Engineered Antibodies for the Therapy of Cancer and Inflammatory
Transcrição
Engineered Antibodies for the Therapy of Cancer and Inflammatory
Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Von der Fakultät Energie-, Verfahrens- und Biotechnik der Universität Stuttgart zur Erlangung der Würde eines Doktors der Naturwissenschaften (Dr. rer. nat.) genehmigte Abhandlung Vorgelegt von Kirstin Anja Zettlitz aus Wiesbaden Hauptberichter: Prof. Dr. Roland Kontermann Mitberichter: Prof. Dr. Klaus Pfizenmaier Tag der mündlichen Prüfung: 27.09.2010 Institut für Zellbiologie und Immunologie Universität Stuttgart 2010 I hereby declare that I performed the present thesis independently without further help or other materials than stated. Kirstin Anja Zettlitz Stuttgart, July 20, 2010 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Contents Table of Contents Table of Contents .................................................................................................................................... 3 Abbreviations .......................................................................................................................................... 6 Summary ................................................................................................................................................. 8 Zusammenfassung................................................................................................................................. 10 1 Introduction ................................................................................................................................... 12 1.1 Therapeutic antibodies.......................................................................................................... 12 1.2 Antibody structure ................................................................................................................ 17 1.3 Antibody functions ................................................................................................................ 18 1.3.1 Complement-dependent cytotoxicity, CDC ................................................................... 18 1.3.2 Antibody-dependent cellular cytotoxicity, ADCC .......................................................... 19 1.3.3 Cross-presentation ........................................................................................................ 19 1.3.4 FcRn ............................................................................................................................... 20 1.4 Antibody optimization ........................................................................................................... 20 1.4.1 Strategies to optimize structures: ................................................................................. 20 1.4.2 Immunogenicity ............................................................................................................. 21 1.4.3 Antigen binding ............................................................................................................. 21 1.4.3.1 Specificity............................................................................................................... 21 1.4.3.2 Affinity ................................................................................................................... 22 1.4.4 Fc domain modulation................................................................................................... 23 1.4.5 Pharmacological properties........................................................................................... 24 1.5 Targets ................................................................................................................................... 25 1.5.1 Heat shock protein 70 (Hsp70) in cancer ...................................................................... 25 1.5.2 Tumor necrosis factor (TNF) in inflammatory diseases................................................. 27 2 Materials and Methods ................................................................................................................. 30 2.1 Materials................................................................................................................................ 30 2.1.1 Instruments ................................................................................................................... 30 2.1.2 Special Implements ....................................................................................................... 30 2.1.3 Chemicals....................................................................................................................... 31 2.1.4 Peptides ......................................................................................................................... 31 2.1.5 Media and supplements ................................................................................................ 31 2.1.5.1 Bacterial culture .................................................................................................... 31 2.1.5.2 Cell Culture ............................................................................................................ 32 2.1.5.3 Antibiotics .............................................................................................................. 32 2.1.6 Solutions ........................................................................................................................ 32 2.1.7 Bacteria and phage ........................................................................................................ 33 2.1.8 Cell lines......................................................................................................................... 33 2.1.9 Antibodies...................................................................................................................... 33 2.1.10 Antigens ......................................................................................................................... 34 2.1.11 Enzymes ......................................................................................................................... 34 2.1.12 Restriction Enzymes ...................................................................................................... 34 2.1.13 Kits, Marker ................................................................................................................... 35 2.1.14 Primer ............................................................................................................................ 35 2.1.14.1 Primer for cloning of IgG humex ........................................................................... 35 2.1.14.2 Primer for Hsp70 fragments .................................................................................. 35 2.1.14.3 Primer for mutagenesis ......................................................................................... 36 2.1.14.4 Primer for screening or sequencing ...................................................................... 36 2.1.15 Vectors........................................................................................................................... 37 2.2 Methods ................................................................................................................................ 37 2.2.1 Cloning ........................................................................................................................... 37 3 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Contents 2.2.1.1 Bacterial culture .................................................................................................... 37 2.2.1.2 Chemical competent E. coli cells ........................................................................... 37 2.2.1.3 Electro competent E. coli cells............................................................................... 37 2.2.1.4 Polymerase chain reaction .................................................................................... 38 2.2.1.5 Site directed mutagenesis ..................................................................................... 38 2.2.1.6 Restriction digest, Ligation, Ethanol precipitation ................................................ 39 2.2.1.7 Antibody humanization ......................................................................................... 39 2.2.1.8 Cloning of IgG humex ............................................................................................ 40 2.2.1.9 Cloning of Hsp70 fragments .................................................................................. 40 2.2.1.10 Cloning of chimeric TNFR1-Fc fusion proteins ...................................................... 41 2.2.1.11 Heat shock transformation of E. coli TG1 .............................................................. 41 2.2.1.12 Electroporation of E.coli TG1 ................................................................................. 41 2.2.1.13 Screening of clones ................................................................................................ 41 2.2.1.14 Plasmid-DNA Isolation (Midi, Mini) ....................................................................... 42 2.2.1.15 Sequence Analysis ................................................................................................. 42 2.2.2 Phage display ................................................................................................................. 42 2.2.2.1 Preparation of helper phage ................................................................................. 42 2.2.2.2 Immunotube selection .......................................................................................... 42 2.2.2.3 Equilibrium selection ............................................................................................. 43 2.2.2.4 Rescue of phage libraries for selection with helper phage ................................... 44 2.2.2.5 Polyclonal phage ELISA .......................................................................................... 44 2.2.2.6 Screening of soluble scFv by ELISA ........................................................................ 44 2.2.3 Coupling peptides to carrier proteins ........................................................................... 45 2.2.4 Biotinylation of antigen ................................................................................................. 45 2.2.5 Protein production ........................................................................................................ 45 2.2.5.1 Periplasmic protein expression in E. coli TG1 (scFv, Hsp70-SBD, AlF-fusion)........ 45 2.2.5.2 Protein expression in BL21-DE3 (Hsp70-fragments) ............................................. 46 2.2.5.3 Production of IgG humex in CHO-K1 ..................................................................... 46 2.2.5.4 Production of chimeric TNFR1-Fc in HEK293......................................................... 46 2.2.6 Protein purification........................................................................................................ 46 2.2.6.1 Immobilized Ni+ affinity chromatography, IMAC .................................................. 46 2.2.6.2 Protein A affinity chromatography ........................................................................ 47 2.2.7 Protein characterization ................................................................................................ 47 2.2.7.1 SDS-PAGE, Immunoblot and Western Blot analysis .............................................. 47 2.2.7.2 Thermal stability .................................................................................................... 48 2.2.7.3 Deglycosylation...................................................................................................... 48 2.2.8 Affinity measurements .................................................................................................. 48 2.2.9 ELISA .............................................................................................................................. 48 2.2.10 Flow cytometry .............................................................................................................. 49 2.2.11 Cytotoxicity .................................................................................................................... 49 2.2.12 IL-6 and IL-8 assays ........................................................................................................ 49 2.2.13 Preparation of peripheral blood mononuclear cells (PBMC) ........................................ 49 2.2.14 Isolation of human polymorphonuclear cells (PMN) and flow cytometry assay for oxidative burst using dihydrorhodamine (DHR) ............................................................................ 50 3 Results ........................................................................................................................................... 51 3.1 Hsp70-specific antibodies for cancer therapy ....................................................................... 51 3.1.1 Chimerization of cmHsp70.1 (IgG tumex) ..................................................................... 51 3.1.2 Humanization of cmHsp70.1 ......................................................................................... 53 3.1.2.1 Analysis of mouse variable regions ....................................................................... 53 3.1.2.2 Design of reshaped human antibody .................................................................... 54 3.1.2.3 ScFv humex ............................................................................................................ 56 4 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 4 5 6 7 8 Contents 3.1.2.4 IgG humex.............................................................................................................. 57 3.1.3 Antibody glycosylation .................................................................................................. 58 3.1.4 Affinity measurement.................................................................................................... 59 3.1.5 Epitope mapping of Hsp70-specific antibodies ............................................................. 60 3.2 Antagonistic TNFR1-specific antibodies for therapy of inflammatory diseases.................... 64 3.2.1 Antibody constructs derived from humanized H398 (IZI-06.1) ..................................... 64 3.2.1.1 IZI-06.1 scFv ........................................................................................................... 64 3.2.1.2 IZI-06.1 Fab-HSA .................................................................................................... 65 3.2.1.3 IZI-06.1 scFv-HSA ................................................................................................... 66 3.2.1.4 IZI-06.1 IgG (ATROSAB) .......................................................................................... 66 3.2.2 TNFR1-Fc fusion proteins .............................................................................................. 68 3.2.3 Antigen specificity (species- and receptor-specificity) .................................................. 68 3.2.4 Thermal stability ............................................................................................................ 70 3.2.5 Affinity measurements .................................................................................................. 71 3.2.5.1 IZI-06.1 monovalent antibody constructs ............................................................. 71 3.2.5.2 ATROSAB, H398 ..................................................................................................... 72 3.2.6 Pharmacokinetics .......................................................................................................... 73 3.2.7 Antagonistic activity of TNFR1-specific antibodies ....................................................... 74 3.2.8 Epitope mapping ........................................................................................................... 78 3.2.9 Optimization of IZI-06.1................................................................................................. 79 3.2.9.1 Library construction............................................................................................... 80 3.2.9.2 Immunotube selection of library 1 (CDRH1/CDRL2) ............................................. 81 3.2.9.3 Immunotube selection of library 2 (CDRH2/CDRL1) ............................................. 83 3.2.9.4 Immunotube selection of library 2a (CDRH2) ....................................................... 83 3.2.9.5 Equilibrium selection of library 2a (CDRH2) .......................................................... 84 3.2.9.6 Immunotube selection of library 2b (CDRL1) ........................................................ 85 3.2.9.7 Summary of selections of CDR H1, H2, L1, L2 ....................................................... 87 3.2.9.8 ScFv IZI-06.1_mutants and combined scFv ........................................................... 88 3.2.9.9 Binding and activity of scFv IZI-06.1 derivates ...................................................... 88 Discussion ...................................................................................................................................... 91 4.1 Hsp70-specific antibodies for cancer therapy ....................................................................... 91 4.1.1 Chimerization of cmHsp70.1 (IgG tumex) ..................................................................... 91 4.1.2 Humanization of cmHsp70.1 (IgG humex) .................................................................... 92 4.1.3 Epitope mapping of Hsp70-specific antibodies ............................................................. 94 4.2 TNFR1-specific antibodies for therapy of inflammatory diseases......................................... 96 4.2.1 Mono- and bivalent derivatives of humanized IZI-06.1 ................................................ 96 4.2.2 Optimization of IZI-06.1................................................................................................. 99 References ................................................................................................................................... 103 Sequences.................................................................................................................................... 115 6.1 human Hsp70 ...................................................................................................................... 115 6.2 human TNFR1-Fc ................................................................................................................. 116 6.3 mouse TNFR1....................................................................................................................... 117 6.4 rhesus TNFR1 ....................................................................................................................... 117 Acknowledgements ..................................................................................................................... 118 Curriculum Vitae .......................................................................................................................... 119 5 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Abbreviations Abbreviations °C µ aa Ab / mAb ADCC Ag AlF3 AML amp APS AS bp BSA CD CDC CDR CEA CL CLL CRD CTL CTLA4 Da DC DHR DMSO DNA dNTP DTT EC50 ECD ECL EDTA EGFR degree celsius micro- (x10-6) amino acid (monoclonal) antibody antibody-dependent cellular cytotoxicity antigen domain 3 of HSA acute myeloid leukaemia ampicillin ammonium persulfate ankylosing spondylitis base pairs bovine serum albumin surface antigen, cluster of differentiation complement dependent cytotoxicity complementarity determining region carcinoembryonic antigen constant light chain domain chronic lymphocytic leukaemia cysteine rich domain cytotoxic T lymphocyte cytotoxic T lymphocyte antigen 4 Dalton, molecular weight dendritic cell dihydro-rhodamine dimethyl sulfoxide deoxyribonucleic acid deoxyribonucleoside dithiothreitol half maximal effective concentration extracellular domain enhanced chemiluminescence ethylenediaminetetraacetate epidermal growth factor ELISA Fab FBS / FCS Fc FcRn Fd FDA FITC FR Fv g glc GS h HACA HAHA HAMA HC / H HER2 HPLC HRP HSA Hsc70 Hsp70 / - SBD hu IC50 Ig / IgG IL IMAC receptor enzyme linked immunosorbent assay fragment antigen binding fetal bovine / calf serum fragment crystallizable neonatal Fc-receptor portion of the heavy chain that is included in a Fab food and drug administration fluorescein-5-isothiocyanate framework region fragment variable gram glucose glutamine synthetase hour human anti-chimeric antibody response human anti-human antibody response human anti-mouse antibody response heavy chain of an antibody human epidermal growth factor receptor 2 high performance liquid chromatography horse radish peroxidase human serum albumin constitutive heat shock protein 70 heat shock protein 70 / substrate binding domain human half maximal inhibitory concentration immunoglobulin (G) interleukin immobilized metal affinity chromatography 6 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz ITAM ITIM JIA k kan kcps KD l LC / L Lib / L M m mA MAC MCS MEF MHC min MMP mo MOA MS MSX mTNF / sTNF MW / Mr MWCO n NF-κB NHL NK cells OD PAGE PBMC PBS PCR PE PEG immunoreceptor tyrosinebased activation motif immunoreceptor tyrosinebased inhibitory motif juvenile idiopathic arthritis kilo (x103) kanamycin kilocycle per second (kilohertz) dissociation constant liter light chain of an antibody library molar [1M=1mol/l] mili- (x10-3), meter milliampere membrane attack complex multiple cloning site mouse embryonic fibroblast major histocompatibility complex minute matrix metallo-proteinase mouse mechanism of action multiple sclerosis L-methionine sulphoximine membrane / soluble TNF molecular weight / relative molecular mass molecular weight cut-off nano- (x10-9) nuclear factor-kappa B Non-Hodgkin’s lymphoma natural killer cells optical density polyacrylamide electrophoresis peripheral blood mononuclear cell phosphate buffered saline polymerase chain reaction pycoerythrin polyethylene glycol PK PLAD PMA QCM R r RA res Ssq rhe Rmax rpm RT s scFv SDR SEC SLE TAA TACE TACI TMB TNF / TNFR TRADD TRAF Tris UC VEGF VH, VL wt Abbreviations pharmacokinetics pre-ligand binding assembly domain phorbol 12-myristate 13acetate, phorbol-diester quartz crystal microbalance receptor recombinant rheumatoid arthritis residual sum of squares rhesus macaque maximal response rotations per minute room temperature second single-chain fragment variable specificity-determining residues size exclusion chromatography systemic lupus erythematosus tumour associated antigen TNF alpha converting enzyme transmembrane activator and calcium-modulating cyclophilin ligand interactor tetra-methylbenzidine tumor necrosis factor / receptor TNFR associated death domain TNFR associated factor tris-(hydroxymethyl)-aminomethane ulcerative colitis vascular endothelial growth factor variable domains of the heavy and light chain of an antibody, respectively wild type 7 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Summary Summary Detailed knowledge of the antibody structure and function allows researchers to engineer