriormente a sua
conformação biologicamente activa num processo que é regido pelas leis da termodinâmica. Assim, qualquer
proteína se enrola para a conformação biologicamente activa “movida” por um factor de natureza entrópica (i.e. a
destrução das “gaiolas de água”, formadas num meio aquoso em torno das cadeias laterais hidrofóbicas dos
resíduos de aminoácidos, conduz a um aumento da entropia do sistema), de tal modo que esta conformação tem
um conteúdo de energia inferior (i.e. é mais estável) que as outras conformações – e é por este motivo que as
cadeias polipeptídicas das proteínas se enrolam para a sua conformação biologicamente activa.
No meio aquoso em que se encontra a grande maioria das proteínas, este processo faz com que o polipéptido se
enrole, levando as cadeias laterais hidrofóbicas dos resíduos de aminoácidos para o interior da sua estrutura,
longe do contacto (termodinamicamente instável) com a água, mas deixando à sua superfície inúmeras cadeias
laterais hidrofílicas, que podem interagir livremente com as moléculas de água do meio circundante.
Dada a mobilidade térmica das moléculas (tal como ocorre a temperaturas superiores a -273,15 OC) e o facto de
a energia de estabilização das proteínas na sua conformação nativa ser muito baixa, acontece muito
frequentemente, à escala molecular, o desenrolamento parcial e ocasional das cadeias polipeptídicas, expondo
grupos não polares ao contacto com a água. Esta instabilidade pode ser resolvida de duas maneiras: o
polipéptido volta a adquirir a conformação biologicamente activa ou encontra uma parte hidrofóbica de outra
molécula proteica parcialmente desenrolada e associa-se a ela, num processo também de natureza entrópica. E
isto pode acontecer sucessivamente até à formação de agregados proteicos enormes, pela adição sempre
sucessiva de novas moléculas parcialmente desenroladas.
As células têm, por isso, sistemas cuja complexidade está ainda muito longe de ser compreendida e que
detectam e degradam rapidamente as proteínas parcialmente desenroladas, evitando a formação dos grandes
agregados proteicos. É o caso, por exemplo, da via proteolítica da ubiquitina/proteassoma.
O meio celular está, por isso, permanentemente sob o escrutínio de sistemas proteolíticos, no sentido de evitar a
formação de agregados que podem ocorrer espontaneamente em condições de temperaturas elevadas ou em
consequência da formação de proteínas estruturalmente anómalas, portadoras de erros resultantes de mutações
ou de erros a nível da transcrição e/ou tradução.
Quando ocorre formação de agregados proteicos, torna-se impossível para as células e ou enzimas proteolíticas
degradar as proteínas presentes nos agregados.
Estes agregados podem envolver a formação de diversos tipos de ligações entre as proteínas que os compõem:
- Ligações covalentes entre as proteínas constituintes – é o caso dos corpos de Lewy, característicos das células
cerebrais dos pacientes com doença de Parkinson, compostos por moléculas de ubiquitina e de α-sinucleína.
Notar que as doenças neurodegenerativas que afectam o homem se caracterizam pela formação de agregados
proteicos que as enzimas proteolíticas dos neurónios são incapazes de degradar.
- Ligações electrostáticas, como as que caracterizam a acumulação das proteínas de reserva das leguminosas
(globulinas) nos PSVs (do Inglês Protein Storage Vacuoles) das suas sementes. Nestas partículas, as proteínas
são empacotadas sob a forma de grandes agregados proteicos, com os metais alcalino-terrosos (neste caso o
cálcio e, em menor extensão, o magnésio) a servirem de ponte electrostática entre duas cargas negativas de
duas moléculas proteicas adjacentes.
O mesmo mecanismo explica a formação do Tofu a partir das proteínas de reserva da soja e do Nigari™
(carbonato de cálcio e de magnésio).
- Interacções hidrofóbicas, que explicam a formação da coalhada, constituída por hiperagregados proteicos entre
as micelas de caseína, após estas sofrerem proteólise limitada por acção da renina do estômago dos ruminantes
ou das cardosinas da flor do cardo - ver texto de apoio da Enciclopedia Verbo sobre “As proteínas do leite”.