antibodies on a rational basis to design therapeutic antibodies dependent on the target antigen, therapeutic strategy and clinical setting. The development of therapeutic antibodies is a rapidly growing field with more than 30 antibodies approved over the past 25 years. Thereof, cancers as well as autoimmune and inflammatory diseases are the main indications. The purpose of the first part of this thesis was the cloning, chimerization and humanization of the monoclonal antibody (mAb) cmHsp70.1. This mouse mAb is specific for heat shock protein 70 (Hsp70) and able to bind the plasma membrane bound form (mHsp70), associated with various cancers including breast cancer, head-and-neck cancer, and acute myeloid leukemia. Humanization of cmHsp70.1 by grafting the complementarity-determining regions onto homologous human germline genes resulted in an antibody (humex) possessing a similar affinity (3 nM) as the parental antibody and an improved production and thermal stability. Epitope mapping confirmed that the parental, chimeric, and humanized antibodies recognize the same region including amino acids 473504 of the Hsp70 substrate binding domain (SBD). Hence, this humanized antibody provides a basis for further development of a mHsp70-specific antibody therapy. The purpose of the second part of this thesis was to evaluate an appropriate format and an optimization strategy for a humanized antibody (IZI-06.1) specific for human tumor necrosis factor receptor 1 (TNFR1). Selective inhibition of TNFR1 provides the opportunity to neutralize the proinflammatory activity of TNF while maintaining the advantageous immunological responses mediated by TNFR2. Here, this humanized antibody was converted into an IgG1 molecule (ATROSAB) containing a modified human Fc region deficient in mediating effector functions. IgG ATROSAB was compared to monovalent antibody derivatives fused to human serum albumin (HSA). Using chimeric human/mouse TNFR1 molecules, the epitope of ATROSAB was mapped to the N-terminal region (amino acid residues 1-70) comprising the first cysteine-rich domain (CRD1) and the A1 sub-domain of CRD2. Purified ATROSAB, produced in CHO cells, inhibited in vitro typical TNF-mediated responses like apoptosis induction and activation of NFκB-dependent gene expression such as IL-6 and IL-8 production. Moreover, ATROSAB showed strong binding to human and rhesus TNFR1-Fc fusion protein with an affinity identical to the parental mouse antibody H398. These findings open the way to further analyze the therapeutic activity of ATROSAB in relevant disease models in non-human primates. Furthermore, phage display technology was used for affinity maturation of the humanized variable domains by site directed mutagenesis of CDR1 and CDR2 of each VH and VL. Attempts 8 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Summary towards affinity maturation resulted in a mutant (scFv IG11) showing a two-fold increase in antigen binding affinity which also translated into slightly improved inhibition of TNF-mediated cytotoxicity in vitro. The results of this study indicate that further engineering of ATROSAB could offer a number of benefits for its therapeutic efficacy. TNFR1-selective antagonist, such as ATROSAB, will permit new therapeutic options for diseases where anti-TNF therapeutics failed or even exacerbate disease progression and could be an especially useful therapeutic alternative in diseases already known to clinically respond to anti-TNF treatment and particularly in those diseases where specific blockage of TNFR1 and maintenance of TNFR2 function appears as a promising therapeutic approach. 9 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Zusammenfassung Zusammenfassung Detailliertes Wissen um die Struktur und Wirkungsweise von Antikörpern ermöglicht es Wissenschaftlern, Antikörper nach rationalen Grundlagen zu gestalten, abhängig von Zielstrukturen, therapeutischen Strategien und klinischen Vorgaben. Die Entwicklung von therapeutischen Antikörpern ist ein schnell wachsendes Fachgebiet, mit über 30 zugelassenen Antikörpern in den letzten 25 Jahren. Die häufigsten Indikationen davon sind Krebserkrankungen, sowie Autoimmunund entzündliche Erkrankungen. Das Ziel des ersten Teils dieser Arbeit war die Klonierung, Chimärisierung und Humanisierung des monoklonalen Antikörpers (mAb) cmHsp70.1. Dieser Maus-Antikörper ist spezifisch für das HitzeSchock-Protein 70 (HSP70) und bindet dessen Plasmamembran-gebundene Form, welche mit verschiedenen Krebserkrankungen wie Brustkrebs, Kopf-Hals-Karzinom und akute myeloische Leukämie assoziiert ist. Die Humanisierung, durch Transplantation der „complementaritydetermining regions“ (CDR) auf humane homologe Keimbahngene, resultierte in einem Antikörper (humex) mit vergleichbarer Affinität (3 nM) zum ursprünglichen Antikörper und verbesserter Produktivität und thermischer Stabilität. Die Epitop-Kartierung bestätigte, dass der parentale, der chimäre und der humanisierte Antikörper dieselbe Region der Substrate-Binde-Domäne (SBD) erkennen, diese Region umfasst die Aminosäuren 473-504. Folglich bietet dieser humanisierte Antikörper eine Basis für die weitere Entwicklung einer Membran-Hsp70 spezifischen Antikörper Therapie. Die Zielsetzung im zweiten Teil dieser Arbeit war die Evaluierung eines geeigneten Formats und einer Optimierungs-Strategie für einen humanisierten Antikörper (IZI-06.1), der spezifisch für den humanen Tumor Nekrose Faktor Rezeptor 1 (TNFR1) ist. Die selektive Blockierung von TNFR1 erlaubt die Neutralisierung der entzündlichen Wirkung von TNF, während die positiven TNFR2-vermittelten Immunantworten bestehen bleiben. Dieser humanisierte Antikörper wurde hier in ein IgG Molekül (ATROSAB) konvertiert, das einen modifizierten, Effektor-Funktion defizienten, humanen Fc Teil enthält. IgG ATROSAB wurde mit monovalenten, Albumin-fusionierten (humanes Serum Albumin, HSA) Antikörperfragmenten verglichen. Mittels chimärer (Human/Maus) TNFR1 Moleküle wurde das Epitope von ATROSAB in der N-terminalen Region (Aminosäuren 1-70) kartiert, es umfasst die erste CRD (Cysteine-reiche Domäne) und die Subdomäne A1 der CRD2. In CHO Zellen produzierter und gereinigter IgG ATROSAB blockierte in vitro typische TNF-vermittelte Reaktionen wie die Induktion von Apoptose und die Aktivierung von NFκB-abhängiger Genexpression, wie die Produktion von IL-6 und IL-8. Darüber hinaus zeigte ATROSAB starke Bindung an humanes und rhesus TNFR1-Fc 10 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Zusammenfassung Fusionsprotein mit einer identischen Affinität wie der parentale Maus-Antiköper H398. Diese Ergebnisse ermöglichen die weitere Analyse der therapeutischen Wirkung von ATROSAB in relevanten Krankheits-Modellen in nicht-humanen Primaten. Des Weiteren wurde zur AffinitätsReifung der humanisierten variablen Domänen Phagen-Display und gezielte Mutagenese (site directed mutagenesis) der CDR1 und CDR2 von VH und VL eingesetzt. Die angestrebte AffinitätsReifung führte zu einer Mutante (scFv IG11) mit verbesserter Antigen-Bindungs Affinität, was zu einer ebenfalls leicht verstärkten Blockierung von TNF-vermittelter Zytotoxizität in vitro führte. Die Ergebnisse dieser Studie zeigen, dass weiteres Engineering von ATROSAB einige Vorteile für die therapeutische Wirksamkeit bieten kann. TNFR1-spezifische Antagonisten, wie ATROSAB, ermöglichen neue therapeutische Optionen für Krankheiten in denen Anti-TNF Therapeutika keine Wirkung zeigten oder sogar den Krankheitsverlauf beschleunigten und könnten eine therapeutische Alternative sein, für Krankheiten die klinisch auf anti-TNF-Behandlung ansprechen und besonders für Krankheiten in denen die spezifische Blockierung von TNFR1 und die Erhaltung der TNFR2 Funktionen ein vielversprechender therapeutischer Ansatz ist. 11 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction 1 Introduction 1.1 Therapeutic antibodies The research and development of monoclonal antibodies is a rapidly progressing field (Aggarwal 2009; Beck et al. 2010) with more than 30 antibodies or antibody derivatives approved for human therapy over the past 25 years (Beck et al. 2008; Reichert 2010). Thereof, cancer (Weiner et al. 2010), and autoimmune and inflammatory diseases (Chan and Carter 2010), are the main indications. The antibody properties of target specificity, low toxicity and the ability to activate the immune system suggest the continuing promise of therapeutic antibodies. The concept of using antibodies to selectively target tumors was proposed by Paul Ehrlich (“magic bullet”-concept) over a century ago (Ehrlich 1906). However, only with the invention of the hybridoma technology in 1975 (Köhler and Milstein 1975), the production of monoclonal antibodies (mAb) became possible and led to the approval of the first mouse monoclonal antibody muromonab eleven years later (1986, CD3-specific, Orthoclone OKT3; Janssen-Cilag) (Table 1-1). The mouse origin of mAbs accounts for their therapeutic limitations: these antibodies are generally highly immunogenic in humans, unable to induce human immune effector functions and have a short serum half-life of typically less than 20 hours (Carter 2001; Presta 2002), because they do not bind to the human neonatal Fc receptor (FcRn) (Ober et al. 2001). There are only two further mouse mAbs in the clinic (ibritumomab tiuxetan, Zevalin; Biogen Idec Inc. and 131 I-toditumomab, Bexxar; GlaxoSmithKline), both antibodies induce cell death by radiation and are approved for treatment of non-Hodgkin’s lymphoma. The event of antibody chimerization was first described in 1984 by S.L. Morrison (Morrison et al. 1984) (Table 1-1), and overcomes some of these limitations. A chimeric antibody is encoded by genes from more than one species; usually the variable (V; antigen binding) domains of a mouse monoclonal antibody are joined to the constant domains of a human antibody. The reduction of the mouse portion of an antibody lowers the risk of a mouse-specific antibody response in humans (HAMA, human anti-mouse antibodies), and enables the induction of Fc-mediated effector functions. Abciximab (glycoprotein IIβ-specific, ReoPro; Centocor/Eli Lilly), the first chimeric Fab fragment was approved in 1994, 10 years after the description of chimerization. The first full length chimeric antibody was approved in 1997 (rituximab, CD20-specific, Rituxan/Mabthera; Genentech/Roche/Biogen Idec), followed by infliximab in 1998 (TNF-specific, Remicade; Centocor/Merck). Even though chimeric antibodies show reduced immunogenicity, the immune system can develop a human anti-chimeric antibody response (HACA) thus limiting the half-life and 12 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction clinical efficacy of the therapeutic antibody (Hanauer et al. 2002; Baert et al. 2003) and can even lead to anaphylactic reactions in some patients (Vultaggio et al. 2009). In 1986 P.T. Jones et al. described antibody humanization as the next step to further increase the similarity of the therapeutic antibody to human antibodies (Jones et al. 1986). A common humanization method is CDR-grafting in which all the six complementarity determining regions (CDRs; that is the antigen-binding loops) of the non-human antibody are grafted onto a framework acceptor sequence of a human germline V gene that is similar to the variable domains of the antibody of interest (Jones et al. 1986; Verhoeyen et al. 1988). It took eleven years until the first humanized antibody was approved for immunosuppressive treatment in organ transplantations (1997, daclizumab, CD25-specific, Zenapax; Hoffman-La Roche) and from the currently approved therapeutic antibodies twelve are humanized. A further milestone of antibody engineering was described in 1990 by J. McCafferty: the phage display technology for the generation of fully human antibodies (McCafferty et al. 1990). This technology is based on the physical linkage of genotype and phenotype of an antibody fragment by displaying the protein on the surface of a bacteriophage that contains the gene encoding the displayed protein. A fully human antibody derived from phage display (adalimumab, TNF-specific, Humira; Abbott) was approved for the first time in 2002, 12 years after the description of phage display. Another technology for the generation of fully human antibodies was introduced in 1994 by L.L. Green (Green et al. 1994) (Abgenix mice) and by N. Lonberg (Lonberg et al. 1994) (Medarex mice): genetically engineered (transgenic) mice that express human antibody repertoires. Human antibodies are generated by antigen immunization to stimulate an in vivo humoral immune response to generate somatically mutated, affinity matured, secondary repertoire B cells. Subsequently, the B cells can be cloned and screened by conventional hybridoma technology. Those mAbs show often a high binding affinity and specificity, reflecting the importance of combinatorial diversity (encoded in the germline library of V, D, and J gene segments) and junctional and somatic diversity. At least 66 different therapeutic drugs, derived from either phage display or transgenic mice (e.g. 2006, panitumumab, EGFR-specific, Vectibix; Amgen), have entered human clinical trials. The reported binding affinities for these MAbs range over five orders of magnitude; however, most are subnanomolar and nearly 50 % have affinities in the 0.1 - 1 nanomolar range, with no preference of either technology. Yet, lead optimization as reported for phage display derived antibodies may not be required for transgenic mouse derived antibodies that have already undergone affinity maturation in vivo (Lonberg 2005). 13 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction So far, second generation antibodies have entered the clinic. These follow-up antibodies originate from approved therapeutic antibodies or are directed against the same validated antigens, but have alterations such as improved variable domains to decrease immunogenicity (humanized or human variable domains), altered affinity (affinity matured CDRs) or have different antibody formats (Fab fragments or Fc-fusion proteins). Examples are certolizumab pegol (2008, TNF-specific, Cimzia; UCB), a PEGylated Fab fragment of the IgG4 isotype, and golimumab (2009, TNF-specific, Simponi; Centocor), a fully human antibody derived from transgenic mice, following infliximab. In addition, third-generation antibodies have reached clinical trials (Strohl 2009; Oflazoglu and Audoly 2010). These antibodies target different epitopes, trigger other mechanisms of action (MOA) and are often engineered (glyco- or amino acid engineered Fc region) for improved Fc-associated immune functions or extended half-life. For example, obinutuzumab (CD20-specific, GA101; Biogen idec/Roche/Glycart) follows rituximab and is less immunogenic, has a different mechanism of action and is glyco-engineered for increased effector functions (Oflazoglu and Audoly 2010). Table 1-1: Therapeutic monoclonal antibodies and Fc fusion proteins for use in oncology, autoimmunity and inflammation. Adapted from (Chan and Carter 2010). year generic name (trade name; sponsoring company) 1975 Production of monoclonal antibodies by hybridoma technology invented by C. Milstein and G. Köhler (Köhler and Milstein 1975). Antibody chimerization first described by S.L. Morrison et al. (Morrison et al. 1984). muromonab-CD3 mouse CD3ε organ transplant modulates T cell function (Orthoclone OKT3; IgG2a rejection Janssen-Cilag) Antibody humanization first described by P.T. Jones et al. (Jones et al. 1986). Description of phage display technology for the generation of fully human antibodies by J. McCafferty and colleagues (McCafferty et al. 1990). abciximab chimeric CD41, cardiovascular prevents blood clotting (ReoPro; Centocor/Eli Fab (IgG1) glycodisease Lilly) protein IIb/IIIa Description of transgenic mice with human immunoglobulin genes by L.L. Green et al. (Abgenix mice) (Green et al. 1994) and by N. Lonberg et al. (Medarex mice) (Lonberg et al. 1994). rituximab chimeric CD20 NHL, RA sensitizes cells to chemo(Rituxan/Mabthera; IgG1 (inadequate therapy; induces apoptosis, Genentech/Roche/ responses to TNF ADCC and CDC Biogen Idec) blockade) and CLL daclizumab humanized CD25 (α organ transplant modulates T cell function (Zenapax; HoffmannIgG1 chain of IL- rejection La Roche) 2 receptor) basiliximab chimeric CD25 organ transplant modulates T cell function (Simulect; Novartis) IgG1 rejection 1984 1986 1990 1994 1997 1998 antibody format target indication proposed mode of action 14 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction infliximab (Remicade; Centocor/Merck) chimeric IgG1 TNF etanercept (Enbrel; Amgen/Pfizer) trastuzumab (Herceptin; Genetech/Roche) TNFR2 ECD-Fc (IgG1) humanized IgG1 TNF HER2 Crohn’s disease, RA, psoriatic arthiritis, UC, AS and plaque psoriasis RA, JIA, psoriatic arthritis, AS and plaque psoriasis breast cancer 2000 gemtuzumab ozogamicin (Mylotarg; Pfizer) CD33 AML 2001 alemtuzumab (Campath/MabCampa th; Genzyme/Bayer) 111 90 In/ Y-ibritumomab tiuxetan (Zevalin; Biogen Idec) adalimumab (Humira/Trudexa; Abbott) humanized IgG4calicheamicin conjugate humanized IgG1 CD52 CLL, MS ADCC mouse IgG2 radioconjugate human IgG1 (phage) CD20 lymphoma B cell depletion by radiation TNF RA, JIA, psoriatic arthritis, Crohn’s disease, AS and plaque psoriasis I-tositumomab (Bexxar; GlaxoSmithKline) omalizumab (Xolair; Genentech/ Roche/ Novartis) mouse IgG2 radioconjugate humanized IgG1 CD20 lymphoma neutralizes TNF activity by binding soluble and transmembrane TNF; lyses TNF-expressing cells by CDC; induction of activated T cell and macrophage apoptosis B cell depletion by radiation IgE-Fc moderate to severe persistent allergic asthma efalizumab (Raptiva; Genentech/ Merck Serono) alefacept (Amevive; Astellas) humanized IgG1 CD11a (LFA-1) psoriasis LFA3 ECDFc (IgG1) CD2 SLE cetuximab (Erbitux; ImClone Systems/ Bristol-Myers-Squibb) bevacizumab (Avastin; Genentech) chimeric IgG1 EGFR colorectal cancer humanized IgG1 VEGFA colorectal, breast and lung cancer 2002 2003 2004 131 neutralizes TNF activity by binding soluble and transmembrane TNF; induction of activated T cell and macrophage apoptosis neutralizes TNF activity by binding soluble and transmembrane TNF inhibition of receptor dimerization; downregulation of receptor; reduced proliferation, angiogenesis depletion of CD33 positive blasts ligand binding and receptor antagonism, reduces release of allergic response mediators inhibition of T cell migration ligand binding and neutralization; blocks activation of TACI inhibition of ligand binding and dimerization of EGFR, blocks EGFR activation; ADCC blocks binding of VEGF to its receptor; reduced angiogenesis 15 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 2005 2006 natalizumab (Tysabri; Biogen Idec/Elan) humanized IgG4 α4 subunit of integrins MS and Crohn’s disease nimotuzumab (Theracim/Theraloc; YM Biosciences/ Onco-sciences) abatacept (Orencia; BristolMyers Squibb) humanized IgG1 EGFR squamous cell carcinoma, head and neck cancer CTLA4 ECD-Fc, mutated IgG1-Fc humanized IgG1 CD80/ CD86 RA and JIA, UC and Crohn’s disease, SLE IL-6R RA, JIA affinity matured Fab, humanized IgG1 human IgG2 (mice) humanized IgG2-IgG4 hybrid humanized PEGylated IgG4 Fab human IgG1 (mice) mouse-rat hybrid VEGFA age-related macular degeneration anti-angiogenic, Inhibition of all subtypes of VEGFA EGFR colorectal cancer C5 complement protein TNF Paraxysmal nocturnal haemoglobinuria Crohn’s disease and RA TNF RA, psoriatic arthritis and AS CD3 and EPCAM ovarian cancer, malignant ascites, gastric cancer inhibition of ligand binding and dimerization of EGFR, blocks EGFR activation binds C5, inhibiting its cleavage and preventing the formation of MAC neutralizes TNF activity by binding soluble and transmembrane TNF neutralizes TNF activity by binding soluble and transmembrane TNF retargeting of T lymphocyte to tumor cells; ADCC, CDC, phagocytosis human IgG1 (mice) human IgG1 (mice) IL-12 and IL-23 plaque psoriasis ligand binding and receptor antagonism CD20 CLL, RA CDC and ADCC tocilizumab (Actemra/RoActemra; Chugai/ Roche) ranibizumab (Lucentis; Genentech/ Novartis) panitumumab (Vectibix; Amgen) 2007 2008 2009 Introduction eculizumab (Soliris; Alexion pharmaceuticals) certolizumab pegol (Cimzia; UCB) golimumab (Simponi; Centocor) catumaxomab (Removab; Fresenius Biotech/Trion Pharma) ustekinumab (Stelara; Centocor) ofatumumab (Arzerra; Genmab/ Glaxo-SmithKline) receptor binding and antagonism; inhibits leukocyte adhesion to their counter receptor blocking of EGFR, reduced proliferation inhibits T cell activation by binding to CD80 and CD86, thereby blocking interaction with CD28 receptor binding and ligand blockade The suffix of the international non-proprietary names for monoclonal antibodies denotes the antibody format: -omab, mouse IgG2; -ximab, mouse–human chimeric IgG1; -zumab, humanized IgG1; -umab, human antibodies from phage display or transgenic mice; -cept, Fc-fusion protein; -axomab, trifunctional (bispecific) mouse–rat hybrid. 16 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction VL Fab Antigen VH CH 1 CL Hinge FcγR Complement CH 2 Fc FcRn CH 3 Sialyc acid Glycosylation Galactose Bisecting N-acetylglucosamine Mannose Core Variable Fucose N-acetylglucosamine Asn297 Figure 1-1: Antibody structure and function. IgGs comprise a pair of identical heavy and light chains. The heavy chain contain a variable domain (VH) and three constant domains (CH1, CH2, CH3), whereas the light chain contain a variable domain (VL) and a single constant domain (CL). IgGs contain two functional subunits: the fragment antigen binding (Fab) and the fragment crystallizable (Fc). The Fc part interact with Fc receptors for IgG (FcγR), the complement component C1q and the neonatal Fc receptor (FcRn). The Fc region is N-glycosylated at the conserved asparagines residue Asn297. 1.2 Antibody structure Immunglobulin molecules are composed of two types of protein chains: heavy chains and light chains. Two types of light chain, termed lambda (λ) and kappa (κ), are found in antibodies and do not differ in function. Antibodies are grouped into five classes based on the sequence of their heavy chain constant regions: IgM, IgD, IgG, IgE, and IgA. They differ in their biological properties, functional locations and ability to deal with different antigens as depicted in Table 1-2. Thereof IgG is the most commonly used for therapeutic antibodies (Reichert et al. 2005). IgG molecules are tetramers of about 150 kDa, which comprise two identical heavy and light chains linked by disulphide bonds. Antibodies can be divided into two distinct functional units: the fragment of antigen binding (Fab) and the constant fragment Fc (fragment crystallizable; hinge and constant domains CH2 and CH3). The Fab fragment is composed of one constant and one variable domain of each of the heavy and light chain and contains the variable fragment (Fv), which is responsible for interaction with 17 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction antigens. The antigen binding site is formed by six loops, the hypervariable complementarity determining regions (CDRs), three of which are present in each of the VH and VL domains. The binding site confers essential properties such as binding affinity and target specificity. The Fc fragment of an antibody mediates its immune effector functions, by initiating complement-dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cellular phagocytosis (ADCP). A second function of the Fc is interaction with the neonatal Fc receptor (FcRn) which controls the half-life of immunoglobulins. Table 1-2: The structural and functional properties of the human immunoglobulin isotypes. name types IgA α1, α2 description antibody half-life complexes in serum mucosal areas, salvia, tears and breast milk; dimer 6 days alternative pathway of complement activation; binding (Mr 390 kDa) to macrophage and phagocyte Fc receptors IgD antigen receptor on B cells; activates basophils and monomer mast cells IgE 3 days (Mr 184 kDa) binds to allergens; triggers histamine release from monomer 2 days mast cells and basophils; protects against parasitic (Mr 188 kDa) worms; binding to macrophage and phagocyte Fc receptors IgG γ1, γ2, provides the majority of antibody-based immunity; monomer γ3, γ4 FcRn mediated complement placental activation (not transport; γ4); 21, 20, classical (Mr 146 kDa; 7, 21 binding to γ3: 165 kDa) days macrophage and phagocyte Fc receptors (not γ2) IgM expressed on the surface of B cells and in secreted pentamer 10 days form with very high avidity; eliminates pathogens in (Mr 970 kDa) the early humoral immunity, CDC 1.3 Antibody functions 1.3.1 Complement-dependent cytotoxicity, CDC Subclasses of IgG (particularly IgG1 and IgG3) are strong activators of the classical complement pathway. Antigen-bound antibodies on the cell surface lead to high-affinity binding of the complement component 1q (C1q) to the Fc region and to subsequent activation of downstream complement proteins. The result of the complement pathway is the formation of the membrane 18 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction attack complex (MAC) and cell lysis. Moreover, immune effector cells (macrophages, mast cells and granulocytes) are recruited and activated by the highly chemotactic complement molecules C3a and C5a (Dunkelberger and Song 2010), bound to the target cell surface. Additionally, C3b acts as opsonin, by binding to antigens and coating negatively charged molecules on the cell membrane, thereby binding of phagocytic cells expressing complement receptor 1 (CR1) is greatly enhanced. The relationship between complement activation and therapeutic activity is suggested from studies with several clinically approved mAbs (Di Gaetano et al. 2003; Cragg and Glennie 2004; Racila et al. 2008). 1.3.2 Antibody-dependent cellular cytotoxicity, ADCC ADCC is a mechanism of cell-mediated immunity whereby effector cells of the immune system that express FcγR (mainly natural killer (NK) cells, but also neutrophils, mononuclear phagocytes and dendritic cells (DCs)) actively lyse a target cell that has been bound by specific antibodies. FcγRs mediate activating signals through immunoreceptor tyrosine-based activation motifs (ITAMs) and inhibitory signals through immunoreceptor tyrosine-based inhibitory motifs (ITIMs). FcγRIIB (CD32) is the major inhibitory FcR, whereas FcγRI (CD64) is a high affinity activating receptor expressed by macrophages, DCs, neutrophils and eosinophils and FcγRIIIA (CD16A) is an activating receptor expressed by NK cells, DCs, macrophages and mast cells (Nimmerjahn and Ravetch 2006). The importance of Fc-FcγR interactions for the in vivo antitumor effects of therapeutic antibodies has been shown in many studies (Clynes et al. 2000) and polymorphisms in genes encoding FcγRs are associated with clinical response to antibodies (Cartron et al. 2002; Musolino et al. 2008; Bibeau et al. 2009). 1.3.3 Cross-presentation The lysis of tumor cells is a prerequisite for a process known as cross-presentation. Dendritic cells (DCs) can engulf the resultant apoptotic tumor cells and subsequently present tumor-derived peptides on MHC class I and II molecules (Berard et al. 2000). This dual presentation leads to direct tumor cytotoxicity by CTLs (CD8+ cytotoxic T cells) (Albert, 1998) and promotes activation of CD4+ T cells, which can prime B cells for the production of tumor-specific host antibodies. The delayed therapeutic effect of e.g. rituximab points to a role of the adaptive immune system in mediating long-term benefit of mAbs (Cartron et al. 2004). And there is increasing evidence to suggest a role for cross-presentation in the induction of adaptive immune responses following antibody therapy. 19 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 1.3.4 Introduction FcRn The neonatal Fc receptor (FcRn) is structurally distinct from FcRs and is related to MHC class I molecules. FcRn plays an important role in passive transfer of humoral immunity from mother to fetus. FcRn expressed on vascular endothelial cells bind to the Fc part of IgGs after fluid-phase uptake at acidic pH in endosomes and return it to circulation, or protecting it from transcytotic lysosomal catabolism en route to the lymphatics (Roopenian and Akilesh 2007). Thereby this recycling mechanism contributes to the long half-life of IgG and maintenance of serum IgG. In addition, FcRn may also contribute to antibody-mediated antigen presentation by dendritic cells by uniquely directing multimeric immune complexes to lysosomes (Qiao et al. 2008). 1.4 Antibody optimization Design goals for therapeutic antibodies are dependent on the target antigen, therapeutic strategy and clinical setting. In anticancer therapy, antibodies are, as yet, rarely curative. Therefore, in oncology the goal is to improve the antitumor activity of antibodies and improve patient survival, by increasing the frequency of partial or complete responses and by extending the duration of response (Carter 2001; Adams and Weiner 2005). In general, increasing the potency of the antibody or extending its half-life in plasma might allow for a reduced dose or administration schedule, which would reduce adverse effects and therapy costs and improve the patients’ quality of life. Furthermore, it is often desirable to obtain species-crossreactive antibodies, allowing the biological function of the antibodies to be evaluated in animal models of disease. However, it is challenging to derive antibodies that are crossreactive with mouse antigens by immunization of mice or transgenic mice, because self-reactive antibody-producing cells are selected against by the process of immune tolerance induction. Detailed knowledge of antibody structure and activity allows researchers to engineer primary antibodies on a rational basis and even to introduce additional properties like increased cytotoxicity or dual targeting or to generate IgG-related structures with additional functions and specificity. 1.4.1 Strategies to optimize structures: Two broad strategies are widely used, either individually or in combination, for the optimization of antibody therapeutics: display libraries (Lowe and Jermutus 2004; Hoogenboom 2005) and structurebased design (rational design) (Szymkowski 2005). Phage display libraries are the most commonly used display technology for antibody generation and optimization (Bradbury and Marks 2004; Lowe and Jermutus 2004; Hoogenboom 2005) but also other display technologies, such as yeast-, mRNA-, and ribosome-display libraries are evolving 20 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction (Hoogenboom 2005). A particular strength of display technology is that direct selection for specific binding properties, such as higher affinity or species cross-reactivity, is sometimes possible (Popkov et al. 2004). Display technology includes the selective recovery of antibodies on the base of antigen binding, and provides the means to amplify the selected clone for further rounds of selection or analysis. The binding step can be done with the antigen immobilized on a surface, in solution or on cells and conditions can be adapted to the design goal (binding, stability, production). Experience with phage display libraries supports the prediction that increases in functional display library size (the number of clones that is displayed with sufficient efficiency to be potentially selectable) facilitates the identification of higher-affinity clones (Perelson and Oster 1979; Griffiths et al. 1994; Bradbury and Marks 2004). Structure-based design uses three-dimensional structural information, sometimes in combination with sophisticated computational methods, to predict the site and type of useful mutations (Szymkowski 2005). The ideal starting point for design is a high-resolution structure of an antibody in complex with the relevant binding partner (antigen, complement, FcRn, FcγR), but the molecular model of an antibody can sometimes provide a useful starting point as well. 1.4.2 Immunogenicity All protein drugs are potentially immunogenic (Chirino et al. 2004). Antibody chimerization substantially reduces the immunogenicity of the antibody and humanization might further reduce it (Hwang and Foote 2005). Beside the influence of the primary amino acid structure, other factors, such as the presence of aggregated or misfolded antibody, contaminants, microheterogeneity in the antibody pool (glycosylation, chemical modification) and the presence of T cell epitopes (Hwang and Foote 2005) contribute to the immunogenicity of therapeutic antibodies. 1.4.3 Antigen binding 1.4.3.1 Specificity Typically, antibody binding to its target antigen is of high specificity, which allows their use in targeted therapy. On the other hand, it is less common for antibodies to bind the corresponding antigen from a different species (e.g. non-human primate or rodent) although such crossreactivity would enable preclinical evaluation of efficacy and toxicity. The sequence homology of the antigen in different species (i.e. the conservation of the target epitope) is the crucial factor in generating such species-crossreactive antibodies. Display technologies (phage display and others) are well suited to the generation of species-crossreactive antibodies, because they are independent of the induction of 21 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction immune tolerance in the immunization process and allow screening and/or selection for species crossreactivity (Fredericks et al. 2004; Popkov et al. 2004). 1.4.3.2 Affinity The antigen-binding affinity may be the most intensive studied property of antibodies, it describes the ratio of the association (kon or ka) and dissociation (koff or kd) rate constants, which can be measured using a range of technologies including quartz crystal microbalance (QCM) or surface plasmon resonance (SPR). The affinity equilibrium constant (KD) is then calculated as a function of kon and koff (KD = koff/kon). Affinity maturation to increase the strength of the antibody-antigen interaction can be achieved using different library-construction strategies together with several display technologies. Phage display has been successfully used to increase antibody affinity more than 1000fold (Yang et al. 1995; Schier et al. 1996c). In general, mutations are introduced into the antibody gene, to create an antibody gene library. The key decision in this method is where and how to introduce mutations into the antibody V-genes. The easiest approach is to introduce mutations randomly into the V-genes, thus mimicking the in vivo process of hypermutation. Mutations can be introduced by chain shuffling (Marks et al. 1992; Figini et al. 1994), error prone polymerase chain reaction (PCR) (Hawkins et al. 1992), DNA shuffling (Crameri et al. 1996) or by reproduction of phage in mutator strains of E. coli (Low et al. 1996). One limitation of random mutagenesis is that little information is generated regarding to the localization of mutations that modulate affinity and the constructed libraries are hardly large enough to cover the number of possible permutations. A further problem is that this approach may create problems of immunogenicity. Another approach is to introduce mutations site directed into the CDRs by using PCR and special randomized primers. During in vivo somatic hypermutation, mutations accumulate preferentially in the CDRs compared to framework residues (Loh et al. 1983). The location of these CDR mutations complements the location where diversity is generated in primary antibody repertoire (Tomlinson et al. 1996). However, many CDR residues, especially in VHCDR3 and VLCDR3, are responsible for high energy interactions with antigen. Mutating these residues will in many cases abolish antigen binding, for that reason the constructed library has to be large enough (according to the number of mutated residues) to allow recreation of these important residues. Mutated residues in the CDRs may increase affinity by introducing new contact residues or by replacing low affinity contact residues with more favorable energetic (Novotny et al. 1989). Another possibility is that the introduced mutations indirectly influence affinity by repositioning the CDRs or the side-chains of contact residues for optimal interaction with the antigen (Foote and Winter 1992). Mutations in the CDRs are also less likely to induce immunogenicity problems then mutations in the conserved framework regions. Finally, site directed mutagenesis reveals information about conserved structural and functional residues and 22 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction those residues that modulate affinity (Schier et al. 1996b) and these information will be useful for subsequent mutagenic efforts. Separate mutations that increase binding affinity can be combined and often further increase affinity in an additive or synergistic manner (Wells 1990). Affinity maturation is more often than not (Carter et al. 1992) associated with increased in vitro biological potency (Chowdhury and Wu 2005; Hoogenboom 2005). Not so much is known about the relevance of affinity for the in vivo activity of an antibody. However, the antigen-binding affinity of an antibody definitely influences its tumor localization, as shown for a panel of scFvs specific for ErbB2 (Adams et al. 1998; Adams et al. 2001). For specific tumor localization an affinity (KD) higher than 10-7 - 10-8 is needed and an affinity higher than 10-9 – 10-11 did not further improve tumor uptake. The term “binding-site barrier” describes the observation that scFv with the lowest affinity had the most uniform distribution throughout the tumor, while the highest affinity scFv was found mainly in the perivascular region of the tumor (Fujimori et al. 1989). Interestingly, tumor localization of dimeric versions (diabodies) of these ErbB2-specific scFvs correlated inversely with the monomeric affinity, with the lowest-affinity diabody (KD of 400 nM) localizing more than twofold more efficiently than the highest-affinity diabody (KD of 2 nM) (Nielsen et al. 2000). That hints to an influence of the antibody format (valency, pharmacokinetics) which can outrun the influence of intrinsic affinity, as long as tumor penetration is concerned. Another aspect is the nature and localization of the target antigen, e.g. targets in inflammatory diseases are often soluble (like cytokines) or expressed on immune cells, hence tissue penetration may not influence the biological potency of therapeutic antibodies and the influence of the antigen-binding affinity may be different. The antigen-binding affinity of current antibody therapeutics ranges from a KD of 0.08 nM (gemtuzumab ozogamicin, Mylotarg; Wyeth) to 32 nM (alemtuzumab, Campath; Genzyme Corporation and Schering AG). If there is an ideal antigen-binding affinity for antibodies remains unknown and an empirical approach is warranted for preclinical optimization of antibody affinity. 1.4.4 Fc domain modulation Mutational analysis has increased our understanding of, and provided a means to modulate, the interaction of the Fc region of IgG with various FcγRs (Duncan et al. 1988; Shields et al. 2001), the FcRn and complement component 1q (C1q) (Duncan and Winter 1988; Idusogie et al. 2000). Effector functions mediated by the Fc region of an IgG might be increased with the intention to increase efficacy or be decreased to reduce side-effects, according to the chosen target antigen, therapeutic strategy and clinical setting. For some antibody therapies (like inflammatory diseases), antigen binding may be sufficient for achieving efficacy, and effector functions may be unnecessary and a potential source of adverse 23 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction events in patients. There are different means to minimize FcγR binding, like the use of the isotypes IgG2 and IgG4. Substitution into human IgG1 of IgG2 residues at positions 233-236 and IgG4 residues at positions 327, 330 and 331 greatly reduced ADCC and CDC (Armour et al. 1999; Shields et al. 2001); a similar IgG (hIgG1e3, InvivoGen, San Diego, USA) was used in this study to generate a TNFR1specific humanized antibody (ATROSAB). Another means is the use of IgG of various isotypes with mutations that impair interaction with FcγRs or prevent the glycosylation that is required for effector functions (Alegre et al. 1994; Salfeld 2007; Labrijn et al. 2008) e.g. by mutating the conserved asparagine residue at position Asn297 in the CH2 domain (otelixizumab, TRX4; Tolerx/GlaxoSmithKline) (Bolt et al. 1993). Finally, antibody fragments lacking the Fc region can be used (certolizumab pegol) (Choy et al. 2002). On the other hand, Fc-mediated effector functions like ADCC and CDC are suggested to be important mechanisms of action for several antibodies used in cancer immunotherapy. The modification of Fcmediated activities is emerging as one of the most promising ways to further increase the clinical potential of antibodies (Carter 2006; Presta 2008; Kubota et al. 2009). One such Fc mutant (Ser239Asp, Glu330Leu, Ile332Glu) gave a ~100-fold increase in ADCC potency as shown with variants of several therapeutically relevant antibodies (Lazar et al. 2006). Increasing complement activity can be achieved by isotype chimerism, if some IgG1 residues are replaced with IgG3 sequences (Natsume et al. 2008) or by mutations to improve C1q binding, which showed ~two-fold greater CDC activity but with slightly impaired ADCC activity (Idusogie et al. 2001; Coiffier et al. 2008). Modification of the oligosaccharide content of the Fc domain provides another mechanism for regulation of anti- and pro- inflammatory properties of therapeutic antibodies (Jefferis 2009b; Jefferis 2009a), e.g. defucosylation leads to a significant enhancement of ADCC (Kubota et al. 2009). The relative importance of each mechanism, and whether these mechanisms are synergistic, additive or antagonistic, remains uncertain. 1.4.5 Pharmacological properties The terminal half-life of antibodies can be adjusted over a wide range to fit clinical goals by tailoring the interaction between IgG and FcRn. Mapping of the FcRn interaction site on IgG revealed two conserved histidine residues (His310, His435) which are responsible for the pH dependence of this interaction (Ghetie and Ward 2002). Most approved antibodies (chimeric, humanized, human) are IgG1 with similar constant domains, but their half-life vary from ~3 – 27 days (Lobo et al. 2004). Increased serum half-life and exposure offers the potential benefits of greater efficacy, lower or less frequent dosing, lower cost and 24 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction enhanced localization to the target. Different mutations of the Fc region resulted in increased binding to the FcRn and extended serum half-life (Hinton et al. 2004; Dall'Acqua et al. 2006; Zalevsky et al. 2010). The half-life of antibody fragment can also be extended by endowing them with the ability to bind serum proteins as IgG or albumin; reviewed in (Kontermann 2009), or by conjugating them to polyethylene glycol (PEGylation) (Choy et al. 2002). 1.5 Targets A limitation of antibody therapeutics clearly is the restriction of targets to those on the cell surface or exterior of host cells. The first step in the generation of antibody therapeutics, which is one of the most difficult steps, is the selection of a target antigen; reviewed in (Carter et al. 2004). The selection of antigen targets can be classified into two main approaches: the first one is the development of antibodies against “validated targets”, i.e. prior mAbs have shown proof of activity and vast literature exists on the importance of these targets for the disease mechanism. The second approach is the “functional approach”, which intends to indentify new or less studied targets that confer particular functions that might be involved in disease by selection of antibodies based on a functional screen. Most cytokines and the associated receptors seem to be valuable targets for treatment of immunological disorders as shown by the large number of already approved mAb (Strohl 2009; Chan and Carter 2010; Smith and Clatworthy 2010). The mechanism driving at least some inflammatory disorders are reasonably well known. In contrast, finding new targets in oncology is a challenging issue (Weiner et al. 2010) because malignancies have often multifactorial, redundant causes that are frequently poor understood. In addition, patients may become resistant to current cancer treatment, leading to the expression of new molecules (potential targets) that promote tumor growth (Spector and Blackwell 2009). Possible tumor targets include antigens expressed by the tumor itself or in the tumor microenvironment (e.g. growth factor receptors, increased during tumorgenesis). 1.5.1 Heat shock protein 70 (Hsp70) in cancer Heat shock proteins (Hsp) belong to a large group of highly conserved proteins divided into several families according to their molecular weight. Each family is composed by members expressed either constitutively or regulated inducible and inhabit nearly all cellular compartments. They play a major role in maintaining protein homeostasis and protecting the cell against stress-induced damage (Lindquist and Craig 1988). Elevated levels of intracellular Hsps are found after environmental stress, but also during differentiation, proliferation, and maturation. Members of the highly conserved Hsp70 family, including the constitutively expressed Hsc70 and the stress-inducible Hsp70, are 25 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction intrinsic to cellular life (Calderwood et al. 2005). They comprise a C-terminal region that binds peptides and denatured proteins, and an N-terminal ATPase domain controlling opening and closing of the substrate-binding domain (Mayer and Bukau 2005). Besides cytosolic occurrence, the inducible Hsp70 is capable of translocating into the plasma membrane and can also be released into the extracellular space in a membrane-associated form where it can exert immune stimulatory activities (Sherman and Multhoff 2007; Vega et al. 2008). Membrane-associated Hsp70 (mHsp70) has been selectively detected on more than 50 % of tumors of different origin, including lung cancer, colorectal cancer, breast cancer, head-and-neck cancer, melanoma, and leukemia, but not on cells from normal tissues (Multhoff et al. 1995; Hantschel et al. 2000; Farkas et al. 2003; Gehrmann et al. 2003; Kleinjung et al. 2003; Steiner et al. 2006; Multhoff 2007) (Figure 1-2). Figure 1-2: Hsp70 surface expression is tumor-specific and increased on metastasis. Table adapted from (Hantschel et al. 2000). The translocation of Hsp70 into the plasma membrane of tumor cells makes it a promising target for cancer therapy. Thus, mHsp70 can act as a recognition structure for natural killer (NK) cells and antitumor activity was demonstrated, for example, with NK cells stimulated ex vivo with an Hsp70derived peptide (Multhoff et al. 1997; Multhoff et al. 2000; Multhoff et al. 2001; Multhoff 2002; Krause et al. 2004; Multhoff 2009). A detailed analysis of various monoclonal antibodies recognizing different epitopes revealed that parts of the C-terminal substrate-binding domain (SBD) of Hsp70 are exposed on tumor cells (Botzler et al. 1998). One of these monoclonal antibodies, cmHsp70.1 (clone C92F3B1), which was raised by immunizing mice with an SBD-derived synthetic peptide (Multhoff 2007), has been extensively studied and identified to be useful for diagnostic and therapeutic applications (Moser et al. 2002; Gross et al. 2003; Gastpar et al. 2004; Gehrmann et al. 2004; Gastpar et al. 2005; Pfister et al. 2007; Vega et al. 2008). Because mHsp70 has no proliferative activity, in vivo anti-tumoral effects will be mediated through the Fc-part (ADCC, CDC) and the mouse antibody cmHsp70.1 will be of limited use as therapeutic in humans. 