- Os priões, o agente “infeccioso” da doença de Creutzfeldt-Jakob (CJD) no homem, do scrapie nos ovinos e da
doença das vacas loucas nos bovinos, é uma proteína cerebral que pode assumir duas conformações principais:
uma dita normal, a outra patogénica porque induz idêntica conformação em moléculas adjacentes, que se
aglomeram, acabando por conduzir à formação dos agregados proteicos que caracterizam estas doenças - ver
texto de apoio da Enciclopedia Verbo sobre “Priões”.
A patogénese: uma interacção entre um agente patogénico e um hospedeiro, seja ele
o homem, um animal ou uma planta, pode ser considerada como uma guerra aberta,
composta por inúmeras batalhas, cujas armas são proteínas e compostos de baixa
massa molecular, sintetizados por ambos os organismos. O resultado final desta guerra
dita o estabelecimento de resistência ou de patogénese.
Os organismos superiores, quer plantas quer animais, encontram-se permanentemente em contacto com uma
enorme variedade de microrganismos patogénicos e não patogénicos. Contudo, sabendo que o estado normal de
uma planta ou animal é o saudável, o desenvolvimento de uma doença requer a ocorrência simultânea de um
estado susceptível do hospedeiro, de um estado virulento do agente patogénico e de um meio ambiente
favorável. Por outras palavras, nem todos os agentes patogénicos podem atacar todos os organismos, nem um
só organismo é susceptível à panóplia total de agentes patogénicos. Na realidade, apenas uma fracção diminuta
destes agentes é capaz de invadir, com sucesso, e provocar doença, em cada hospedeiro. Se, por um lado, a
virulência dos agentes patogénicos e a susceptibilidade dos hospedeiros variam ao longo dos seus ciclos de vida,
por outro, o desenvolvimento de uma doença depende fortemente das condições ambientais, como a
disponibilidade em água, a temperatura, etc. Por todos estes motivos, o estabelecimento de uma doença é
normalmente muito menos frequente do que o que seria de esperar.
A presença de agentes patogénicos ao longo de centenas de milhões de anos permitiu às plantas e animais o
desenvolvimento de uma ampla gama de ferramentas de defesa, intricadas e elaboradas. Este padrão surgiu a
partir do que se pode considerar um processo de co-evolução do tipo ping-pong, em que hospedeiro e agente
patogénico foram sucessivamente adicionando armas químicas ao longo de uma guerra perpétua. Sempre que
uma inovação defensiva era estabelecida no hospedeiro, novas maneiras de a ultrapassar eram desenvolvidas
pelo agente patogénico.
Este processo co-evolutivo complexo explica, provavelmente, não só casos de extrema especificidade, que se
estabeleceram entre muitos agentes patogénicos e os seus hospedeiros, como a ineficácia e/ou redundância de
alguns genes defensivos, que frequentemente codificam enzimas com actividades sobrepostas.
Nota: ver artigo dos textos de apoio intitulado “A Batalha Química para a Patogénese”.
O sistema imunológico
- Anticorpos policlonais
- Anticorpos monoclonais
- Abezimas
As noções de anticorpos policlonais, anticorpos monoclonais, antigénio, epítopo e
hapteno.
Aplicações de anticorpos em Medicina no diagnóstico de doenças e outras
condições fisiológicas.
Aplicações de anticorpos como ferramenta Bioquímica: as técnicas de ELISA e de
immunoblotting.
Via proteolítica da ubiquitina/proteassoma
proteassoma
26 S
Ub
Ub
Ub
Ub
Ub
E3
E2
Ub
Proteína
substrato
Péptidos e
aminoácidos
Proteina
substrato
E1
E3
E2
E1
E1
Ub
Ub
E2
Ub
Ub
Ub
Ub
Blot anti-Ub
Ub
Proteína total
Lemna minor L.
Lectinas
Lectinas são proteínas de origem não-imunológica (o que exclui os anticorpos
que reconhecem e se ligam a hidratos de carbono), que se ligam de modo estável
(exclui as enzimas que utilizam hidratos de carbono como substratos) a hidratos
de carbono.
Binding of lectins with opsonin activity to foreign substances such as bacteria
promote phagocytosis (A). After binding to the carbohydrate chains on erythrocyte
surface, hemolytic lectins induce membrane damage (e.g., by forming pores),
leading to hemolysis (B).
Microbes and lectins bind to carbohydrate receptors on cells
Cell surface lectin–
carbohydrate interactions.