26 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction Conversion of a murine antibody into a chimeric or humanized derivative has been established as an adequate option to reduce the murine portion of the antibody and to increase the therapeutic efficacy (see 1.4.2, 1.4.4) (Almagro and Fransson 2008). The purpose of the first part of this thesis was to clone and produce a recombinant chimeric antibody derived from the mouse antibody cmHsp70.1 as well as the humanization of this antibody by CDRgrafting. Comparison of the recombinant antibodies and the parent mouse antibody regarding production, stability, epitope specificity (species crossreactivity) and antigen-binding affinity should show if these antibodies can be useful for further development of therapeutic antibodies and antibody derivatives targeting the membrane-bound form of Hsp70. 1.5.2 Tumor necrosis factor (TNF) in inflammatory diseases Tumor necrosis factor (TNF) is a pleiotropic cytokine and a central mediator of inflammation. Elevated levels of TNF are associated with various inflammatory diseases including rheumatoid arthritis, psoriasis, and Crohn's disease (Figure 1-3). Figure 1-3: Schematic presentation of TNF action in rheumatoid arthritis. Adapted from (Pope 2002). An unknown trigger sets up an initial inflammation in the synovial membrane that attracts autoreactive lymphocytes and macrophages to the inflamed tissue. The produced cytokines (mainly IL-1 and TNF) stimulate monocytes, macrophages, endothelial cells and fibroblasts and these cells produce more cytokines (IL-6, IL-8, MCP1, GM-CSF). Finally, this leads to the production of matrix metallo proteinases, responsible for tissue destruction and to the activation of bone-destroying osteoclasts and joint destruction. Several TNF-neutralizing reagents have been approved for the treatment of these diseases, including soluble TNF receptors (etanercept) as well as anti-TNF antibodies (infliximab, adalimumab, certolizumab pegol, golimumab), and many more are under development; for review see: (Tracey et al. 2008; Kontermann et al. 2009). The TNF antagonists are presently the most successful class of 27 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction biological drug for inflammatory diseases (total worldwide sales of $16.4 billion in 2008 (Chan and Carter 2010)) and with over 1 million patients treated with TNF antagonists, therapeutic efficacy is well documented (Schiff et al. 2006). However, global TNF inhibition over a prolonged period of time increases the risk of tuberculosis reactivation, serious infections and even malignancies (Bongartz et al. 2006; Desai and Furst 2006; Wallis 2008). Consequently, medical information of all approved antiTNF medicines includes extensive warnings and precautions. Figure 1-4: Strategies to interfere with TNF action. Two TNF receptors (CD120a, TNFR1, CD120b, TNFR2) mediate signal transduction upon binding of TNF (Locksley et al. 2001) (Figure 1-4). They consist of four extracellular cysteine-rich domains (CRDs), a single CRD typically including six cysteine-residues distributed in a range of 40 amino acids. They differ in their intracellular domains, with only TNFR1 containing a death domain (Wilson et al. 2009). TNFR1 is ubiquitously expressed on most cell types and is activated both by the membranebound form of TNF (mTNF) and soluble TNF (sTNF), which is produced from mTNF by proteolytic cleavage (Black et al. 1997). TNFR1 is a strong activator of both gene expression and apoptosis and is the major mediator of TNFs pathologic phenotypes. In contrast, TNFR2, expressed in a more restricted manner e.g. by immune cells, endothelial cells and neurons, is mainly activated by mTNF. Activation of TNFR2 induces anti-apoptotic signals via activation of the NF-κB pathway and can lead to cell proliferation in vitro (Wajant et al. 2003). Furthermore, TNFR2 appears to play a role in infection, tissue homeostasis and regeneration (Wallach and Kovalenko 2009) and can act in a neuroprotective manner (Marchetti et al. 2004). 28 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Introduction All the currently approved TNF-targeting therapeutics interfere with TNF-action at the level of ligand binding, thereby generally blocking TNF signaling affecting both receptors. Selective inhibition of TNFR1 signaling has gained increasing attention as alternative to global TNF neutralization. Recently, a TNF mutein (R1antTNF) selectively neutralizing the activity of TNFR1 has been described (Shibata et al. 2008b). This TNF mutein, administered either as unmodified or as PEGylated protein (PEGR1antTNF), demonstrated therapeutic efficacy in acute murine hepatitis models and a murine collagen-induced arthritis model (Shibata et al. 2008a; Shibata et al. 2009). The beneficial effect of selectively inhibiting TNFR1 was further supported by results from a dominant-negative TNF mutein (XPro1595), which is capable of forming inactive complexes with sTNF, thus selectively inhibiting the pro-inflammatory action mediated by TNFR1 while preserving the innate immunity to infections (Zalevsky et al. 2007; Olleros et al. 2009). TNFR1-selective inhibition can be also achieved with TNFR1-specific antibodies. For example, a monoclonal antibody, H398, with selectivity for human TNFR1, showed potent inhibition of TNF-mediated signal transduction and cytotoxicity (Thoma et al. 1990; Kruppa et al. 1992; Moosmayer et al. 1995). Recently, a humanized version of H398 (Kontermann et al. 2008) was generated. This humanized antibody (IZI-06.1), produced as Fab fragment in E. coli, exhibited in vitro neutralizing activities comparable to that of the Fab fragment of the parental antibody. Hence, IZI-06.1 may open a new treatment option by selectively inhibiting TNFR1-mediated signal transduction. In the second part of this study, IZI-06.1 was converted into a full IgG1 antibody (ATROSAB). In order to avoid Fc-mediated effector functions, an ADCC and CDC-deficient heavy chain was used (see 1.4.4). Additionally, monovalent IZI-06.1-derivatives (scFv, Fab, scFv-HSA, Fab-HSA) were used to compare antigen-binding (affinity and specificity) and neutralizing behavior with the intention to find the most appropriate antibody format for further development of a therapeutic TNFR1-specific antibody drug. Furthermore, phage display technology was used for affinity maturation of the humanized variable domains by site directed mutagenesis of CDR1 and CDR2 of each VH and VL. 29 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2 Materials and Methods 2.1 Materials 2.1.1 Instruments Balance Blotter Centrifuges Electrophoresis Electroporation Film developing machine Flow cytometer Gel documentation Feinwaage Basic [Sartorius AG, Göttingen, Germany] 440-39N and 440-33N [Kern, Balingen, Germany] Trans-Blot SD Semi-dry transfer cell [Bio-Rad, Munich, Germany] Eppendorf 5804R [Eppendorf, Hamburg, Germany] J2-MC, rotors: JA10, 14, 20 [Beckman Coulter, Krefeld, Germany] Avanti-J301, rotors: JA10, 14, 30.5 [Beckman Coulter, Krefeld, Germany] CR 422 [Jouan, Rennes, France] GR4i [Jouan, Rennes, France] Mini-PROTEAN®3 Cell Electrophoresis System [Bio-Rad, Munich, Germany] Ready Agarose Precast Gel Electrophoresis System [Bio-Rad, Munich, Germany] Power Pac Basic and HC [Bio-Rad, Munich, Germany] Gene-Pulser™, Pulse Controller, Capacitance Extender *Bio-Rad, Munich, Germany] Curix60 [Agfa, Cologne, Germany] Cytomics FC 500 [Beckman Coulter, Krefeld, Germany] Transilluminator, Gel documentation system Felix [Biostep, Jahnsdorf, Germany] Heat block HBT-1-131 [Hlc–Haep Labor Consult, Bovenden, Germany] HPLC system Waters HPLC-System [Millipore, Billerica, USA] Chromatography Software Clarify Lite v.2.4.1.65 Incubator for BD 53 [Binder, Tuttlingen, Germany] bacteria Infors HAT Multitron 2 [Infors Ag, Basel, Switzerland] Incubator for cell Heal Force water-jacketed CO2 Incubator HF160W, [Shanghai Lishen, Shanghai, culture China] Magnetic stirrer MR 3001K 800W [Heidolph Instruments, Nürnberg, Germany] Microplate reader Microplate Reader Spectra max 340 PC [Molecular Devices, Palo Alto, USA] Tecan infinite M200 [Tecan, Crailsheim, Germany] PCR cycler RoboCycler 96 [Stratagene, La Jolla, USA] Pump Ismatec mp13 GJ-10 [Ismatec, Wertheim-Mondfeld, G] QCM Attana A100 C-Fast System [Attana, Stockholm, Sweden] Rotator PTR-30 [Grant-bio, Cambridgeshire, UK] Spectrophotometer Nanodrop® ND-1000 [pEQLab Biotechnology, Erlangen, Germany] eppendorf BioPhotometer plus [eppendorf, Hamburg, Germany] Vortex Sky Line [Elmi Ltd., Riga, Latvia] Water bath MA6, [Lauda, Lauda-Königshofen, Germany] Haake DC10, [Thermo Haake, Karlsruhe, G] Zetasizer Zetasizer Nano ZS, [Malvern Instruments, Herrenberg, Germany] 2.1.2 Special Implements BioRad Ready Gel Tris-HCl gel, 4-15 % linear gradient, cat.no. 161-1176 [Bio-Rad Laboratories, Munich, Germany] 30 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Cryobox Dialysis tubes Dynabeads Electroporation cuvettes ELISA plates HPLC column IMAC affinity matrix Immunotubes Liquid Chromatography Columns magnetic separator Nitrocellulose membrane Protein ASepharose Sensor chip Dialysis Chamber Square plates Tissue culture flasks and dishes Whatman paper X-ray films 2.1.3 Methods filled with isopropanol for eukaryotic cell freezing [Nalgene, Rochester, USA] ZelluTrans, 40 mm cut-off 8 – 10 kDa [Roth, Karlsruhe, Germany] 23 mm cut-off 12,4 kDa [Sigma-Aldrich, Taufkirchen, Germany] Dynabeads®M-280 Streptavidin, Cat.no. 112.05D [Invitrogen Dynal, Carlsbad, USA] 1-mm-electroporation cuvettes, no. 71-2010 (red) [pEQLab, Erlangen, Germany] MICROLON 96 well [Greiner bio-one, Kremsmünster, Austria] Nunc MaxiSorp™ *Thermo Scientific Fisher, Langenselbold, Germany] BioSep-SEC-S2000 or S3000 [Phenomenex, Aschaffenburg, Germany] BioSuite™ 250, 5 µm HR SEC *Waters GmbH, Eschborn, Germany+ His-SelectTM Nickel Affinity Gel [Qiagen, Hilden, Germany] 5 ml immunotubes *Nunc MaxiSorp™, cat.no. 444202, Thermo Scientific Fisher, Langenselbold, Germany] Luer-Lock, Non-jacketed, Size: 1.0 cm x 10 cm, bed: 8 ml, [Sigma-Aldrich, Taufkirchen, Germany] MPC-S [Dynal-Invitrogen, Carlsbad, USA] BioTrace NT Membrane [Pall Life Sciences, East Hills USA] CL-4B, P-3391 [Sigma-Aldrich, Taufkirchen, Germany] Biotin Nc MkIII, prod.no. 3613-3033; Carboxyl Nc MkIII, prod.no. 3616-3103 [Attana, Stockholm, Sweden] Slide-A-Lyzer®Dialysis Cassettes: Prod.no 66380, 0.5 – 3 ml Capacity, Cutoff (MWCO) 10,000 [Thermo Scientific, Rockford, USA] 24 x 24 cm Tissue culture plates [Nunc, Thermo Scientific Fisher, Langenselbold, Germany] Cellstar® [Greiner bio-one, Kremsmünster, Austria] 3 mm 46 x 57 cm #3030 917 [Schleicher & Schuell, Brentford, UK] Medical X-Ray film 100 NIF 18 x 23 cm [Fuji, Düsseldorf, Germany] Chemicals All chemicals were purchased by Roth [Karlsruhe, Germany], Boehringer Mannheim [Mannhein, Germany], Merck [Darmstadt, Germany], Sigma-Aldrich [Taufkirchen, Germany] and Roche, [Basel, Switzerland] unless otherwise stated and were of p.a. quality. 2.1.4 NLL-17 RFE-13 TKD-14 2.1.5 Peptides NLLGRFELSGIPPAPRG RFELSGIPPAPRG TKDNNLLGRFELSG [EMC microcollections, Tübingen, Germany] [EMC microcollections, Tübingen, Germany] [EMC microcollections, Tübingen, Germany] Media and supplements 2.1.5.1 Bacterial culture IPTG Isopropyl-β-D-thiogalactopyranoside, stock solution 1 M in H2O [Gerbu 31 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods Biochemicals, Gaiberg, Germany] 1 % peptone, 0.5 % yeast extract, 0.5 % NaCl (low salt = 5 g/L) in H2O LB medium, 1.5 % (w/v) agar, 100 µg/ml ampicillin, 1 % glucose 0.5 % (w/v) yeast extract, 2 % (w/v) peptone, 10 mM NaCl, 2.5 mM KCl, 10 mM MgSO4, 10 mM MgCl2 SOB medium and 20 mM glucose (catabolite repression due to glucose) 1.6 % peptone, 1 % yeast extract, 0.5 % NaCl in H2O 2xTY medium and 1.5 % agar, 100 µg/ml ampicillin, 1 % glucose 10 %, 50 %, 86 % in H2O, 0.2 µm sterile filtered 0.5 M Na2HPO4, 0.22 M KH2PO4, 5 % NaCl, 10 % NH4Cl, pH 7.2 1.5 % agar, 0.2 % glucose, 1 mM MgSO4, 2 µg/ml vitamine B1, M9 stock 1x 0.7 % agar in 2xTY medium LB medium, 1 x LBamp, glc agar plates SOB SOC TY medium, 2 x TYEamp, glc glycerol M9 stock, 10 x Minimal plates TYE top agar 2.1.5.2 Cell Culture DMSO Eosin FBS FCS dialyzed Lipofectamine™ 2000 RPMI Media 1640 Opti-MEM MSX Trypsin/EDTA, 10 x Lysis-buffer 99.5 % [Roth, Karlsruhe, Germany] 0.4 % Eosin, 10 % FBS, 0.02 % NaN3 in PBS Heat inactivated at 56 °C for 1 hour, HyClone®, Cat.no. SV30160.03 [Thermo Scientific, Cramlington, UK] [GIBCO Invitrogen, Karlsruhe, Germany] Cat.no. 11668-019 [Invitrogen, Karlsruhe, Germany] + L-glutamine and no glutamine [GIBCO Invitrogen, Karlsruhe, Germany] + L-glutamine [GIBCO Invitrogen, Karlsruhe, Germany] methionine sulphoximine [Sigma-Aldrich, Taufkirchen, Germany] 0.5 % Trypsin, 5.3 mM EDTA, [GIBCO Invitrogen, Karlsruhe, Germany] 20 mM Tris, pH 7.4, 5 mM MgCl2, 1 % Triton X 100, 150 mM NaCl 2.1.5.3 Antibiotics Ampicillin, 1000 x Penicillin/Streptomycin, 100 x Zeocin™ Kanamycin, 1000 x Puromycin 2.1.6 100 mg/ml stock solution in H2O [Roth, Karlsruhe, Germany] 104 U/ml / 104 µg/ml [GIBCO Invitrogen, Karlsruhe, Germany] [Invitrogen, Karlsruhe, Germany] 25 mg/ml stock solution in H2O [Roth, Karlsruhe, Germany] 10 mg/ml stock solution in H2O [Roth, Karlsruhe, Germany] Solutions Blotting buffer Bradford Solution, 5 x Carbonate-bicarbonate buffer Coomassie Crystal violet DNA loading buffer, 5 x ECL reagent: solution A ECL reagent: solution B Glutaraldehyde Glycogen 20 % methanol, 192 mM glycine, 25 mM Tris, pH 8.3 Bio-Rad protein assay [Bio-Rad, Munich, Germany] 50 mM, pH 9.6, (3 ml of 0.1 M sodium carbonate, 7 ml of 0.1 M sodium bicarbonate) Serva Blau G C.I. 42655, Brilliant Blue G-250 [Serva Feinbiochemica, Heidelberg, Germany], 80 mg in 1 L H2O, 35 mM HCl 0.5 % crystal violet, 20 % methanol in H2O 1 ml TAE buffer, 50 x, 2.5 ml glycerol, 0.02 % (w/v) bromophenol blue, ad 10 ml H2O 0.1 M Tris/HCl (pH 8.6), 1.25 mM luminol sodium salt [Sigma-Aldrich, Taufkirchen, Germany] 11 mg para-hydroxycoumaric acid [Sigma-Aldrich, Taufkirchen, Germany] in 10 ml DMSO 25 % solution in H2O [Serva, Feinbiochemica, Heidelberg, Germany] #R0561 [Fermentas, St. Leon-Rot, Germany] 32 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz IMAC Na-phosphate buffer, 5 x (low salt) Lysis-buffer PBA PBS, 1 x PEG-NaCl Periplasmatic preparation buffer, PPB Protein A buffer A Protein A elution buffer Protein A wash buffer SDS loading buffer, 5 x SDS running buffer, 10 x Sulfo-NHS-SS-Biotin TAE buffer, 50 x TMB substrate TNF 2.1.7 E. coli HB2151 E. coli DH5α E. coli BL21-DE3 Phage VCS M13 B16-FAP Colo+ MEF HEK 293 HT1080 HeLa Antigen 0.02 M NaH2PO4 (2.4 g), 0.15 M NaCl (8.8 g) ad 1 L H2O, pH 8.0 100 mM glycine pH 3.0 100 mM Tris-HCl pH 8.0 and 10 mM Tris-HCl pH 8.0 non-reducing: 30 % (v/v) glycerol, 3 % (w/v) SDS, 2 µg/ml bromophenol blue in 62.5 mM Tris-HCl, pH 6.8 reducing: add 5 % (v/v) -mercaptoethanol 1.92 M glycine, 0.25 M Tris, 1 % SDS, pH 8.3 Prod.no. 21328 [Pierce, Rockford, USA] 2 M Tris, 0.95 M glacial acetic acid, 50 mM EDTA in H2O, pH 8 100 µl TMB (100 mg/ml stock in DMSO), 2 µl 30 % H2O2, 10 ml Naacetate buffer, pH 6 (100 mM) soluble human TNF + HSA; 0.5 mg/ml (21.07.2008), in-house production [Stratagene, La Jolla, USA], Genotype: supE thi-1 Δ(lac-proAB) Δ(mcrB-hsdSM)5 (rK– mK–) [F´ traD36 proAB lacIqZΔM15]. (Carter et al. 1985) F- endA1 glnV44 thi-1 recA1 relA1 gyrA96 deoR nupG Φ80dlacZΔM15 Δ(lacZYA-argF)U169, hsdR17(rK- mK+), λ– F– ompT gal dcm lon hsdSB(rB- mB-) λ(DE3 [lacI lacUV5-T7 gene 1 ind1 sam7 nin5]) Interference-resistant helper phage, cat.no. 200251 [Stratagene, La Jolla, USA] Cell lines CHO-K1 Kym-1 2.1.9 250 mM Na-phosphate (37.38 g Na2HPO4 · 2H2O + 6.24 g NaH2PO4 · 2H2O), 1.25 M NaCl, pH 7.5, ad 1 L H2O 100 mM NaH2PO4, 10 mM Tris, 8 M urea 2 % FCS, 0.2% NaN3 in sterile PBS, 1 x 2.67 mM KCl, 1.47 mM KH2PO4, 137.93 mM NaCl, 8.06 mM Na2HPO4 · 7H2O, pH 7.5 200 g Polyethylenglycol 6000, 2.5 M NaCl, ad 1 L H2O 30 mM Tris-HCl pH 8.0, 1 mM EDTA, 20 % sucrose in H2O Bacteria and phage E. coli TG1 2.1.8 Methods Chinese hamster ovary [Lonza Biologics, Berkshire, UK] Human rhabdomyosarcoma from neck tumor (JCRB0627), supplied by M Sekignchi, University of Tokyo, Japan Mouse melanoma Human adenopancreatic carcinoma (Colo 357), provided by [Multimmune GmbH, Munich, Germany] immortalized mouse embryonic fribroblasts from TNFR1/TNFR2 double knock-out mice, stably transfected with human TNFR1-Fas or TNFR2-Fas (Krippner-Heidenreich et al. 2002) Human embryonic kidney Human fibrosarcoma (ECACC85111505) Human cervix carcinoma (DSMZ ACC 57) Antibodies Origin human Conjugate - Company [Sigma-Aldrich, Taufkirchen, Germany] 33 Cat.no. I 4506 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz His6-Tag, Hisprobe (H-3) Hsp70 (cmHsp70.1) Human Albumin Human IgG (Fabspecific) Human IgG (Fcspecific) Human IgG (whole molecule) Human lambda light chain-b+f Human TNFReceptor I (CD120a) M13 Mouse IgG (Fcspecific) Myc-tag (9E10) Methods IgG mouse HRP mouse FITC rabbit goat HRP [Santa Cruz Biotechnology, Santa Cruz, sc-8036 USA] [Multimmune GmbH, Munich, Germany] [Sigma-Aldrich, Taufkirchen, Germany] A 0433 [Sigma-Aldrich, Taufkirchen, Germany] A 0293 goat HRP [Sigma-Aldrich, Taufkirchen, Germany] A 0170 rabbit HRP [Sigma-Aldrich, Taufkirchen, Germany] A 8792 goat HRP [Bethyl, Montgomery, USA] A80-116P mouse - [Hbt Hycult biotechnology b.v.] in house production Cat.no. HM2020b goat goat HRP HRP [Pharmacia, Stockholm, Sweden] [Sigma-Aldrich, Taufkirchen, Germany] 27-9421-01 A 2554 mouse - [Sigma-Aldrich, Taufkirchen, Germany] HRP [Sigma-Aldrich, Taufkirchen, Germany] OM-11-908 (Genosys) A 0545 Rabbit IgG (whole goat molecule) 2.1.10 Antigens CEA HSA Hsp70 FZ30-AC25 [Europa Bioproducts Ltd, Cambridge, UK] A3782 [Sigma-Aldrich, Taufkirchen, Germany] [Multimmune GmbH, Munich, Germany] 2.1.11 Enzymes Alkaline phosphatase FailSafe™PCR Herculase®Enhanced DNA Polymerase REDTaq ReadyMix™ Taq DNA-Polymerase T4 DNA Ligase N-glycosidase F 5 U/µl [Fermentas, Burlington, USA] PreMixSelection Kit, Cat.Nos. FS99060 [Epicentre, Madison, USA] 5 U/µl [Stratagene, La Jolla, USA] 0.06 U/µl, Cat.no. R2523 [Sigma-Aldrich, Taufkirchen, Germany] 1 U/µl [Fermentas, Burlington, USA] 5 U/µl), [Fermentas, Burlington, USA] PNGase F, cat.no. 11 365 185 001 [Roche Diagnostics, Mannheim, Germany] 2.1.12 Restriction Enzymes AdeI/DraIII Alw44I/ApaLI BamHI Bpu10I BshTI/AgeI Bsp1407I/BsrGI Cfr9I/XmaI EcoRI HindIII 10 U/µl 10 U/µl 10 U/µl 10 U/µl 10 U/µl 10 U/µl 10 U/µl 10 U/µl 10 U/µl [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] 34 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz KpnI NcoI NheI NotI PstI SfiI SgsI (AscI) XbaI XhoI 20 U/µl 10 U/µl 10 U/µl 10 U/µl 20 U/µl 10 U/µl 5 U/µl 10 U/µl 10 U/µl Methods [New England Biolabs, Ipswich, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [New England Biolabs, Ipswich, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] [Fermentas, Burlington, USA] 2.1.13 Kits, Marker Amine Coupling Kit First Strand cDNA Synthesis Kit Gene RulerTM DNA Ladder Mix ready-touse High sensitivity human ELISA set (interleukin 6, interleukin 8) MycoAlert®Mycoplasma Detection Kit NucleoBond®Xtra Midi NucleoSpin®Extract II Kit Page RulerTM Prestained Protein Ladder Page RulerTM Prestained Protein Ladder Plus PureLink™ Quick Plasmid Miniprep Kit QIAprep® Spin Miniprep Kit Streptavidin Poly-HRP Prod.no. 3501-3001 [Attana, Stockholm, Sweden] #K1612 [Fermentas, St. Leon-Rot, Germany] #SM0333 [Fermentas, St. Leon-Rot, Germany] Cat.No.: 31330069/ 31330089 [ImmunoTools, Friesoythe, Germany] Cat.no.LT07-218 [Lonza Rockland, Rockland, USA] [Macherey-Nagel, Düren, Germany] [Macherey-Nagel, Düren, Germany] #SM0671 [Fermentas, St. Leon-Rot, Germany] #SM1811 [Fermentas, St. Leon-Rot, Germany] Catalog nos. K2100-10, K2100-11 [Invitrogen, Carlsbad, USA] Cat no 27104 [Qiagen, Hilden, Germany] Cat.no. 31334248 [ImmunoTools, Friesoythe, Germany] 2.1.14 Primer 2.1.14.1 Primer for cloning of IgG humex name HindIII-Igk-AgeIVL-humex-back no sequence target 242 5’AAT CCC AAG CTT ATG GAG ACA GAC ACA CTC CTG CTA VL TGG GTA CTG CTG CTC TGG GTT CCA GGT TCC ACC GGT humex VL humex-AscIforward HindIII-Igk-AgeIVH-humex-back 240 5’ T TGG CGC GCC CTT TGG CTG GCC CAG CAC GGT CAG VL CTT GGT C 3’ humex 5’AAT CCC AAG CTT ATG GAG ACA GAC ACA CTC CTG CTA 243 VH TGG GTA CTG CTG CTC TGG GTT CCA GGT TCC ACC GGT humex CAG GCC GTG GTG ACC CAG GAG 3’ GAG GTG CAG CTG GTC GAG AGC 3’ VH humex-XhoI- 241 5’ T ACC GCT CGA GAC GGT CAC GGT GGT GCC CTG 3’ for VH humex 2.1.14.2 Primer for cloning of Hsp70 fragments name Hsp70-495-NotI-for no 235 Hsp70-504-NotI-for 270 Hsp70-514-NotI-for 234 Hsp70-Fragment 1- 198 sequence 5’ A TAG TTT AGC CGT GGC 3’ 5’ A TAG TTT AGC CTT GTT GGC 3’ 5’ A TAG TTT AGC CAG GCG 3’ 5’ A TAG TTT AGC GGC CGC GGT GCT CTT GTC target Hsp70 GGC CGC GGT GAT GGT GAT Hsp70 GGC CGC CTC CTC CTT GCT Hsp70 GGC CGC GTC CAG CAG CAG Hsp70 35 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz NotI-for Hsp70-Fragment 3-NotIfor Hsp70-Fragment 4-NotIfor Hsp70-Fragment2-NotIfor NcoI-Hsp70-425-back Methods 194 CAG GTC 3’ 5’ A TAG TTT AGC GGC CGC GTT GAA GGC GTA GGA CTC 3’ Hsp70 192 5’ A TAG TTT AGC GGC CGC ATC TAC CTC CTC AAT GGT G 3’ Hsp70 196 5’ A TAG TTT AGC GGC CGC CTC GAT CTG GGG CAC GCC 3’ Hsp70 233 5’ CAT GCC ATG GCC ACG CAG ATC TTC ACC ACC 3’ 5’ CAT GCC ATG GCC ACG GCC GGA GGC GTG ATG 3’ 5’ CAT GCC ATG GCC ACC TAC TCC GAC AAC CAA 3’ 5’ CAT GCC ATG GCC ATG ACG AAA GAC AAC AAT 3’ 5’ CAT GCC ATG GCC GGC ATC CCT CCG GCC CCC AGG 3’ 5‘ CAT GCC ATG GCC CAG ATC GAG GTG ACC TTC 3’ 5’ CAT GCC ATG GCC AAC GGC ATC CTG AAC 3’ 5’ CAT GCC ATG GCC ACG GAC AAG AGC ACC 3’ 5’ CAT GCC ATG GCC AAA GCC GCG GCG ATC GGC 3’ Hsp70 NcoI-Hsp70-404-back 232 NcoI-Hsp70-430-back 260 NcoI-Hsp70-449-back 266 NcoI-Hsp70-463-back 267 NcoI-Hsp70-473-back 268 NcoI-Hsp70-482-back NcoI-Hsp70-490-back NcoI-Hsp70-Fragment 1back NcoI-Hsp70-Fragment 2back NcoI-Hsp70-Fragment 3back NcoI-Hsp70-Fragment 4back 269 261 199.1 Hsp70 Hsp70 Hsp70 Hsp70 Hsp70 Hsp70 Hsp70 Hsp70 197.1 5’ CAT GCC ATG GAC AAG TCC GAG AAC GTG 3’ Hsp70 195.1 5’ CAT GCC ATG GTG CTG ATC CAG GTG TAC 3’ Hsp70 193.1 5’ CAT GCC ATG GTG TCA GCC AAG AAC GCC 3’ Hsp70 2.1.14.3 Primer for site-directed-mutagenesis of scFvIZI-06.1 name CDRH1mutbackNheI CDRH2mutbackXmaI CDRL2-mutBamHI-for CDRL1-mutPstI-for no 295 sequence 5‘ TGC AAA GCT AGC GGC TAT ACC TTT ACC NHK NHK NHK ATT AAC TGG GTG CGT CAG GCA CCC 3‘ target VH IZI06.1 296 5’ CAG GCA CCC GGG CAG GGC CTG GAA TGG ATT GGC NHK ATT NHK CCG NHK NHK GGC NHK GCA NHK TAC AAC NHK AAA TTC AAA GCG CGT GTG ACC 3’ VH IZI06.1 297c 5’ GCT ACC GGA TTC GCT AAA GCG ATC CGG CAC GCC MDN VL IZI06.1 VL IZI06.1 AAA ACG MDN GCT CAC MDN ATA AAT CAG CAG CTG CGG 3’ 298 5’ CGG TTT CTG CAG ATA CCA ATG CAG MDN GGT MDN GCC MDN MDN MDN CAG CAG GCT CTG GCT GCT ACG GCA 3’ 2.1.14.4 Primer for screening or sequencing name fdSeq1 LMB2 LMB3, M13-RP Lonza-14.4-R Lonza-F pET-Seq1, T7-981079 pSec-Seq2 no 258 326 88 84 82 89 91 sequence 5’ 5’ 5’ 5’ 5’ 5’ 5’ GAA GTA CAG CCT GCC TAA TAG TTT AAA GAA GAA ACC TAC AAG TCT CGA ACA CCT AGA GAC GCA GTA CGG GCT GAA CAT TCA CAG TGA CCA ATG ACA AAT CTA TCG GG 3’ GT 3’ ACC A 3’ TAA 3’ AGC 3’ TAG G 3’ AGG 3’ target pHEN pAB1 pAB1, pHEN pEE6.4, pEE14.4 pEE6.4, pEE14.4 pSecTagA pSecTagA 36 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.1.15 Vectors pAB1 pEE14.4 pEE6.4 pET-28b pHEN2 pSecTagA 3342 bp, vector for prokaryotic protein expression in E. coli TG1 (Kontermann et al. 1997) 10124 bp, GS-encoding expression vector, GS-System™pEE Expression Vectors [Lonza Biologics, Berkshire, UK] 5067 bp, accessory vector, GS-System™pEE Expression Vectors [Lonza Biologics, Berkshire, UK] 5369 bp, Cat-no. 69685-3 [Novagen, Merck Bioscience, Nottingham, UK] 4600 bp, 15 aa linker, pUC119 backbone 5166 bp, eukaryotic expression [Invitrogen, Karlsruhe, Germany] 2.2 Methods 2.2.1 Cloning 2.2.1.1 Bacterial culture E. coli strains TG1 and DH5α were used as cloning hosts and for amplification of plasmid DNA. E. coli strains TG1, BL21-DE3 and HB2151 were used for production. Glycerol stocks consisting of 700 µl overnight culture and 300 µl glycerol were frozen at -80 °C for long-time storage. 2.2.1.2 Chemical competent E. coli cells 50 ml LB medium were inoculated with 1 ml of an overnight culture of E. coli TG1, BL21-DE3 or DH5α and incubated at 37 °C to OD600 nm 0.5 – 0.6. The cells were cooled on ice for 15 min and harvested by centrifugation (Jouan GR4i, 3500 rpm, 5 min, 4 °C). The resulting cell pellet was resuspended in 50 ml 0.1 M CaCl2 and incubated on ice for 30 minutes. The cells were centrifuged again (3500 rpm, 5 min, 4 °C) and resuspended in 10 ml 20 % glycerol/50 mM CaCl2. Finally the cell suspension was frozen in aliquots of 500 µl and stored at -80 °C. 2.2.1.3 Electro competent E. coli cells 450 ml SOB medium were inoculated with 5 ml of an overnight culture (E. coli TG1, SOB) and incubated at 37 °C for about 3 h with vigorous shaking until the OD600 nm was approximately 0.7 – 0.8. Cells were chilled on ice for 1 h and harvested by centrifugation (J2-MC, JA10, 2000 x g, 10 min, 4 °C). The cell pellet was resuspended in 200 ml cold sterile water and again centrifuged (J2-M2, JA10, 2000 x g, 15 min, 4 °C). The pellet was resupended in 200 ml cold sterile water and incubated on ice for 30 min. The cells were harvested by centrifugation (J2-MC, JA10, 2000 x g, 15 min, 4 °C) and this time resuspended in 25 ml cold 10 % glycerol and transferred to a 50 ml conical tube. The cell suspension was incubated for additional 30 min on ice and cells were harvested by centrifugation (Jouan GR4i, 1500 x g, 15 min, 4 °C). The supernatant was removed and cells were resuspended in a final volume of 1 ml cold 10 % glycerol. 40 µl aliquots of electro competent cells were directly used for electroporation. 37 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.1.4 Polymerase chain reaction Polymerase chain reaction (PCR) was used for amplification of desired DNA fragments. Different Polymerases and different composition were used: Polymerase Input template Primer (each) Deoxynucleotide buffer MgCl2 dH2O total volume 0.5 µl Herculase Enhanced DNA Polymerase (2.5 U total) 1-15 ng vector DNA 100-200 ng genomic DNA 1.25 µl Taq DNA Polymerase (1.25 U total) 1-15 ng vector DNA 100-200 ng genomic DNA 1 µl (10 pmol/µl) 1 µl (10 pmol/µl) (1 µM final concentration) (1 µM final concentration) 200 µM each dNTP (0.8 200 µM each dNTP mM total) (0.8 mM total) 0.5 µl FailSafe PCR Enzyme Mix (1.25 U total) 1-15 ng vector DNA 100-200 ng genomic DNA 0.5 µl (50 pmol/µl) (1 µM final concentration) PreMix contains 400 µM of each dNTP (0.8 mM total) 5 µl 10 x Herculase 5 µl 10 x Taq buffer PreMix contains 100 mM Reaction buffer (+(NH4)2SO4) Tris-HCl, pH 8.3, 100 mM KCl 4 µl (25 mM) (2 mM final concentration) x µl x µl x µl reaction 50 µl 50 µl 25 µl 2.2.1.5 Site directed mutagenesis In PCR the randomized primers amplified most of the scFv gene and introduced mutations into the CDR. At the same time these primers appended the restriction sites for cloning the fragment into acceptor plasmid pHENIS-scFvIZI-06.1_notwt (midi-no 0586) which was modified to contain a deletion after CDRH2 and an additional stop-codon to prevent production of wild type scFv. 50 µl PCR reaction mix was prepared containing: water 34.25 µl dNTPs (20 mM, 5 mM each) 2.5 µl 10 x taq buffer +(NH4)2SO4 5 µl MgCl2 (25 mM) 4 µl primer forward (10 pmol/µl) 1 µl primer reverse (10 pmol/µl) 1 µl scFv gene template (100 ng) 1 µl taq-DNA polymerase (1 U/µl) 1.25 µl 38 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods PCR program no 14 was used (94°, 1’, 55°, 1’, 72°, 1’; 30 cycles). The gene-repertoires were gelpurified (1 % agarose gel electrophoresis) and the DNA was extracted using NucleoSpin®Extract II Kit (Macherey-Nagel). Purified DNA was dissolved in 30 µl H2O and DNA concentration was determined by photometric measurement (Nanodrop). 2.2.1.6 Restriction digest, Ligation, Ethanol precipitation 1 µg DNA in a total volume of 20 µl was used in analytical digestion, while 5 – 10 µg DNA in a total volume of 50 µl was used in preparative digestion. Restriction enzymes were used in excess (ca. 20 U/ reaction mix). The used buffers and incubation times were chosen according to the manufacturer’s protocol. For buffer exchange the NucleoSpin® Extract II Kit (Machery-Nagel) was used. Previous to ligation, vectors were dephosphorylated with 1 µl of alkalic phosphatase (5 U/µl) in a total volume of 50 µl alkalic phophatase buffer for 60 min at 37°C to avoid religation of the vector. Ligation of linearised, dephosphorylated vector and insert was carried out in a total volume of 20 µl ligation buffer with a molar ration of vector to insert of 1:3 to 1:5 and 1 µl T4-DNA ligase (5 U/µl). After incubation for 60 min at room temperature 10 µl of the ligation mixture were used for transformation of competent bacterial cells. To digest scFv repertoires 50 µl reaction mixes were prepared containing 1 – 4 µg scFv DNA, one or two restriction enzymes (1 – 2 µl each) and 5 µl of the appropriate buffer 10 x (according to manufacturer’s protocol). The digestion was incubated overnight at 37 °C and gel-purified the next day. Approximately 20 µg of purified pHEN2 scFvIZI-06.1_notwt were digested with the appropriate enzymes and dephosphorylated using CIP (calf intestine phosphatise, Fermentas). For ligation of scFv repertoires 2000 ng digested acceptor vector and 5-fold molar excess of digested scFv gene repertoire (molar ratio of insert to vector: 5:1) were mixed, 3 µl T4 DNA ligase (5 U/µl) and 5 µl of 10 x ligation buffer were added (total volume: 50 µl). Ligation was carried out overnight at 16 °C. DNA was ethanol precipitated by adding 1/10 volume (5 µl) of 3 M NaOAc pH 5.2 and glycogen (Fermentas) to a final 0.05 – 1 µg/µl concentration. 2.5 volume (125 µl) of 100 % EtOH were added, mixed and the mix was incubated for 1 hour at -80 °C. After centrifugation (eppendorf, 13000 x g, 4 °C) the DNA pellet was rinsed two times with 70 % EtOH, air-dried and resuspended in 10 µl H2O. 2 µl/transformation of were used for electroporation. 2.2.1.7 Antibody humanization A humanized version of cmHsp70.1 (humex) was generated by grafting all 6 complementarity determining regions (CDRs) onto human variable germline genes IGHVH3-66 (DP86) and IGLV7-43 (DPL18, VL3-2) similar to the tumex VH and VL sequence, respectively. The amino acid sequences 39 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods were back-translated into a nucleotide sequence using preferred codon frequencies of homo sapiens. Codon-optimized DNA encoding the two humanized variable domains (VH humex, VL humex) was synthesized by GeneArt (Regensburg, Germany). The genes encoding the variable heavy and light chain domain of antibody humex were supplied in vector pGA4 containing appropriate cloning sites. For cloning of scFv humex, plasmid pGA4-VHhumex was digested with restriction enzymes NcoI and XhoI and the resulting fragment was cloned into vector pHENIS (pHEN2 with His-tag, containing a linker sequence (G4S)3) digested with the same enzymes. Subsequently, the plasmid pGA4-VLhumex was digested with the restriction enzymes ApaLI and NotI and the resulting fragment was cloned into vector pHENIS-VHhumex digested with the same enzymes. Finally, the DNA encoding the scFv fragment was subcloned into pAB1 via NcoI and NotI. 2.2.1.8 Cloning of IgG humex For construction of an IgG molecule in the Lonza expression system, the VH humex-encoding region was reamplified from plasmid pGA4 with primers incorporating restriction sites HindIII and XhoI and a modified Igκ-leader sequence containing an AgeI site to allow correct N-terminal processing (HindIII-Igκ-AgeI-VHhumex-back, VHhumex-XhoI-for) and cloned into vector pEE6.4-CH1-CH3 containing the human γ1 heavy chain constant regions. The VLhumex encoding region was reamplified from plasmid pGA4 with primers incorporating both restricition sites HindIII and AscI and the Igκ-leader sequence (HindIII-Igκ-AgeI-VLhumex-back, VLhumex-AscI-for) and cloned into pEE14.4Cλ containing the human lamda light chain constant region. The two plasmids were then combined according to the manufacturer’s protocol (via NotI and BamHI) resulting in a bicistronic expression plasmid with the heavy chain gene downstream of the light chain gene (pEE14.4 IgG humex). 2.2.1.9 Cloning of Hsp70 fragments Human Hsp70 cDNA was reverse-transcribed from the total RNA of heat-shock treated Colo+ cells and used as PCR-template for amplification of overlapping Hsp70 fragments. The respective primers introduced a NcoI and a NotI restriction site at the 5’ and the 3’ ends. The PCR products were digested with restriction enzymes NcoI and NotI and cloned into plasmid pET-28b (Novagen) containing a C-terminal hexahistidyl-tag sequence. The expression plasmids were transformed into chemically competent E. coli BL21-DE3. Hsp70 fragments less than 100 amino acids were produced as fusion proteins with human serum albumin domain 3 (AlF3: aa 382-582 of HSA). The DNA encoding AlF3 was cloned into vector pAB1 as NotI-AlF3-His-EcoRI fragment resulting in pAB1-AlF3. The Hsp70 fragments were introduced upstream of AlF3 via NcoI/NotI, the resulting plasmids were transformed into E. coli TG1. 40 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.1.10 Cloning of chimeric TNFR1-Fc fusion proteins DNA encoding the extracellular region of human TNFR1 (aa 29-211), rhesus TNFR1 (aa 27-209), and mouse TNFR1 (aa 30-212) was produced synthetically (Geneart, Regensburg, Germany), introducing appropriate restriction sites between the individual domains, and cloned into pSecTagL1-Fc (modified from pSecTag-FcHis, (Muller et al. 2008). Chimeric human/mouse TNFR1-Fc fusion proteins were generated by exchanging the different regions between human and mouse TNFR1-Fc. 2.2.1.11 Heat shock transformation of E. coli TG1 Chemical competent cells were thawed on ice and 100 µl of cell suspension were incubated together with 10 µl ligation for 15 min on ice. The bacteria were exposed to a heat shock for 45 sec in a 42 °C water bath and then cooled for 1 min on ice. After addition of 1 ml LB medium the bacteria were grown for 1 hour at 37 °C to permit expression of the resistance gene. Cells were harvested by centrifugation, resuspended in the reflux (ca. 100 µl) and plated on agar plates (LB amp, glc). Plates were incubated overnight (37 °C). 2.2.1.12 Electroporation of E.coli TG1 Electroporation cuvettes, microcentrifuge tubes were pre-chilled and electro competent cells were handled on ice. 40 µl E. coli TG1 were mixed with 2 µl plasmid DNA (in H2O), the electroporator was set to a voltage of 1700 V (17 kV/cm field strength), a resistance of 200 Ω and a capacity of 25 µF. The sample was pulsed once and immediately resuspended in pre-warmed SOC medium (1 ml, 37 °C). Cells were transferred to a sterile 14-ml BD Falcon polypropylene round-bottom tube and incubated for 1 hour at 37 °C with shaking. Serial dilutions of the transformation mix were plated onto TYEamp, glc plates. The cells were harvested by centrifugation, resuspended in 200 µl SOC medium and plated onto 15 cm TYEamp, glc plates. Plates were incubated overnight at 37 °C. The next day colony numbers were counted for calculation of the library size. Bacteria were scraped from the plates by adding 2 ml of 2xTY medium. The number of bacteria per ml was calculated (OD600nm of 1.0 corresponds to 5 x 108 cells). Glycerol stocks containing bacteria in 10-fold excess of the calculated number of different clones were stored at – 80 °C. 2.2.1.13 Screening of clones The screening for positive clones was performed by analytical PCR for inserts. Single clones were picked and used as template in REDTaq™Ready Mix (Sigma), simultaneously this clones were plated on a masterplate and incubated overnight (37 °C). Both PCR program and primer were chosen according to the expected fragments and the used plasmids. Samples were separated in agarose gel electrophoresis and positive clones could be identified due to bands of the predicted size. One of these clones was used to inoculate an overnight culture designated for plasmid isolation (Midi). 41 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.1.14 Plasmid-DNA Isolation (Midi, Mini) For the isolation of plasmid DNA from bacterial cells the NucleoBond®Xtra Midi (Macherey-Nagel) was used according to the manufacturer’s instruction. The obtained DNA pellets were air dried resolved in 100 µl H2O and stored at -20 °C. Purification of plasmid DNA from 1 – 5 ml overnight culture was done using QIAprep® Spin Miniprep Kit (Qiagen) according to manufacturer’s instructions. 2.2.1.15 Sequence Analysis Sequencing was performed by GATC Biotech AG (Konstanz, Germany). Analysis of the resulting sequence was performed using the program `blast` (Tatusova and Madden 1999) and the program ‘Clone Manager 7’ version 7.11 for windows. 2.2.2 Phage display 2.2.2.1 Preparation of helper phage An overnight culture was inoculated with a single clone of TG1 grown on a minimal plate. The next day this overnight culture was used to inoculate 12 ml 2xTY. The culture was incubated at 37 °C with shaking until OD600nm reached 0.3 – 0.5. 100 µl of serial dilutions of helper phage (VCSM13, Stratagene) were mixed with 100 µl of log-phase TG1 and 3 ml pre-warmed (42°C) top agar and plated onto TYE plates. The next day a single plaque from the lawn was transferred to 3 ml 2xTY containing 100 µl of a TG1 overnight culture and incubated for 3 hours with shaking at 37 °C. The grown plaque was used to inoculate 500 ml 2xTY and incubated for 1 hour (37 °C, shaking) before 25 µg/ml kanamycin was added. The culture was incubated overnight at 37 °C with shaking. The next day bacteria were removed by centrifugation (J2-MC, JA10, 6300 x g, 30 min) and the supernatant containing the helper phage was heated to 65 °C for 15 min. After spinning down cell debris, helper phage were aliquoted and stored at -20 °C. An aliquot was checked on a TYE plate for remaining bacteria. Phage titre was determined using top agar and serial dilution of phage. 2.2.2.2 Immunotube selection Immunotubes were coated with 1 ml of antigen (1 – 0.1 µg/ml) in PBS overnight at 4 °C. The next day immunotubes were washed (PBS, 3 x) and blocked with PBS, 2 % skimmed milk powder (2 % MPBS) for 2 hours at RT. Antibody-phage (from the library-stock or from a previous selection round) were pre-incubated with 1 ml 2 % MPBS for 30 min. Pre-blocked phage were incubated in the immunotube for 2 hours. Immunotubes were washed with PBS, 0.1 % Tween 20 (PBST) and PBS with increasing stringency (Table 2-1) and phage were eluted by incubation with 1 ml 100 mM TEA (triethylamine) for 8 – 10 min. Eluted phage were transferred to a sterile reaction tube containing 500 µl 1 M Tris- 42 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods HCl pH 7.5 to neutralize the solution. 1 ml of neutralized phage was added to 10 ml of log-phase TG1 and (from round 2 on) 10 µl of neutralized phage were added to 1 ml of log-phase HB2151 (to get colonies for soluble expression). Transduced bacteria were incubated at 37 °C standing for 30 min and additional 30 min with shaking. Serial dilutions of TG1 and HB2151 (in 100 µl 2xTY) were plated onto TYEamp, glc plates. The remaining TG1 culture was centrifuged (Jouan GR4i, 2100 x g, 10 min) and the cell pellet was resuspended in 1 ml 2xTY and plated onto nunc square 24x24 cm TYEamp, glc plates. Table 2-1: Conditions for immunotube selection using immobilized antigen. wash PBST wash PBS 10 µl = 2 x 10 20 x 20 x 2 h, RT 1 µl = 5 x 109 1.5 h, 6 x 20 x 2 h, RT 1 µl = 5 x 109 1.5 h, 6 x 20 x Selection Round antigen (nM) incubation phage 1st 10 nM (1 µg/ml) 2 h, RT 2nd 1 nM (0.1 µg/ml) 3rd 1 nM (0.1 µg/ml) 11 2.2.2.3 Equilibrium selection Phage were pre-blocked (2 % MPBS, 30 min, RT), for the first round of selection the number of phage should be at least 100 times higher than the library size. Biotinylated antigen was added directly into equilibrated phage to a final concentration of 10 nM (following rounds of selection see Table 2-2). The mix was incubated for 1 hour at RT on a rotator. 500 µg of washed and blocked streptavidinmagnetic beads (Dynabeads) were added to the phage-antigen mix and incubated for 15 min on a rotator. A magnetic separator was used to separate the beads. The beads were washed 3 times in MPBST (2 % MPBS, 0.1% Tween 20) and subsequently in PBS (following rounds of selection see Table 2-2) and transferred to a new reaction tube. The phage-antigen complex was eluted with 200 µl 10 mM DTT (5 min, rotator). 1 ml PBS was added, the beads were separated and the supernatant was transferred to a new tube. 750 µl of eluted phage were used to inoculate 10 ml log-phase E. coli TG1 and 10 µl eluted phage were used to inoculate 1 ml of log-phase E. coli HB2151 in an analogous manner as described in 2.2.2.2. Table 2-2: Conditions for equilibrium selection using biotinylated antigen. Selection Round 0 1st 2nd 3rd 4th 5th 6th antigen (nM) incubation phage moTNFR1-Fcbiotin, 20 nM 10 nM 10 nM 1 nM 1 nM 0.1 nM 0.1 nM 1 h, RT 10 µl = 2x10 4 h, RT o/n, 4°C; 1 h, RT o/n, 4°C;1h, RT 3 h, RT o/n, 4°C; 1h, RT 3 d, 4°C; 1h, RT 10 µl = 2x10 10 10 µl = 4x10 9 1 µl = 4x10 9 1 µl = 4x10 9 1 µl = 4x10 9 1 µl = 4x10 11 11 Dyna beads 500 µg 500 µg 500 µg 100 µg 100 µg 100 µg 100 µg wash MPBST (PBS) => use supernatant selection 3 (1) x 15 (5) x 20 (10) x 10, 1h, RT (10) x 10, 2h, RT (10) x 10, 2h, RT (10) x 43 for Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.2.4 Rescue of phage libraries for selection with helper phage Transduced TG1 were scraped from the nunc square plates by adding 10 ml 2xTY medium and using a glass spreader. Library stocks (700 µl bacteria and 300 µl of 50 % glycerol, 0.2 µm sterile filtered) were stored at – 20 °C. The number of bacteria per ml was calculated (OD600 nm of 1.0 corresponds to approx. 5 x 108 cells). The input of cells for rescuing was calculated to be in 100-fold excess of different clones in the library but should not exceed a starting OD600 nm of about 0.1. A typical inoculum was 20-50 µl of bacteria in 50 ml 2xTY (100 µg/ml ampicillin, 2 % glucose). The culture was incubated at 37 °C with shaking until an OD600 nm of 0.4 – 0.5 is reached (1-2 x 1010 bacteria). Approximately 10-fold excess (~1011 t.u.) of helper phage was added and incubated for 30 min at 37 °C standing and additional 30 min at 37 °C with shaking. 1 µl was plated onto TYE (100 µg/ml kanamycin) plate to check for infectivity of helper phage. Transduced cells were harvested by centrifugation (Jouan GR4i, 3000 x g, 10 min) to remove glucose, resuspended in 50 ml 2xTY (100 µg/ml ampicillin, 25 µg/ml kanamycin, no glucose) and incubated overnight at 30 °C with shaking. The next day bacteria were removed by centrifugation and the supernatant containing the amplified antibody-phage was transferred into a 500 ml centrifuge bottle. Phage were precipitated by adding 1/5 volume of 20 % PEG, 2.5 M NaCl and incubation at 4 °C for 1 hour with stirring, subsequently phage were harvested by centrifugation and resuspended in 40 ml PBS. Remaining bacteria were removed by an additional centrifugation step. PEG precipitation was repeated and after centrifugation the white pellet was resupended in 1 ml PBS. Phage titre was determined as described in 2.2.2.1. The phage stock was used at once for the next round of selection or stored at 4 °C for approximately 1 week. 2.2.2.5 Polyclonal phage ELISA ELISA plates were coated with antigen (hu/mo TNFR1-Fc) at 0.5 µg/ml in PBS overnight at 4 °C. After blocking (2 h, 2 % MPBS, RT) 10 µl of rescued phage in 100 µl 2 % MPBS were added and incubated for 1 hour at room temperature (RT). Bound phage were detected by anti-M13 antibody-HRP diluted 1/5000 in 2 % MPBS (1 h, RT) as described in 2.2.9. 2.2.2.6 Screening of soluble scFv by ELISA Single HB2151 colonies from selection from phagemid libraries are transferred to a sterile 96-well microtiter plate containing 100 µl 2xTY (100 µg/ml amp, 2 % glucose). This masterplate was incubated overnight at 37 °C with shaking and used the next day to inoculate a fresh plate containing 125 µl 2xTY (100 µg/ml ampicillin, 0.1 % glucose). The masterplate was conserved by adding 50 µl of 2xTY, 45 % glycerol to each well and stored at -20 °C. The induction plate was incubated at 37 °C with shaking for approximately 3 hours (until an OD600 nm of 0.8 – 1.0 was reached) and production of 44 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods soluble scFv was induced by adding 25 µl of 2xTY (100 µg/ml ampicillin, 6 mM IPTG) and plates were incubated overnight at 30 °C with shaking. The next day, after centrifugation, 50 µl of supernatant from each well of the induction plate (in 100 µl 2 % MPBS) was transferred to the corresponding well of an ELISA plates (coated with antigen huTNFR1-Fc or moTNFR1-Fc at 0.5 µg/ml in PBS overnight at 4 °C). Detection was performed using anti-His6-tag antibody-HRP (Santa Cruz) 1/1000 in 2 % MPBS as described in 2.2.9. Positive clones were used to inoculate 5 ml overnight cultures (LB, 100 µg/ml amp, 1 % glc) for mini-prep. 2.2.3 Coupling peptides to carrier proteins Peptides were coupled to the carrier protein BSA using glutaraldehyde. A solution of 5 mg/ml of the synthetic peptides was prepared in PBS and the carrier protein was added at the correct molar ratio (approximately 1 mole of peptide per 50 aa of the carrier) to a total volume of 2 ml. An equal volume of a prepared solution of 0.2 % glutaraldehyde in PBS was slowly added to the peptide/protein solution with constant agitation and incubated for 1 hour at RT. Glycine (1 M stock solution) was added to a final concentration of 200 mM and incubated with stirring for 1 hour at RT. The peptideprotein conjugate was separated from the peptide by dialysis against PBS. 2.2.4 Biotinylation of antigen For a 2 mg/ml protein sample (TNFR1-Fc) a 20-fold molar excess of Sulfo-NHS-SS-Biotin was used and incubated with the protein on ice for 2 hours. The non-reacted Sulfo-NHS-SS-Biotin was removed by dialysis. Biotinylation efficiency was checked by using Dynabeads and both supernatant and bead fraction were analyzed by Western Blot using Streptavidin-HRP (1/5000) for detection. 