Lectins serve as means of
attachment of different kinds of
cell as well as viruses to other
cells via the surface carbohydrates
of the latter. In some cases, cellsurface lectins bind particular
glycoproteins (e.g.,
asialoglycoproteins),
whereas in other cases the
carbohydrates of cell
surface glycoproteins or
glycolipids serve as sites of
attachment for biologically
active molecules that
themselves are lectins (e.g.
carbohydrate-specific
bacterial and plant toxins,
or galectins).
Venenos de aranhas, cobras e escorpiões
Muitos animais produzem venenos cujos princípios activos são polipéptidos ou proteínas. São os casos, por
exemplo, de aranhas, cobras e escorpiões.
veneno de aranha
Muitas aranhas têm glândulas de veneno, que é utilizado para paralisar e matar as suas presas, mas que
raramente é perigoso para o homem. É, porém, o caso das toxinas produzidas pela Latrodectus
tredecimguttatus, da Europa Setentrional, e pela viúva negra-da-américa (L. nactans). Os príncípios activos
do veneno são de natureza proteica e relacionados com os venenos de cobra e de escorpião. Contém,
ainda, enzimas hidrolíticas, como a hialuronidase e proteases, mas é desprovido de fosfolipases e de
agentes hemolíticos ou coagulantes.
veneno de cobra
É constituído por uma mistura de toxinas produzidas nas glândulas das cobras venenosas. Incluem um
conjunto de polipéptidos e proteínas muito tóxicas, que provocam a paralisia e morte da presa, e enzimas,
que facilitam a difusão das toxinas no corpo intacto da presa engolida e iniciam a sua digestão.
As proteínas tóxicas são classificadas em três grupos com base no seu modo de acção:
a) as cardiotoxinas são veneno do músculo cardíaco que originam a despolarização irreversível das
membranas celulares do músculo do coração e das células nervosas;
b) as neurotoxinas são venenos dos nervos que apresentam uma actividade idêntica à do curare - inibem a
transmissâo de impulsos nervosos;
c) os inibidores de proteases inibem a actividade da quimotripsina, da tripsina e da acetilcolinesterase e de
outras enzimas envolvidas na transmissão de impulsos nervosos.
Constituem exemplos destas toxinas a cobramina A, a cobramina B, a crotactina, a crotamina, a crotaxina e
a taipoxina.
As enzimas incluem a hialuronidase, que promove a dífusão das toxinas, a ATPase e a acetilcolinesterase,
envolvidas na paralisia da presa, fosfolipases, responsáveis pela hemólise, e proteinases e L-aminoácido
oxidases, de cuja acção resulta a necrose de tecidos e a coagulação do sangue.
Estima-se que morrem 30.000 a 40.000 pessoas por ano devido a mordeduras de cobras venenosas, das
quais cerca de 50 ocorrem na Europa. Muitos animais, como o ouriço cacheiro e o mangusto, possuem
imunidade natural contra os vevenos de cobra. São utilizadas grandes quantidades destes venenos na
preparação de anti-soros específicos em cavalos. Estes podem ser posteriormente utilizados na imunização
contra as mordeduras das cobras.
Alguns venenos de cobra têm aplicação terapêutica no tratamento de dores, de doenças reumáticas e de
epilepsia. Por estes motivos, as cobras venenosas são criadas em cativeiro. O veneno é recolhido ou por
mordedura numa membrana, com o veneno a ser injectado num reservatório de vidro, ou exercendo pressão
nas glândulas que o contêm. Estas técnicas permitem a extracção de uma quantidade de veneno por cobra
que varia, dependendo da espécie, entre umas dezenas e umas centenas de miligramas.
veneno de escorpião
Escorpiões pertencentes a vários géneros taxonómicos (Androctonus, Buthus, Centruroides, Leiurus, Tityus)
excretam veneno pelo aparelho “picador” da cauda, o qual contém diversos péptidos neurotóxicos (com
actividade no sistema nervoso, tanto periférico como central). Alguns destes péptidos, designados por
escorpaminas, assemelham-se em estrutura e acção com neurotoxinas de venenos de cobra
(nomeadamente da cobra capelo).
Verifica-se que, do ponto de vista celular, as neurotoxinas do escorpião exercem os seus efeitos nefastos
sobre o organismo animal, em consequência de interferirem com o funcionamento de canais iónicos, quer de
Na+, K+ ou Cl-.