2.2.5 Protein production 2.2.5.1 Periplasmic protein expression in E. coli TG1 (scFv, Hsp70-SBD, AlF-fusion) For soluble expression, the scFv fragments in pAB1 were transformed into E. coli TG1 and expression was induced with 1 mM IPTG. The protein was purified from the bacterial periplasm and purified by immobilized metal ion chromatography IMAC as described in 2.2.6.1. Protein concentration was determined photometrically (Nanodrop) and calculated using the calculated ε-value. Hsp70 fragments less than 100 amino acids were produced as fusion proteins with human serum albumin domain 3 (AlF3: aa 382-582 of HSA). The DNA encoding AlF3 was cloned into vector pAB1 as NotIAlF3-His-EcoRI fragment resulting in pAB1-AlF3. The Hsp70 fragments were introduced upstream of AlF3 via NcoI/NotI, the resulting plasmids were transformed into E. coli TG1 and expression was induced with 1 mM IPTG. The protein was purified from the bacterial periplasm and purified by immobilized metal ion chromatography IMAC. 45 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.5.2 Protein expression in BL21-DE3 (Hsp70-fragments) The expression plasmids (pET-28b) were transformed into chemically competent E. coli BL21-DE3. For protein production 200 ml 2xTY (0.1 % glucose, 35 µg/ml kanamycin) were inoculated with 2 ml of an overnight culture and incubated shaking at 37 °C until an OD600 nm of 0.8 - 1.0 was reached. Expression was induced with IPTG (final concentration 1 mM) and the culture was incubated overnight at room temperature with shaking. Cells were harvested by centrifugation; the pellet was resuspended in 5 ml lysis buffer (100 mM NaH2PO4, 10 mM Tris, 8 M urea) and stirred for 30 min. After centrifugation for 30 min at 10000 x g the cleared lysate was transferred to a microcentrifuge tube and stored at -20 °C. The substrate-binding domain (aa 383-548) of human Hsp70 (pET-28bHsp70-SBD) was produced in E. coli BL21-DE3 as described above and purified from the whole cell extract by IMAC. 2.2.5.3 Production of IgG humex in CHO-K1 Stable transfected CHO-K1 cells (Lonza) were selected for their ability to grow in glutamine-free medium by gradual removal of glutamine in the presence of GS inhibitor MSX. Supernatants were screened for amount of secreted product by Western Blot and for functional product by ELISA. Recombinant IgG1 was purified from cell culture supernatants by protein A chromatography. In brief, proteins were precipitated from supernatant with ammonium sulfate (60% saturation), resuspended in PBS, adjusted to pH 8.0 (by adding 1/10 volume of 1 M Tris-HCl pH 8.0) and loaded onto a protein A-Sepharose CL-4B column (Sigma-Aldrich). Bound protein was eluted with 100 mM glycine, pH 3.0 and by adding 1/10 volume of 1 M Tris-HCl pH 8.0 the pH was brought back to neutral. Proteincontaining fractions were dialyzed against PBS. 2.2.5.4 Production of chimeric TNFR1-Fc in HEK293 HEK293 cells were transfected with plasmid DNA using lipofectamine (Invitrogen, Karlsruhe, Germany) and stably transfected clones were selected in the presence of zeocin as described (Muller et al. 2007). Cells were expanded in RPMI, 5 % FCS, 2 mM L-glutamine to 90 % confluence. For protein production, the medium was substituted with Opti-MEM I (Invitrogen, Karlsruhe, Germany) and supernatant was collected every 3-4 days. 2.2.6 Protein purification 2.2.6.1 Immobilized Ni+ affinity chromatography, IMAC Recombinant scFv proteins were purified by binding via their C-terminal histidin-tag to nickelnitrilotriacetic acid-agarose beads (Ni-NTA). A column of 0.5 - 1 ml Ni-NTA beads was equilibrated with 10 - 20 ml PBS and the periplasmatic preparation was loaded. Unbound proteins were washed 46 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods off the column with 50 ml IMAC wash buffer containing 20 mM imidazole. For elution IMAC elution buffer (200 mM imidazole) was added and fractions of 500 µl were collected. The elution fractions were tested for protein content by Bradford test. According to the Bradford test elution fractions were pooled to peak and side fraction and dialyzed over night against PBS. Purity of the fractions was analysed by SDS-PAGE by comparison with crude extract, flow through and wash fraction. 2.2.6.2 Protein A affinity chromatography Proteins containing a human Fc-part were purified from cell culture supernatant by protein A chromatography. In brief, supernatants were adjusted to pH 8 by adding 1/10 volume of 1 M TrisHCl pH 8.0 and loaded onto a protein A-sepharose CL-4B column (Sigma, Taufkirchen, Germany). Unbound protein was removed by rinsing the column with 10 column volumes (CV) of 100 mM Tris pH 8.0 followed by 10 CV of 10 mM Tris pH 8.0. Bound protein was eluted with 100 mM glycine pH 3.0, neutralized by adding 1/10 volume 1 M TrisHCl pH 8.0 and protein containing fractions were dialyzed against PBS. Protein concentrations were determined photometrically and purity was analyzed by SDS-PAGE and immunoblotting using an HRP-conjugated anti IgG (Fc specific) antibody. 2.2.7 Protein characterization Size exclusion chromatography (SEC) was performed by HPLC using a BioSep-Sec-3000 column (Phenomenex, Torrance) or a BioSuite™ 250, 5 µm HR SEC (Waters GmbH, Eschborn, Germany) and PBS as mobile phase at a flow rate of 0.5 ml/min. The following standard proteins were used: thryroglobulin (669 kDa), apoferritin (443 kDa), β-amylase (200 kDa), bovine serum albumin (67 kDa), carbonic anhydrase (29 kDa), cytochrome c (12.4 kDa). 2.2.7.1 SDS-PAGE, Immunoblot and Western Blot analysis SDS-PAGE analysis was performed according to Laemmli using separation gels of 8 – 15 % (Laemmli 1970). For immunoblot analysis, cleared cell lysates were separated by SDS-PAGE and blotted onto a nitrocellulose membrane (semidry blot). The membrane was blocked with 5 % MPBS, 0.1 % Tween 20 for 30 min at room temperature. Primary antibodies were added to the membrane in PBS, 0.3 % BSA, 0.02 % azide at a concentration of 5 µg/ml for 2 h at room temperature. After washing, bound antibodies were detected with HRP-conjugated anti-human or anti-mouse secondary antibodies. Membranes were developed with ECL substrate solution for 1 min. For Western Blot analysis purified proteins were separated by SDS-PAGE and blotted onto a nitrocellulose membrane (semidry blot) as described for immunoblot analysis. Detection was performed with appropriate HRP-conjugated antibodies. 47 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.7.2 Thermal stability The melting points of the scFv and IgG molecules were determined by dynamic light scattering using a ZetaSizer Nano ZS (Malvern, Herrenberg, Germany). Approximately 100 µg of purified scFv was diluted in PBS to a total volume of 1 ml and sterile-filtered into a quartz cuvette. Dynamic laser light scattering intensity (kcps) was measured while the temperature was increased in 1 °C intervals from 35 to 65 °C with 2 min equilibration for each temperature step. The melting point was defined as the temperature at which the light scattering intensity dramatically increased. 2.2.7.3 Deglycosylation Antibodies (IgG tumex, IgG humex; 10 µg in PBS) were denatured at 95 °C for 5 min and subsequently incubated with 2 units N-glycosidase F (Roche, Mannheim, Germany) in a volume of 30 µl at 37 °C overnight. Subsequently, untreated and deglycosylated proteins were analyzed by SDS-PAGE and stained with Coomassie. 2.2.8 Affinity measurements All experiments were carried out with an Attana A100 C-Fast system. Binding experiments were performed in PBS 0.005 % Tween 20 at a flow rate of 25 to 35 µl/min and temperature was controlled at 20 °C. The antigen was immobilized on an Attana carboxyl sensor chip by amine coupling at a concentration of 50 µg/ml according to the manufacturer’s protocol, resulting in a frequency shift of 200 Hz. Varying concentrations of the antibodies from 3.9 to 250 nM were analyzed for binding. The chip was regenerated with 10 mM glycine-HCl, pH 3.0. Buffer injections were performed prior to each sample injection to use as a reference in Attester Evaluation. Additionally, Attana biotin sensor chips were used together with a Mouse-IgG capture kit and a Human-IgG capture kit, respectively, to capture the IgG molecules at 5 µg/ml followed by injections of varying concentrations of antigen from 3 to 100 nM. Data were collected by Attester 3.0 (Version 3.1.1.8, Attana, Stockholm, Sweden) and analyzed by ClampXP (Myszka and Morton 1998). A mass transport model (Myszka 1997) was fitted to the data. 2.2.9 ELISA Antigen was coated onto polystyrene mictrotiter plates (Greiner Bio-One, Frickenhausen, Germany) at different concentrations (Hsp70-SBD: 3 µg/ml; TNFR1-Fc: 0.5 – 1 µg/ml) in PBS overnight at 4 °C. Remaining binding sites were blocked with PBS, 2 % skimmed milk powder (MPBS) for 2 h at room temperature. Primary antibodies were added in 2 % MPBS at the indicated concentrations and incubated for 1 h at room temperature. After washing, bound monoclonal antibodies were detected with horseradish peroxidase-conjugated anti-human, anti-mouse, or anti-His secondary antibodies diluted in 2 % MPBS. Detection was performed using TMB substrate (1 mg/ml TMB, sodium acetate 48 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods buffer, pH 6.0, 0.006 % H2O2). The reaction was stopped with 50 µl of 1 M H2SO4. Absorbance was measured at 450 nm in an ELISA reader (Tecan infinite M200). 2.2.10 Flow cytometry Binding to TNFR1-Fas or TNFR2-Fas transfected MEF cells was analyzed by flow cytometry. Cells (2 x 105) were incubated with dilution series of antibodies for 4 h at 4 °C (Benedict et al. 1997). Cells were then washed with PBS and bound antibodies were detected with PE-labeled goat anti-mouse or antihuman antibody. Cells were analyzed by flow cytometry (Cytomics FC 500, Beckmann-Coulter, Krefeld, Germany). Data were evaluated with the program WinMDI, version 2.9, and fitted with GraphPrism software (La Jolla, USA) from 3 independent binding curves. 2.2.11 Cytotoxicity Kym-1 cells (1.5 x 104 cells/100 µl) were grown in 96-well plates over night. A constant amount of human soluble TNF (1.25 ng/ml in medium) was applied after preincubation with antibodies in triplicates (concentrations as indicated in the figures) in medium for 1 h. After 7 h cells were stained by crystal violet (20 % methanol, 0.5 % crystal violet) for 20 min. The wells were washed with H2O and air-dried. The dye was resolved with methanol for 20 min and optical density at 550 nm was determined (Tecan infinite M200). 2.2.12 IL-6 and IL-8 assays HT1080 cells (2.0 x 105 cells/100 µl) were grown in 96-well plates over night. The next day, the medium was exchanged to remove constitutively produced IL-8 and the cells were incubated in duplicates together with serial dilution of human soluble TNF for additional 18 h. Induction of IL-8 production and secretion into the culture supernatant was determined by an IL-8-Sandwich ELISA (ImmunoTools, Friesoythe, Germany) according to the manufacturer’s protocol. In addition, cells were incubated with serial dilutions of antibodies in presence (constant TNF 1 ng/ml) and absence of TNF and analyzed for IL-8 secretion after 18 h of incubation. In the same way, we analyzed the inhibitory effects of the antibodies on TNF-mediated secretion of IL-6 from HeLa cells using an IL-6 sandwich ELISA (ImmunoTools, Friesoythe, Germany) according to the manufacturer’s protocol. 2.2.13 Preparation of peripheral blood mononuclear cells (PBMC) Buffy coat (leukapheresis) from a healthy human donor was diluted 1:4 in RPMI 1640, layered onto a LSM 1077 Ficoll/ Hypaque gradient (PAA, Cölbe, Germany), and centrifuged for 20 min at 670 x g (without deceleration) at room temperature. The PBMC fraction was aspirated and washed twice with medium, before resuspending in 10 % Me2SO, 90 % fetal bovine serum and storing at -80 °C. 49 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Methods 2.2.14 Isolation of human polymorphonuclear cells (PMN) and flow cytometry assay for oxidative burst using dihydrorhodamine (DHR) PMN were freshly prepared from 20 ml blood and purified using Polymorphprep™ (prod.no. 1114683, Axis-Shield, Oslo, Norway). Whole undiluted blood from a healthy human donor was layered onto 5 ml Polymorphprep (1:1 vol with blood) and centrifuged for 30 min at 450 – 500 x g at room temperature. After the separation both the top band containing only lymphocytes and monocytes and the bottom band containing all of the PMNs were aspirated, pooled and washed two times with medium. Marginal contamination of the PMN by erythrocytes was observed. Cell numbers were determined and cells were adjusted to 2 x 106 cells/ml. Cells (200 000) were directly incubated with TNF, ATROSAB or human control IgG at concentration of 1, 10, and 100 nM for 1 h. As positive control cells were incubated with phorbolester (PMA). Degranulation was determined by adding dihydrorhodamine (DHR) and subsequent FACS analysis gating the granulocyte population. 50 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3 Results 3.1 Hsp70-specific antibodies for cancer therapy 3.1.1 Chimerization of cmHsp70.1 (IgG tumex) As a first approach towards a humanized antibody, a mouse-human chimeric antibody was constructed (Zettlitz 2007). The sequences encoding the variable domains of monoclonal antibody cmHsp70.1 were obtained by PCR amplification from cDNA from hybridoma cells using degenerated primer annealing at the 5’ and 3’ region of the variable domains (Zettlitz et al. 2010). The VH and VL domains were assembled into the scFv format (scFv tumex) and produced in E. coli. Additionally, an IgG-like scFv-Fc fusion protein containing two binding sites per molecule and the human γ1 heavy chain Fc region including the hinge region and a C-terminal hexahistidyl-tag was generated and produced in HEK293 cells. A chimeric IgG1 tumex was generated by fusing the VH and VL domains of cmHsp70.1 to the constant regions of human γ1 heavy chain and the human Cλ domain, respectively (Zettlitz 2007). In this work both heavy chain and light chain genes were cloned into a bicistronic expression vector (pEE14.4, Lonza Biologics, Berkshire, UK) and transfected into CHO-K1 cells (Lonza Biologics, Berkshire, UK). Transfected cells were selected for their ability to grow in glutamine-free medium by gradual removal of glutamine in the presence of the glutamine-synthetase inhibitor L-methionine sulphoximine (MSX). Approximately 300 positive clones were screened by ELISA for expression of Hsp70-binding IgG and thereof 20 clones were expanded and screened by Western Blot for the amount of IgG produced. 9 - 12 mg chimeric IgG tumex per liter of cell culture supernatant of the best producers were purified by protein A chromatography. Purity and correct assembly of the IgG molecules was confirmed by SDS-PAGE and size exclusion chromatography (SEC) analysis. The SDS-PAGE analysis showed the characteristic heavy chain (calculated Mr: 48.9 kDa) and light chain (calculated Mr: 22.7 kDa) bands under reducing conditions (Figure 3-1a) and a single band corresponding to the assembled IgG (calculated Mr: 143.1 kDa without glycosylation) under nonreducing conditions. The apparent molecular mass (greater than 250 kDa) differed from the calculated, this may be due to N-glycosylation of the heavy chain and the branched structure of the IgG molecule. In immunoblot analysis the identity of purified IgG tumex was confirmed by detection with an anti-human IgG (whole molecule) antibody that recognized both heavy and light chain under reducing conditions and by an anti-human light chain (λ-specific) antibody that recognized the assembled IgG under non-reducing conditions (Figure 3-1b). Size exclusion chromatography showed 51 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results that IgG tumex eluted as a single peak again with a higher apparent molecular mass as calculated (greater than 200 kDa) (Figure 3-1c). The parental mouse IgG1 cmHsp70.1 in comparison showed a single peak at the same retention time corresponding to an apparent molecular mass of approximately 200 kDa. A shoulder at 67 kDa represents the contained albumin (HSA). Figure 3-1: Characterization of chimeric IgG tumex. a) SDS-PAGE (12%) analysis of purified IgG tumex (10 µg/lane) under reducing (1) and non-reducing (2) conditions (Coomassie staining). b) Immunoblot analysis of purified IgG tumex (1 µg/lane). SDS-PAGE under reducing (1) and non-reducing (2) conditions; the heavy and light chain were detected by HRPconjugated anti-human IgG (whole molecule) antibody (1) and by HRP-conjugated anti-humanLC (λ-spec.) antibody (2). c) SEC analysis of purified IgG tumex. d) SEC analysis of cmHsp70.1 (containing HSA). The purified IgG tumex recognized recombinant human Hsp70 (not shown) and recombinant substrate binding domain of human Hsp70 (rhHsp70-SBD) in ELISA with a similar sensitivity (EC50=1.721 nM) as the parental antibody cmHsp70.1 (EC50=1.703 nM) (Figure 3-2). The results for the chimeric IgG tumex confirmed that the correct mouse variable regions have been cloned and retained the antigen binding properties of the parental mouse monoclonal antibody cmHsp70.1. In addition the chimeric IgG is a valuable positive control for evaluating a prospective humanized antibody. Figure 3-2: Binding of IgG tumex and cmHsp70.1 to recombinant human Hsp70-SBD in ELISA. Binding to Hsp70-SBD coated plates was detected by HRP-conjugated antibodies (anti-human IgG 1/2000 and anti-mouse IgG 1/2000, respectively). 52 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 3.1.2 Results Humanization of cmHsp70.1 Humanization by CDR-grafting is now a well established technique to reduce the immunogenicity of xenogeneic (here mouse, commonly rodent) monoclonal antibodies and to improve their activation of the human immune system. In order to humanize an antibody with retained antigen specificity and binding affinity, the design of the humanized antibody is the critical step. 3.1.2.1 Analysis of mouse variable regions Web Antibody Modelling (WAM, http://antibody.bath.ac.uk/) and Dr. Andrew C.R. Martin's Group (http://www.bioinf.org.uk/) were used to number and analyse the variable regions derived from hybridoma cmHsp70.1 (Figure 3-3, Figure 3-4). Sequences were numbered using the Kabat numbering scheme. Framework regions (FR) and complementarity determining regions (CDR) were defined based on the contact definition, this definition is residues which take part in interactions with antigen and are part of the canonical sequence for loop structure (MacCallum et al. 1996), also covering the different definitions provided in the literature (Kabat, Cothia, AbM) (Martin 2001) (Figure 3-3). Canonical class alignment results of the CDRs are shown in Table 3-1. Table 3-1: Canonical class alignment results using auto-generated SDR templates. CDR class CDR class L1 7/14B H1 ? similar to class 1/10A, but: H20=F (allows: LIMV), H33=S (allows: YAWGTLV) L2 1/7A L3 ? H2 1/9A similar to class ?/9D, but: L96=L (allows: W) Some unusual sequence features were identified in the VH domain, namely H20 F (occurs in 0.251 % of heavy chains), H68 N (occurs in 0.451 % of heavy chains) which constitutes a potential Nglycosylation site and H101 H (occurs in 0.752 % of heavy chains). Also residues that are located at the VH/VL interface and in the Vernier zone underlying the CDRs were identified (Foote and Winter 1992) (Figure 3-3). 53 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results VH tumex FR1 CDR1 FR2 CDR2 1 2 3 4 5 6 1234567890123456789012345 6789012345 67890123456 7890123456789012345 EVKLQESGPGLVAPSQSLSFTCTVS GFSLSRNSVH WVRQPPGKGLE WLGMIWGGGSTDYNSALKS FR3 CDR3 FR4 7 8 9 10 11 67890123456789012abc345678901234 567890a12 34567890123 RLNISKDSSKSQVFLKMNSLQTDDTAMYFCAR NGGYDVFHY WGQGTTVTVSS VL tumex FR1 CDR1 FR2 CDR2 1 2 3 4 5 1234567891234567890123 4567abc890123456 789012345 67890123456 QAVVTQESALTTSPGETVTLTC RSSTGAVTTSNYANWV QEKPDHLFT GLIGGTNNRAP FR3 CDR3 FR4 6 7 8 9 10 78901234567890123456789012345678 901234567 890123456a7 GVPARFSGSLIGDKAALTITGAQTEDEAIYFC ALWYSNHLV FGGGTKLTVLG CDR-definition: Contact AbM Kabat Chothia Figure 3-3: Sequence analysis of mouse variable domains. Residues were numbered according to the Kabat numbering scheme. Unusual sequence features are indicated in red. Potential N-glycosylation site is depicted in a grey box. Vernier zone residues are indicated in green. Residues located at the VH/VL interface are underlined. CDR definitions according to the different definitions are marked by colored lines. 3.1.2.2 Design of reshaped human antibody A similarity search to human germline gene sequences was performed using V-BASE (http://vbase.mrc-cpe.cam.ac.uk/) and IgBlast (http://www.ncbi.nlm.nih.gov/igblast/) to select the human light and heavy chain variable regions to serve as template for CDR-grafting. For the VH the most homologous human germline genes were of distinct canonical classes, therefore an additional similarity search was performed for each FR separately. The selected human variable regions were analysed for percent similarity with the mouse variable regions, confirmation of the identical canonical CDR structures for the parental and humanized variable sequences (Martin and Thornton 1996) and the assigned humanness z-score (Figure 3-6: Z-score values of variable regions.) (Abhinandan and Martin 2007). 54 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results The most appropriate human sequences (the most similar variable region and the one with the highest z-score, humanness) were chosen for virtual CDR-grafting and superimposed modeling of the reshaped Fv’s (Figure 3-4). Human germline sequence VL 3-2 (IGLV7-43 IMGT, DPL18) and VH 3-66 (IGHV3-66 IMGT, DP-86) were chosen subjectively for retaining the loop structure of the grafted CDRs. A humanized version of murine cmHsp70.1 (designated humex, Figure 3-4, Figure 3-5) was generated by CDR grafting onto these human germline sequences. Figure 3-4: Superimposed model structure of Fv tumex (green) and Fv humex (blue) backbone. Side view of the two model structures. Cysteines are depicted as yellow spheres. The darker regions show the grafted CDR regions. The model was generated with Web Antibody Modeling (WAM, http://antibody.bath.ac.uk/) and visualized with PyMol (http://www.pymol.org). 55 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-5: Sequence alignment. Residues identical to the parental mouse sequences are shown as dots. Residues were numbered according to the Kabat numbering scheme. a) Alignment of the VH sequence isolated from cmHsp70.1 hybridoma (VH tumex) with the closest mouse germline gene (VHQ52.a19.61) as well as the human germline sequence (3-66) used as scaffold for humanization. The humanized VH sequence (VH humex) is also shown. b) Alignment of the VL sequence isolated from cmHsp70.1 hybridoma (VL tumex) with the closest mouse germline gene (VL1) as well as the human germline sequence (3-2) used as scaffold for humanization. The humanized VL sequence (VL humex) is also shown. The calculated z-scores for humanness (Abhinandan and Martin 2007) (Figure 3-6) were increased after humanization from -1.268 for VH tumex to 0.899 for VH humex (acceptor human germline sequence: 2.178) and from -3.471 for VL tumex to -2.142 for VL humex (acceptor human germline sequence: -2.077). a) b) Figure 3-6: Z-score values of variable regions. The Z-score of the query-sequence is indicated by a red line. The distribution of human germline sequences is shown in magenta, the distribution of mouse germline sequences is shown in blue. a) Comparison of IGHV of the original mouse VH tumex, the chosen human germline sequence VH3-66 and the reshaped humanized VH humex. b) Comparison of IGLV of the original mouse VL tumex, the chosen human germline sequence VL3-2 and the reshaped humanized VL humex. 