Escorpião
(Lychas marmoreus)
Os péptidos que actuam sobre os canais de Na+ são os de maiores dimensões (contêm de 45 a 72
resíduos de aminoácidos) e é entre eles que se contam as escorpaminas. Recebem as designações mais
específicas de toxinas α (toxina I, toxina M7, toxina V, etc.), toxinas β, toxinas γ ou, ainda, toxinas
AaHIT4, AaIT, LqqIT, etc.
Os péptidos que actuam sobre os canais de K+ são bastante mais pequenos (de 31 a 39 resíduos de
aminoácidos), recebendo designações como: toxinas de Tityus, leiurotoxina I, iberiotoxina,
margatoxina, noxiustoxina, etc.
Os péptidos que actuam sobre canais de Cl- são também pequenos (cerca de 36 resíduos de
aminoácidos), sendo exemplo a clorotoxina.
As manifestações macroscópicas do efeito destas várias toxinas são bastante variáveis com a toxina e com
os organismos sobre que actuam, os quais podem ser insectos (como baratas), caranguejos, ratos, coelhos,
mamíferos de maiores dimensões ou mesmo o homem. As α-toxinas (toxina I) do escorpião do Norte de
África (Androctonus australis) são péptidos com cerca de 64 resíduos de aminoácidos, que se contam entre
os mais potentes venenos neurotóxicos. Produzem hiperexcitabilidade muscular, aceleração da respiração,
convulsões, parálise espástica e, eventualmente, paragem respiratória.
Proteinas com actividade anti-fúngica e proteinas PR (do Inglês Pathogenesis related)
Referência:
Ferreira, R.B., Monteiro, S., Freitas, R., Santos, C.N., Chen, Z., Batista, L.M.,
Duarte, J., Borges, A. e Teixeira, A.R. (2007) The role of plant defence proteins
in fungal pathogenesis. Molecular Plant Pathology, 8 : 677-700.
Ricina
Trata-se de uma lectina fortemente tóxica, presente nas sementes do rícino (Ricinus communis). É uma
toxalbumina.
É uma glicoproteína composta por 493 resíduos de aminoácidos (66 kDa), constituída por uma cadeia
polipeptídica A (32 kDa) e uma cadeia polipeptídica B (34 kDa), unidas por uma ligação de persulfureto.
Após separação redutiva das duas cadeias por tratamento com 2-mercaptoetanol, ambas as cadeias
apresentam uma actividade inibitória aumentada, mas uma toxicidade marcadamente reduzida. A
actividade tóxica é conferida pela cadeia A (efectómero), servindo a cadeia B (haptómero) para ligar a
toxina à superfície celular.
A ricina inibe a biossíntese das proteínas (provoca a dissociação dos polissomas) e exibe propriedades
antitumor. A dose letal, determinada em ratinhos, é de 1 ng de azoto de ricina por g de peso corporal. A
alta toxicidade da ricina para as células eucariotas resulta da seguinte sequência de acontecimentos:
a) A ricina liga-se às células por interacção entre a sua cadeia polipeptídica B e resíduos de galactose de
receptores presentes na superfície da célula.
b) A ligação de persulfurero da ricina é subsequentemente cortada, permitindo a entrada da sua cadeia
polípeptídíca A para o interior da célula por endocitose.
c) A cadeia A liga-se então às proteínas da subunidade 60S do ribossoma, aparentemente na região dos
centros de ligação dos factores de alongamento eEF-1 e eEF-2, bloqueando a tradução de proteínas.
Aminoácidos, péptidos e proteínas como mecanismos de defesa
Questões:
1 – Alguns aminoácidos não proteicos são análogos estruturais de aminoácidos proteicos,
podendo, em determinadas condições, ser mesmo incorporados em polipéptidos durante o
mecanismo de síntese proteica. Como conjuga esta informação com a definição de
aminoácido não-proteico?
2 - A toxicidade manifestada por muitos aminoácidos, péptidos e proteínas leva a que sejam
utilizados como mecanismos de defesa por uma grande variedade de organismos. Esta
adaptação coloca, inevitavelmente, um problema para o organismo que acumula o composto
tóxico: como evitar intoxicar-se com o seu próprio produto tóxico?
a) Dê um exemplo de um aminoácido, de um péptido e de uma proteína que sejam utilizados
como mecanismos de defesa.
b) Descreva um estratégia utilizada por um organismo para não ser intoxicado pelo seu
próprio produto tóxico.
FIM