3.1.2.3 ScFv humex Codon optimized VH and VL domains (GeneArt, Regensburg, Germany) were assembled into the scFv format (scFv humex) and produced in E. coli with yields of 1 ± 0.3 mg per liter culture, which is a 5fold improvement compared to scFv tumex (0.2 ± 0.1 mg per liter culture) see Table 3-2. Table 3-2: Production yields. protein cell system purification yield [mg/L supernatant] scFv tumex E. coli TG1 IMAC 0.1 – 0.4 scFv-Fc tumex HEK 293 IMAC 4.1 IgG1 tumex CHO-K1 Lonza GS system, (pEE12.4) protein A 0.7 CHO-K1 Lonza GS system, (pEE14.4) protein A 9 - 12 scFv humex E. coli TG1 IMAC 0.7 – 1.3 IgG1 humex CHO-K1 Lonza GS system, (pEE14.4) protein A > 20 56 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results SDS-PAGE analysis revealed a single band with an apparent molecular mass of about 28 kDa (calculated Mr 27.9 kDa) both under reducing and non-reducing conditions (Figure 3-7a). Immunoblot analysis confirmed the identity of scFv humex (Figure 3-7b). Size exclusion chromatography showed that scFv humex eluted as a single peak, corresponding to an apparent molecular mass of approximately 28 kDa (Figure 3-7c). The purified scFv humex recognized recombinant human Hsp70SBD in ELISA (Figure 3-7d) confirming that humanization was successful and antigen specificity was retained. Figure 3-7: Characterization of humanized scFv humex. a) SDS-PAGE analysis of purified scFv humex (2 µg/lane) under reducing (1) and non-reducing (2) conditions (Coomassie staining). b) Immunoblot analysis of purified scFv humex (1 µg/lane) under reducing (1) and non-reducing (2) conditions detected by HRP-conjugated anti-His antibody. c) Size exclusion chromatography of scFv humex. d) Binding of scFv humex to recombinant human Hsp70-SBD in ELISA. Binding was detected by HRP-conjugated anti-His antibody. Humanization also resulted in improved thermal stability, which was determined by measuring the dynamic light scattering intensity (kcps) while the temperature was increased in 1 °C intervals (ZetaSizer Nano ZS, Malvern Instruments, Herrenberg, Germany) (Seitter 2010; Zettlitz et al. 2010). As the protein aggregated the light scattering intensity increased dramatically and this temperature was defined as melting point. The melting point for scFv tumex was determined to be approximately 47 °C while an increased melting point of approximately 58 °C was measured for scFv humex (Figure 3-8). Figure 3-8: Analysis of the melting point of scFv tumex and scFv humex by dynamic light scattering. Dynamic light scattering intensity (kcps) was measured while temperature was increased in 1 °C intervals. 57 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.1.2.4 IgG humex The humanized VH and VL encoding regions were used to generate a humanized IgG1 (IgG humex) in the same way as described for chimeric IgG tumex, but using a modified Igκ-leader allowing correct N-terminal processing. Stable transfected CHO-K1 cells were screened by ELISA for expression of functional (Hsp70-binding) IgG and thereof 10 cell lines were expanded and screened by Western Blot for the amount of IgG produced. More than 23 mg humanized IgG humex per liter of cell culture supernatant were purified by protein A chromatography (Table 3-2). Purity and correct assembly of IgG humex was confirmed by SDS-PAGE analysis and by size exclusion chromatography. SDS-PAGE analysis showed under reducing conditions two bands with an apparent molecular mass of 53 kDa and 25 kDa, corresponding to the heavy and light chain of IgG humex (calculated molecular masses: 48.8 kDa and 22.6 kDa, respectively). Under non-reducing conditions a single band migrating with an apparent molecular mass of more than 250 kDa was visible, corresponding to the assembled IgG (calculated Mr: 142.8 kDa without glycosylation) (Figure 3-9a). The difference between calculated and apparent molecular mass may be caused by N-glycosylation of the heavy chain and the branched structure of IgG humex. In immunoblot analysis the identity of purified IgG humex was confirmed by detection with an anti-human light chain (λ-specific) antibody that recognized the lambda light chain under reducing conditions and by an anti-human IgG (Fc-specific) antibody that recognized the heavy chain under reducing conditions and the assembled IgG under non-reducing conditions (Figure 3-9b). Size exclusion chromatography showed that IgG humex eluted as a single peak of more than 200 kDa, again with a higher apparent weight as calculated (Figure 3-9c). In ELISA the purified IgG humex recognized rhHsp70 (not shown) and rhHsp70-SBD in a dose-dependent manner (Figure 3-9d). Figure 3-9: Characterization of humanized IgG humex. a) SDS-PAGE analysis of purified IgG humex (3 µg/lane) under reducing (1) and non-reducing (2) conditions (Coomassie staining). b) Immunoblot analysis of purified IgG humex (0.5 µg/lane) under reducing (1,2) and non-reducing conditions (3), detected by HRP-conjugated anti-human LC (λ-spec.) antibody (1) and anti-human IgG (Fc-spec.) antibody (2,3), respectively. c) Size exclusion chromatography of purified IgG humex. d) Binding of IgG humex to rhHsp70-SBD in ELISA. Bound antibody was detected by HRP-conjugated anti-human IgG (whole molecule) antibody. 58 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 3.1.3 Results Antibody glycosylation Incubation of purified IgG tumex and IgG humex (15 µg each) with PNGase F confirmed Nglycosylation of the heavy chain of both antibodies. Before treatment, the heavy chain of IgG tumex migrated with an apparent molecular mass of approximately 56 kDa, which was reduced to 52 kDa after PNGase treatment. The heavy chain of IgG humex migrated with an apparent molecular mass of approximately 53 kDa before treatment and was reduced to 51 kDa after PNGase treatment (Figure 3-10). The increased reduction of the molecular mass by 2 kDa of IgG tumex heavy chain after deglycosylation as compared to the IgG humex heavy chain indicates that the additional sequon in the variable heavy chain domain of IgG tumex is indeed N-glycosylated. The light chain was not affected by the treatment with PNGase F (28 kDa for IgG tumex and 26 kDa for IgG humex). The differences in the molecular mass between the chimeric and the humanized antibody were caused by different N-terminal processing due to the used Igκ-leader sequences. Figure 3-10: Antibody glycosylation. IgG tumex (1,2) and IgG humex (3,4) were incubated with PNGase F (2,4) and subsequently analyzed by SDS-PAGE analysis under reducing conditions (Coomassie staining). An increased mobility of the treated samples indicates that both antibodies are N-glycosylated. 3.1.4 Affinity measurement The affinities of cmHsp70.1, IgG tumex, IgG humex and scFv humex were determined by quartz crystal microbalance (QCM) measurements using an Attana A100® C-Fast system. The interaction of antigen and antibody was examined in two settings with the antigen (rhHsp70-SBD) immobilized or the antibody captured on the sensor chip, respectively. These two settings allow estimation of avidity effects which would affect the measured apparent affinity. The affinities of mouse cmHsp70.1, chimeric IgG tumex, humanized IgG humex and scFv humex for immobilized rhHsp70-SBD were determined to be 2.8 nM, 1 nM, 1.5 nM, and 6 nM, respectively (Table 3-3, Figure 3-11 1a-d). In the second set of experiments using captured antibodies and soluble rhHsp70-SBD all IgG’s showed similar kinetics with affinities of 6 nM, 3.3 nM and 4.2 nM for cmHsp70.1, IgG tumex and IgG humex, respectively (Table 3-3, Figure 3-11 2a-c). In both settings, all three antibodies showed similar 59 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results kinetics with affinities to Hsp70-SBD in the low nanomolar range, thus confirming that humanization had not affected affinity. Table 3-3: Summary of kinetic data from QCM measurements of Hsp70-specific antibodies. construct method kon (M-1s-1) cm Hsp70.1 immobilized Ag 2.5 x 10 ± 4.2 x 10 captured Ab IgG tumex IgG humex scFv humex immobilized Ag koff (s-1) 5 4 5 3 5 4 5 2 5.2 x 10 ± 3.4 x 10 5 3 3.3 x 10 ± 6.1 x 10 5 2 4.7 x 10 ± 3.9 x 10 5 3 8.2 x 10 ± 4.7 x 10 2.5 x 10 ± 6.1 x 10 3.6 x 10 ± 3.5 x 10 captured Ab 1.6 x 10 ± 5.2 x 10 immobilized Ag 2.1 x 10 ± 8.4 x 10 captured Ab 4.3 x 10 ± 4.9 x 10 immobilized Ag 1.4 x 10 ± 6.7 x 10 KD (nM) Rmax (Hz) -4 -5 2.8 10 -3 -5 6.0 168 -4 -5 1.0 23 -4 -6 3.3 105 -4 -6 1.5 37 -4 -6 4.2 181 -4 -6 6.0 40 6.9 x 10 ± 6.3 x 10 1.5 x 10 ± 1.2 x 10 3.5 x 10 ± 1.5 x 10 Figure 3-11: Affinity determination of Hsp70-specific antibodies by quartz crystal microbalance (QCM) measurements. 1) Binding of bivalent (a-c) and monovalent (d) Hsp70-specific antibodies to immobilized rhHsp70-SBD. 2) Binding of soluble rhHsp70-SBD to captured mouse (a) and human (b,c) IgG. 3.1.5 Epitope mapping of Hsp70-specific antibodies Competition ELISA with parental mouse antibody cmHsp70.1 was performed to confirm that the recombinant antibodies retained original epitope specificity. Binding of cmHsp70.1 to immobilized antigen (rhHsp70-SBD) was inhibited by increasing concentrations of IgG tumex or IgG humex in a dose-dependent manner. No inhibition was observed with an irrelevant chimeric IgG (IgG CEA, (Zettlitz 2007; Stork et al. 2008)). This result indicated that both recombinant antibodies bind the same epitope as the parental antibody (Figure 3-12a). Binding of both the chimeric IgG tumex and the humanized IgG humex to heat shock-induced Hsp70 of human and murine cell lines was shown in immunoblotting experiments (Figure 3-12b). 60 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-12: Antigen binding. a) Competition ELISA. cmHsp70.1 (constant 10 nM) was incubated with increasing amounts of IgG tumex, IgG humex and IgG CEA, respectively. Remaining antigen binding activity of cmHsp70.1 was determined by ELISA with immobilized antigen (rhHsp70-SBD). b) Immunoblot experiments for binding of cmHsp70.1, IgG tumex and IgG + humex to heat shock-induced extracts of human Colo and murine B16 cells, respectively. Purified recombinant human Hsp70 (rhHsp70) was included as positive control. In both experiments (a,b) bound antibodies were detected by HRPconjugated anti-human IgG and anti-mouse IgG antibodies, respectively. To further analyze the epitope specificity of the Hsp70-specific antibodies, binding and blocking experiments using synthetic TKD-peptide containing the proposed epitope (aa450-463) (Multhoff 2007) were performed. Synthetic TKD-peptide in 105-fold molar excess was not able to block binding of cmHsp70.1 (Figure 3-13a) or IgG tumex (Figure 3-13b) to immobilized Hsp70 in ELISA. In this assay soluble Hsp70 in 830-fold molar excess completely blocked binding of both antibodies. Binding of the recombinant antibodies was also investigated using a TKD-fusion protein comprised of HSA with two TKD-peptides fused N- and C-terminal, in immunoblot experiments no binding of cmHsp70.1 or scFvFc tumex could be observed (Figure 3-13c). Figure 3-13: Blocking and binding experiments with synthetic TKD-peptide. Blocking of cmHsp70.1 (a) and IgG tumex (b) binding to coated Hsp70 (100 ng/well) by soluble TKD-peptide (100.000-fold molar excess) and Hsp70 (830-fold molar excess). c) Immunoblot analysis of binding of cmHsp70.1 and scFv-Fc tumex to recombinant Hsp70 (1) and TKD-HSA-TKD (2). Synthetic peptides containing the epitope sequence and adjacent amino acids were used to repeat binding and blocking experiments by ELISA and Immunoblot analysis. None of the synthetic peptides used in this experiments (Figure 3-14a) showed binding of Hsp70-specific antibodies in Immunoblot (Figure 3-14b) or ELISA experiments or was able to block binding of these antibodies to Hsp70. 61 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-14: a) Synthetic peptides comprising the proposed epitope sequence and adjacent amino acids. b) Dot blot analysis of binding of Hsp70-specific antibodies (cmHsp70.1 and IgG tumex) to synthetic peptides blotted in indicated concentrations onto a nitrocellulose-membrane. Bound antibody was detected by HRP-conjugated anti-mouse IgG or anti-human IgG antibodies, respectively. Coupling of the synthetic peptides to a carrier protein (BSA) was achieved by using glutaraldehyde (Figure 3-15a), and was thought to support immobilization of the small peptides. Nevertheless, binding to these BSA-coupled peptides did not occur neither in dot blot (Figure 3-15b) nor in ELISA experiments (Figure 3-15c). Figure 3-15: BSA-coupled peptides. a) Successful coupling of synthetic peptides to BSA. BSA-NGL-14 (2), BSA-NLL-17 (3) and BSA-RFE-13 (4) analysed by SDS-PAGE under reducing conditions (3 µg/lane, Coomassie-staining). Uncoupled BSA was included as control (1). b) Dot blot analysis of binding of cmHsp70.1 (1) and IgG tumex (2) to blotted BSA-coupled peptides (10 µg/dot). Hsp70 (0.1 µg/dot) and BSA (10 µg/dot) were included as control. c) Binding of cmHsp70.1 and IgG tumex to peptides and BSA-coupled peptides in ELISA. Hsp70 was included as control. Bound antibody was detected by HRP-conjugated anti-mouse IgG or anti-human IgG antibodies. These findings indicate that the proposed epitope region (aa 454-461, NLLGRFEL) (Botzler et al. 1998) is not sufficient for antibody binding. In order to localize the entire epitope, overlapping Hsp70fragments were cloned and produced in E. coli. Fragments smaller than 100 amino acids were fused to human serum albumin domain 3 (AlF3: HSA aa 382-582) to facilitate purification and SDS-PAGE analysis. Binding of Hsp70-specific antibodies to the various fragments was analyzed by immunoblot experiments. In these experiments all three antibodies (mouse cmHsp70.1, chimeric IgG tumex, and humanized IgG humex) showed an identical binding pattern. The minimal region showing antibody binding in this assay was located within aa 473 - 504 of the C-terminal substrate binding domain (Figure 3-16). N- or C-terminal deletion of this region resulted in complete loss of binding (Figure 3-16, fragment 8, 16), indicating that the entire region of 32 amino acids was required. 62 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-16: Epitope mapping. In the scheme of Hsp70-fragments antibody binding is indicated by green bars, Hsp70fragments that did not bind are depicted in red. The table shows position, length and immunoblot result of all used Hsp70-fragments. A structural model of the Hsp70-SBD (substrate binding domain, aa 383 - 548) displays the respective amino acids in three beta strands close to each other (Figure 3-17b). This region is located adjacent to a beta strand containing the TKD sequence. Sequence analysis of the identified sequence revealed 100 % identity to mouse Hsp70 (HS71B_mouse), while three substitutions are located in human Hsc70 (HSP7C_human) (Figure 3-17c). a) b) c) Figure 3-17: Epitope mapping. a) Immunoblot experiment with fragment 18 (KITI, aa 473-504) fused to domain III of HSA incubated with Hsp70-specific antibodies; HRP-conjugated anti-His-tag antibody as control. Recombinant scDb-AlF3 was included as negative control. b) Structure of Hsp70-SBD showing the position of aa 473-504 and the adjacent TKD sequence (light pink). Structures were visualized with PyMol (http://www.pymol.org). c) Sequence of human Hsp70 (aa 450-504) showing the identified epitope (underlined) of the Hsp70-specific antibodies. The previously proposed epitope is depicted in light pink. Alignment of aa 473-504 of human Hsp70, human Hsc70 and mouse Hsp70. 63 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.2 Antagonistic TNFR1-specific antibodies for therapy of inflammatory diseases 3.2.1 Antibody constructs derived from humanized H398 (IZI-06.1) The hybridoma producing monoclonal mouse antibody H398 (subtype IgG2a) was generated by immunization of mice with purified TNF-receptor 1 (Thoma et al. 1990). This antagonistic antibody is specific for human TNFR1 and neutralized a wide spectrum of TNF activities in vitro by competitive inhibition of TNF binding to TNFR1. H398 shows no crossreactivity with TNF receptors from most other species, therefore standard small animal models cannot be used for in vivo evaluation. As well, it would be difficult to evaluate the therapeutic efficacy of H398 in clinical trials, because of the mouse origin of the antibody, holding the risk of acute adverse effects and development of human anti-mouse antibodies (HAMA) upon repeated treatment cycles. To overcome these limitations a humanized version of H398, designated IZI-06.1, was generated by grafting all six complementaritydetermining regions (CDRs) onto human variable germline genes similar to H398 VH and VL sequences (Kontermann et al. 2008). A bacterially produced Fab fragment of IZI-06.1 showed equal blocking activity as the respective mouse Fab fragment. Thus, this humanized TNFR1-specific antibody holds great promise for development of a therapeutic. A clinically applicable therapeutic requires an appropriate format which shows good binding, pharmacokinetics and production. Based on IZI-06.1, the humanized version of mouse mAb H398, different antibody constructs were generated. 3.2.1.1 IZI-06.1 scFv The variable domains of IZI-06.1 were combined into the scFv format using vector pHENIS and subcloned into vector pAB1 for production in E. coli TG1. Purified IZI-06.1 scFv was characterized by SDS-PAGE analysis and size exclusion chromatography. A single band of approximately 29 kDa was visible under both reducing and non-reducing conditions in SDS-PAGE analysis (calculated Mr: 29.4 kDa). In size exclusion chromatography IZI-06.1 scFv eluted as three distinct peaks one of which corresponding to the monomer while the others indicated formation of dimers and trimers. 64 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-18: Characterization of IZI-06.1 scFv. a) SDS-PAGE analysis of purified IZI-06.1 scFv (2 µg/lane) under reducing (lane 1) and non-reducing conditions (lane 2), (Coomassie staining). b) Size exclusion chromatography of purified IZI-06.1 scFv (position of standard proteins is indicated). 3.2.1.2 IZI-06.1 Fab-HSA In this construct, the Fd-fragment (VH-CH1 IZI-06.1) is fused to human serum albumin by a short glycine-serine linker (GGGS). Using a bicistronic expression vector with the light chain (IZI-06.1 LC) cloned upstream of the Fd-HSA, the Fab-HSA fusion protein was produced in CHO cells and purified by Celonic. Purity and integrity were examined by SDS-PAGE analysis and size exclusion chromatography (Figure 3-19). SDS-PAGE analysis under reducing conditions showed two bands migrating with an apparent molecular mass of approximately 25 kDa and 90 kDa corresponding to IZI-06.1 LC (calculated Mr: 23.9 kDa) and Fd-HSA (calculated Mr: 89.9 kDa), respectively (Figure 3-19a, lane 3). Under non-reducing conditions the fully assembled IZI-06.1 Fab-HSA migrated as a band of approximately 115 kDa (Figure 3-19a, lane 4). For comparison IZI-06.1 Fab and HSA were included. Also some minor bands were visible, probably corresponding to impurities and degradation products. In size exclusion chromatography (SEC) correct assembly of IZI-06.1 Fab-HSA was confirmed, additionally a substantial amount of aggregates or impurities were observed (Figure 3-19b). Figure 3-19: Characterization of IZI-06.1 Fab-HSA. a) SDS-PAGE analysis of purified proteins (2 µg/lane, Coomassie staining) under reducing (1,2,3) and non-reducing (4,5,6) conditions. IZI-06.1 Fab-HSA (3,4); HSA (2,5) and IZI-06.1 Fab (1,6) were included for comparison. b) Size exclusion chromatography of purified IZI-06.1 Fab-HSA (position of standard proteins is indicated). 65 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.2.1.3 IZI-06.1 scFv-HSA The IZI-06.1 scFv was fused C-terminal to HSA by a short glycine-serine linker (GGGS). This singlechain peptide was produced in CHO cells and purified by Celonic. Purity and integrity were analyzed by SDS-PAGE analysis and size exclusion chromatography (Figure 3-20a,b). Beside the monomeric IZI-06.1 scFv-HSA of about 95 kDa, degraded as well as aggregated protein was visible in both experiments although to a lesser extent than for the Fab-HSA. Figure 3-20: Characterization of IZI-06.1 scFv-HSA. a) SDS-PAGE analysis of purified proteins (6 µg/lane, Coomassie staining) under reducing (1,2,3) and non-reducing (4,5,6) conditions. IZI-06.1 scFv-HSA (3,4); HSA (2,5) and IZI-06.1 scFv (1,6) were included for comparison. b) Size exclusion chromatography of purified IZI-06.1 scFv-HSA (position of standard proteins is indicated). 3.2.1.4 IZI-06.1 IgG (ATROSAB) The humanized anti-human TNFR1 antibody IZI-06.1 (Kontermann et al. 2008) was converted into a human IgG1 using a heavy chain with abolished effector functions (IgGe3-Fc2, InvivoGen). The used IgG1 is of the G1m1,17 allotype (IGHG1 allele name *01) and has substitutions of IgG2 residues at positions 233 – 236 and IgG4 residues at positions 327, 330 and 331 (Figure 3-22). Figure 3-21: Characterization of ATROSAB. a) SDS-PAGE analysis of purified ATROSAB (4 µg/lane, BioRad ready gel TrisHCl gel, 4-15% linear gradient, Coomassie staining) under non-reducing (1) and reducing conditions (2). b) Size exclusion chromatography of purified ATROSAB (the position of standard proteins is indicated). 66 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results This antibody (named ATROSAB) was produced in CHO cells and purified by protein A chromatography (Celonic). Purity and integrity were confirmed by SDS-PAGE and size exclusion chromatography. In SDS-PAGE analysis (4 - 15 % linear gradient) under non-reducing conditions a band of approximately 160 kDa was visible corresponding to the fully assembled IgG ATROSAB. Under reducing conditions two bands corresponding to the heavy (calculated Mr: 53 kDa) and light chain (calculated Mr: 25 kDa) were observed (Figure 3-21a). In size exclusion chromatography, purified ATROSAB eluted as a single peak with an apparent molecular mass of approximately 160 kDa (Figure 3-21b). a) VL: 1 2 3 4 5 12345678901234567890123 4567abcde8901234 567890123456789 0123456 DIVMTQSPLSLPVTPGEPASISC RSSQSLLHSNGNTYLH WYLQKPGQSPQLLIY TVSNRFS 6 7 8 9 10 78901234567890123456789012345678 901234567 8901234567 GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC SQSTHVPYT FGGGTKVEIK CK: 110 120 130 140 150 160 170 180 190 . . . . . . . . . RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV 200 210 . . YACEVTHQGLSSPVTKSFNRGEC b) VH: 1 2 3 4 5 6 123456789012345678901234567890 12345 67890123456789 012a3456789012345 QVQLVQSGAEVKKPGSSVKVSCKASGYTFT DFYIN WVRQVPGQGLEWIG EIYPYSGHAYYNEKFKA 7 8 9 10 11 67890123456789012abc345678901234 56781234567890123 RVTITADKSTSTAYMELSSLRSEDTAVYYCAR WDFLDYWGQGTTVTVSS CH1: 120 130 140 150 160 170 180 190 . . . . . . . . ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN 200 210 . . VNHKPSNTKVDKKVEPKSC Hinge: 230 . DKTHTCPPCPAPPVAG CH2: 240 250 260 270 280 290 300 310 320 . . . . . . . . . PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC 330 340 . . KVSNKGLPSSIEKTISKAK CH3: 350 360 370 380 390 400 410 420 . . . . . . . . GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS 430 440 . . CSVMHEALHNHYTQKSLSLSPGK 67 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-22: Sequence of humanized IgG ATROSAB. Residues are numbered according to the Kabat numbering scheme. a) Light chain of ATROSAB. b) Heavy chain of ATROSAB. The substituted residues of IgG2 and IgG4 are underlined. Lys214 determines the G1m17 allotype, whereas Asp356 and Leu358 determine the G1m1 allotype. 3.2.2 TNFR1-Fc fusion proteins Fusion proteins composed of the extracellular domains of human TNFR1 (aa 29-211), rhesus TNFR1 (aa 27-209), and mouse TNFR1 (aa 30-212) fused to the hinge and Fc-region of human γ1 heavy chain were produced in HEK293 cells and purified by protein A chromatography. Purified proteins were analyzed by SDS-PAGE analysis and showed a single band with under reducing conditions corresponding to the monomer (calculated Mr: 47 kDa without glycosylation). Under non-reducing conditions the dimer is represented by a single band migrating with an apparent molecular weight higher than 130 kDa (calculated Mr: 95 kDa without glycosylation) (Figure 3-23a). In size exclusion chromatography human TNFR1-Fc eluted as a single peak (Figure 3-23b). Figure 3-23: Characterization of TNFR1-Fc fusion proteins. a) SDS-PAGE analysis of purified human TNFR1-Fc (1,4), mouse TNFR1-Fc (2,5) and rhesus TNFR1-Fc (3,6) (4 µg/lane, BioRad ready gel Tris-HCl gel, 4-15% linear gradient, Coomassie staining) under reducing (1-3) and non-reducing (4-6) conditions. b) Size exclusion chromatography of purified human TNFR1-Fc (the position of standard proteins is indicated). 3.2.3 Antigen specificity (species- and receptor-specificity) Antigen binding of all IZI-06.1 constructs was confirmed by ELISA using human TNFR1-Fc coated plates and HRP-conjugated secondary antibodies. IZI-06.1 scFv showed the strongest binding of the monovalent constructs with an EC50 value of 2.6 nM. IZI-06.1 scFv-HSA and Fab-HSA bound slightly weaker with EC50 values of 3.5 nM and 7.2 nM, respectively (Figure 3-24a). The bivalent IgG1 ATROSAB exhibited the strongest binding to recombinant human TNFR1-Fc (EC50 value: 0.22 nM), similar to the binding of the parental antibody H398 (EC50 value: 0.1 nM) (Figure 3-24b). These results confirmed that humanization and conversion into the different antibody formats did not affect antigen binding. 68 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-24: ELISA of IZI-06.1 constructs for binding to human TNFR1-Fc. a) ELISA of monovalent IZI-06.1 constructs. Binding of scFv was detected by HRP-conjugated anti-His antibody and binding of HSA-fusion proteins was detected by rabbit anti-HSA antibody and HRP-conjugated anti-rabbit antibody (n=3). b) ELISA of bivalent IgG ATROSAB and H398. Binding of ATROSAB was detected by HRP-conjugated anti-huIgG (Fab-specific) antibody and binding of H398 was detected by HRP-conjugated anti-mouse IgG antibody (n=3). Data were normalized to Y=0 becomes 0 % for all data set and the largest value in each data set becomes 100 %. Data were fitted to the approximate equation of one site – specific binding Y = Bmax * X/(EC50 + X), where Bmax is the extrapolated maximum specific binding and EC50 is the concentration needed to achieve half-maximum binding at equilibrium. The ability of ATROSAB and H398 to bind to antigen expressing cells and their selectivity for TNFR1 was confirmed by flow cytometric analysis using mouse embryonic fibroblasts (MEF) transfected with fusion proteins comprised of the extracellular domain of TNFR1 and TNFR2, respectively, fused to the intracellular domain of human Fas (MEF-TNFR1-Fas, MEF-TNFR2-Fas) (Krippner-Heidenreich et al. 2002). For both antibodies, binding was only seen with MEF-TNFR1-Fas cells but not with MEFTNFR2-Fas cells (Figure 3-25). Additionally, binding of TNFR1-specific antibodies to huTNFR1 was confirmed by using Kym-1 cells (human rhabdomyosarcoma, expressing about 3000 TNFR1 molecules per cell) in flow cytometry analysis. Figure 3-25: Flow cytometry analysis of binding of ATROSAB and H398 to mouse embryonic fibroblasts (MEF) transfected with human TNFR1-Fas or human TNFR2-Fas and to Kym-1 cells expressing human TNFR1. Cells alone are depicted in grey; cells incubated with indicated antibodies are depicted as black line. 69 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Titration of antibody concentration showed that binding of ATROSAB to MEF-TNFR1-Fas cells was comparable to that of H398 with EC50 values of approximately 0.09 nM for ATROSAB and 0.2 nM for H398 (Figure 3-27). Figure 3-26: Flow cytometry analysis of binding of ATROSAB and H398 to MEF-TNFR1-Fas cells. Titration of antibody concentration (n=3), data were normalized to cells alone becomes 0 % and the largest value in each data set becomes 100 %. Data were fitted to the approximate equation MFI = MFI max * [IgG]/(EC50+[IgG]) using GraphPad Prism Software, where MFI is the mean fluorescent intensity and MFImax is the fitted plateau value at high concentrations of IgG. Species specificity was investigated by using recombinant TNFR1-Fc fusion proteins in ELISA experiments. In this assay, binding of ATROSAB and H398 was seen for human and rhesus TNFR1-Fc, but not for mouse TNFR1-Fc (Figure 3-27). Figure 3-27: ELISA of binding of ATROSAB and H398 to purified human, rhesus and mouse TNFR1-Fc. Binding of an antihuman IgG (Fc-specific) antibody (a-huFc) was included as coating control. 3.2.4 Thermal stability Thermal stability of purified ATROSAB was determined by dynamic light scattering (DLC) using 1 °C intervals and 1 min for equilibration. ATROSAB showed a two-phase thermal denaturation with a first transition around 50 °C and a second (major) transition at 81 °C. This indicates that ATROSAB is stable up to a temperature of 46 °C (Figure 3-28a). Analysis of the IZI-06.1 scFv fragment under the same conditions revealed a first gradual denaturation up to 60 °C followed by complete denaturation at around 60 °C (Figure 3-28b). 70 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-28: Analysis of the melting point of ATROSAB (a) and IZI-06.1 scFv (b) by dynamic light scattering. Dynamic light scattering intensity (kcps) was measured while temperature was increased in 1 °C intervals. 3.2.5 Affinity measurements 3.2.5.1 IZI-06.1 monovalent antibody constructs The affinities of IZI-06.1 scFv and IZI-06.1 scFv-HSA for human TNFR1 were determined by quartz crystal microbalance measurements (QCM, Attana A100 C-Fast system) using immobilized TNFR1-Fc (Figure 3-29). For the IZI-06.1 scFv an affinity of 2.2 nM was determined (Table 3-4). The scFv-HSA fusion protein exhibited a 10-fold reduced affinity as compared to the scFv molecule indicating some sterical hindrance of binding through the HSA fusion partner. Figure 3-29: Determination of affinities of IZI-06.1 scFv (a) and IZI-06.1 scFv-HSA (b) to human TNFR1-Fc by quartz crystal microbalance measurements. Table 3-4: Summary of binding kinetics of IZI-06.1 scFv and scFv-HSA on immobilized huTNFR1-Fc. construct IZI-06.1 scFv IZI-06.1 scFv-HSA kon (M-1s-1) 3.541 x 10 5 8.284 x 10 4 koff (s-1) KD (nM) B (Hz) res Ssq -4 2.236 7.212 0.3066 -3 17.4 23.81 0.4460 7.584 x 10 1.443 x 10 71 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.2.5.2 ATROSAB, H398 Competition experiments for binding of H398 and ATROSAB to human and rhesus TNFR1-Fc showed that the two antibodies compete for the same epitope on the respective receptor (Figure 3-30). These experiments also indicated that, on a molar basis, 5 to 10-fold more ATROSAB was required to compete binding of H398 to human TNFR1-Fc and 4 to 5-fold more for rhesus TNFR1-Fc. The other way around only 0.5 – 1.8-fold molar excess of H398 is required to compete binding of ATROSAB to human TNFR1-Fc (0.2 to 1-fold for rhesus TNFR1-Fc). Figure 3-30: Competition experiment. Either human TNFR1-Fc (a,b) or rhesus TNFR1-Fc (c,d) was coated (100 ng/well) and incubated with a constant concentration of either H398 (2 nM; a,c) or ATROSAB (10 nM; b,d). Binding was competed by increasing concentrations of ATROSAB (a,c) or H398 (b,d). (n=2, shown is experiment 2) The affinity of ATROSAB for TNFR1 was determined by quartz crystal microbalance measurements (QCM, Attana A100 C-Fast system) using immobilized TNFR1-Fc. ATROSAB bound with subnanomolar affinity to human and rhesus TNFR1-Fc, similar to the affinity of H398 for human and rhesus TNFR1-Fc (Table 3-5, Figure 3-31). 72 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Table 3-5: Summary of binding kinetics of ATROSAB and H398. construct antigen kon (M-1s-1) ATROSAB huTNFR1-Fc 3.8 x 10 ATROSAB rheTNFR1-Fc 6.9 x 10 H398 huTNFR1-Fc 3.1 x 10 H398 rheTNFR1-Fc 2.1 x 10 koff (s-1) KD (nM) B (Hz) res Ssq 5 1.3 x 10 -4 0.35 46.6 0.6449 5 6.7 x 10 -5 0.10 34.9 0.3397 5 7.0 x 10 -5 0.23 45.4 0.4229 5 1.0 x 10 -4 0.49 30.4 0.3738 Figure 3-31: Determination of affinity of H398 and ATROSAB for binding to human and rhesus TNFR1-Fc by quartz crystal microbalance. a) Binding of ATROSAB to human TNFR1-Fc. b) Binding of ATROSAB to rhesus TNFR1-Fc. c) Binding of H398 to human TNFR1-Fc. d) Binding of H398 to rhesus TNFR1-Fc. 3.2.6 Pharmacokinetics Pharmacokinetics was determined after a single dose (25 µg) i.v. injection into CD1 mice. Both antibodies showed biphasic elimination from circulation (Figure 3-32). Serum half-life was determined to be 10.5 ± 2.8 days for ATROSAB and 8.1 ± 1.5 days for H398 (calculated for the 4 terminal time points). 73 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-32: Pharmacokinetics of ATROSAB and H398. Serum clearance of ATROSAB (a) and H398 (b) after a single i.v. injection of 25 µg purified IgG into the tail vein of CD1 mice (n=3). Serum concentrations of the antibodies were determined at different time points by ELISA. 3.2.7 Antagonistic activity of TNFR1-specific antibodies TNF incubation on Kym-1 cells (expressing approximately 3000 TNFR1, 30000 TNFR2, type I cell) induced cell death (apoptosis) in approximately 80 - 90 % of cells at concentration above 1 ng/ml (Figure 3-33a, Figure 3-34a). The antagonistic effects of IZI-06.1 Fab-HSA and scFv-HSA were analyzed for TNF-mediated cytotoxicity on Kym-1 cells (Figure 3-33). An IC50 value of 60 nM was measured for scFv-HSA. Fab-HSA did not reach 50 % inhibition, thus no IC50 value could be determined. Figure 3-33: Inhibition of TNF-mediated cytotoxicity on Kym-1 cells. a) Killing of Kym-1 cells upon TNF stimulation. b) Inhibition of TNF-mediated cytotoxicity (1.25 ng/ml TNF) on Kym-1 cells by IZI-06.1 scFv-HSA and IZI-06.1 Fab-HSA. Cells were analyzed after 6 h by crystal violet staining (n=3, for Fab-HSA n=2). Maximum (20 % viability of control) and half maximum (60 % viability of control) are depicted in dotted lines. Furthermore, the antagonistic effects of IZI-06.1 Fab-HSA and scFv-HSA were analyzed for TNFmediated IL-8 release from HT1080 cells. However, no accurate IC50 values could be determined from these assays, although scFv-HSA showed blocking activity (not shown). 74 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results TNF-induced killing of Kym-1 cells was inhibited in a dose-dependent manner by ATROSAB and H398. In this assay, a TNF concentration was used resulting in 90 % cell killing (1.25 ng/ml) (Figure 3-34a). Half-maximal killing, i.e. 55 % viable cells, was observed at about 60 nM for ATROSAB and 5-10 nM for H398, respectively (Figure 3-34b). Figure 3-34: Inhibition of TNF-mediated cytotoxicity on Kym-1 cells. a) Killing of Kym-1 cells upon TNF stimulation. b) Inhibition of TNF-mediated cytotoxicity (1.25 ng/ml TNF) on Kym-1 cells by ATROSAB and H398. Cells were analyzed after 6 h by crystal violet staining (n=3). Maximum (10 % viability of control) and half maximum (55 % viability of control) are depicted in dotted lines. The effects of ATROSAB and H398 on TNF-induced secretion of IL-6 from HeLa and IL-8 from HT1080 cells, respectively, were investigated by determining cytokine content of cell culture supernatants by sandwich ELISA. TNF stimulation (4 nM TNF, 200 ng/ml) for 18 h induced a strong increase in IL-6 secretion from HeLa cells in a dose-dependent manner and reached approximately 700 pg/ml (Figure 3-35a). Similarly, TNF induced secretion of IL-8 from HT1080 cells reached approximately 7000 pg/ml after incubation with 4 nM TNF for 18 h (Figure 3-35b). To examine potential agonistic activity of the bivalent antibodies ATROSAB and H398 as well as control IgG (human IgG, Sigma), they were incubated with HeLa or HT1080 cells in the absence of TNF for 18 h. This resulted only in a marginal induction of cytokine release, peaking at a concentration around 10 nM. Thus, IL-6 levels increased from 15 pg/ml of untreated cells to 40 to 60 pg/ml, which is an increase of 3 – 6 % compared to the values reached after treatment with a comparable TNF concentration (4 nM). Similarly, IL-8 levels increased from 80 pg/ml endogenous production to approximately 200 pg/ml after incubation with the antibodies, corresponding to approximately 2 % of the value reached after treatment with a comparable TNF concentration. The negative control (human IgG) had no effect on cytokine release. Also a Fab fragment derived from ATROSAB by papain digestion did not induce any detectable increase of cytokine release (not shown). ATROSAB and H398 inhibited release of IL-6 from HeLa cells and IL-8 from HT1080 cells induced by 20 pM TNF (1 ng/ml) in a dose-dependent manner. In these assays, the IC50 values were 60 nM for ATROSAB and 6 nM for H398 for inhibition of IL-6 release 75 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results (Figure 3-35c) and for inhibition of IL-8 release (Figure 3-35d), respectively. In the same assay using 40 pM TNF (2 ng/ml) IC50 values of 760 nM for ATROSAB and 200 nM for H398 for inhibition of IL-6 release (n=2, not shown) and IC50 values of 210 nM for ATROSAB and 62 nM for H398 for inhibition of IL-8 release (n=3, not shown) were determined. Figure 3-35: Inhibition of IL-6 and IL-8 secretion by ATROSAB and H398. TNF induced secretion of IL-6 from HeLa cells (a) and IL-8 from HT1080 (b) in a concentration-dependent manner. Secretion of IL-6 (c) and IL-8 (d) induced by TNF at 1 ng/ml was inhibited by ATROSAB and H398 (n=3). To further investigate possible agonistic activities of ATROSAB and H398, the antibodies were incubated in serial dilution with human PBMCs (1 x 105 cells/well) isolated from buffy coat of healthy donors for 24 h and cytokine concentrations were determined by ELISA as described above. As control also TNF was incubated with PBMCs for 24 h, in this experiment only a moderate increase of cytokine levels (IL-6 and IL-8) was observed (Figure 3-36a,c). For IL-6 release a slightly increased level was determined after incubation with TNF and anti-TNFR2 antibody 80M2 (constant 1 µg/ml), indicating TNFR2 mediated activation. Neither ATROSAB nor H398 induced interleukin production (Figure 3-36b,d). These findings indicate that ATROSAB and H398 do not lead to activation of PBMCs, i.e. are not agonistic in this setting with freshly prepared primary cells. 76 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-36: PBMCs were incubated with TNF or TNF plus cross-linking mAb 80M2 and IL-6 (a) and IL-8 (c) levels were determined after 24 h by ELISA. In parallel, PBMCs were incubated with ATROSAB, H398 or negative control human IgG and IL-6 (b) and IL-8 (d) release was determined after 24h (n=3). Possible agonistic activity was additionally investigated using purified human granulocytes (PMN) which were freshly prepared from 20 ml blood and purified using Leukoprep (Polymorphprep™, AxisShield, Oslo, Norway) (experiment carried out by Dr. rer. nat. Dafne Müller). PMNs (2 x 10 5 cells) were incubated with TNF, ATROSAB or human IgG as control at concentrations of 1, 10, and 100 nM for 1 h. Incubation with phorbolester (PMA) was included as positive control (not shown). Degranulation was determined by adding dihydro-rhodamine (DHR) and subsequent FACS analysis gating the granulocyte population (Figure 3-37). Figure 3-37: Analysis of degranulation from PMNs of a healthy donor. PMNs were incubated with antibodies or TNF for 1 h and degranulation was determined by staining with DHR. Cells were quantified by flow cytometry. The positive control (PMA) induced nearly complete degranulation (97.7 %, not shown) but TNF induced as well a significant degranulation reaching approximately 40 % of positively stained cells at 10 – 100 nM. For ATROSAB, no or only a very weak degranulation was observed, compared to the negative control huIgG. 77 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 3.2.8 Results Epitope mapping Because H398 and ATROSAB do not bind to mouse TNFR1, a domain swapping strategy was applied for epitope mapping (Figure 3-38a). Binding to these chimeric TNFR1-Fc molecules was analyzed by ELISA. No binding was seen with chimeric molecules where the human CRD1 and 2 (construct 3) or only the CRD1 was substituted by the corresponding mouse domains (construct 4). Some weak binding was seen when only the A1 domain of CRD1 of human TNFR1 was exchanged with the corresponding mouse sequence (construct 5). Binding was also reduced with mouse TNFR1 containing the human CRD1 (construct 7) or the human A1 domain of CRD1 (construct 6), indicating that further regions are required for full binding. Extension of the human portion to include subdomain A1 of CRD2 resulted in a chimeric TNFR1 to which H398 and ATROSAB show strong binding (construct 8). Thus, the epitope resides in the N-terminal region of TNFR1 covering residues 1 to 70. Within this region, 15 residues are different between human TNFR1 and mouse TNFR1, while only one residue is different between human and rhesus TNFR1 (Figure 3-38b). This residue (Ile 21) is substituted by a valine in rhesus and mouse TNFR1. Several of the residues different between human and mouse TNFR1 are exposed in the interaction site of the receptor with TNF, including Pro23, Gln24, Tyr30, Asn31, Ser57, Ser 59, His66, and His69. In order to further narrow down the epitope, residues P23 and Gln24, located in sub-domain A1 of CRD1, were exchanged by the corresponding mouse residues in the chimeric TNFR1 h1-2A1/m2B2-4 (construct 10, Figure 3-38a,b). These mutations completely abolished binding of ATROSAB and strongly reduced binding of H398 under the applied assay conditions. Figure 3-38: a) Epitope mapping of ATROSAB and H398 using wild-type and chimeric human/mouse TNFR1-Fc fusion proteins. b) Sequence comparison of the identified epitope region (aa 1-70) of human (huTNFR1), mouse (moTNFR1), and rhesus (rhTNFR1) TNFR1. Cysteine residues are marked with grey boxes and the 2 positions (P23, Q24) analyzed by sitedirected mutagenesis are marked by asterisks. 78 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results The structure of TNFR1 shows the TNF contact site which is mainly located at CRD2 and 3 and shows that the antibody binding site at least partially overlaps with TNF binding (Figure 3-39). Thus, displacement of TNF by ATROSAB could be explained by sterical hindrance. Figure 3-39: a) Structure of TNF (red) bound to TNFR1 (blue). The identified epitope region is marked in green. b) A single TNFR1 chain. The positions (P23, Q24) identified by site-directed mutagenesis to contribute to binding of ATROSAB and H398 are highlighted in dark green. Structures were visualized with PyMol (http://www.pymol.org). 3.2.9 Optimization of IZI-06.1 Antibody affinity plays an important role in biological efficacy and increased affinity may allow for a reduced dosage of a therapeutic antibody and thereby toxic side effects may be reduced. The molecular surface of the antibody-combining site of an antibody is formed by the intersection of the apical regions of VL and VH (Figure 3-40a). The CDRs (complementarity-determining regions) lie in close spatial proximity and provide a contiguous surface for antigen recognition. The VH-CDRs, and the VH-CDR3 in particular, generally make more extensive contact than the VL-CDRs, and the geometrical centre of the antibody-antigen interface tends to lie near VH-CDR3. That is the initially reason for excluding VH-CDR3 and VL-CDR3 from optimization. The combining site of antibodies that recognize large protein antigens are generally more planar than those of antibodies recognizing smaller antigens such as peptides or DNA which have a grooved antigen-contacting surface. Large antigens often contact antibody residues at the edge of the combining site and interact with more apical portions of the CDR-loops. There exists a strong correlation between residues that do not form contacts with antigen and those residues that are important in defining the canonical backbone structures of the CDR loops. These residues tend to pack internally and are therefore less exposed on the antibody-combining site surface. Taken these considerations together exposed residues of VHCDR1,2 and VL-CDR1,2 were chosen for site directed mutagenesis (Figure 3-40b). 79 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz a) Results b) Figure 3-40: Antigen binding site of IZI-06.1 scFv (view is looking down). a) The CDRs of the heavy chain are depicted in red, the CRDs of the light chain are depicted in blue. b) Exposed residues of CDRs 1 and 2 which were chosen for mutagenesis. Structures were visualized with PyMol (http://www.pymol.org). Because selection of affinity matured mutants of IZI-06.1 was to be done by phage display, correct display of scFv fragments on phage was confirmed by performing a phage rescue of IZI-06.1_wt scFv (wild type) and showing specific binding of phage to human TNFR1-Fc in ELISA (Figure 3-41). Figure 3-41: Binding of IZI-06.1 scFv-phage to immobilized huTNFR1-Fc in ELISA. Immobilized HSA was included as control. Bound antibody –phage were detected by HRP-conjugated anti-M13 antibody. 3.2.9.1 Library construction Mutagenized scFv libraries were generated by site directed mutagenesis using primer introducing mutations and restriction sites for cloning into phage display vector pHEN2_scFvIZI-06.1_notwt (this acceptor vector was modified to contain a deletion after CDRH2 and an additional stop-codon to prevent production of wild type scFv). The primer contain the degenerate codon NHK (N=G,C,A,T / H=A,T,C / K=G,T) at the positions to be randomized, this allows for 24 codons = 16 aa (possible amino acids: LIMV FY KH DE STQN AP; absent amino acids: CWRG). Four different libraries were generated by using combinations of the primers. The PCR-based mutagenesis and cloning strategy is depicted in Figure 3-42. 80 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz a) Results b) Figure 3-42: Cloning strategy. a) Primer introducing mutations and restriction sites for subsequent cloning. b) Library construction. Combination of primer resulted in four libraries. Calculated permutations are depicted in red. Size of final libraries (Table 3-6) was determined by plating serial dilutions of transformed E. coli TG1. Diversity of the libraries (frequency and distribution of mutations) was confirmed by sequencing of randomly chosen clones (shown as percent functionality in Table 3-6). Table 3-6: Size and functionality of generated libraries. library 1 library 2 library 2a library 2b mutations in CDRH1/CDRL2 CDRH2/CDRL1 CDRH2 CDRL1 positions 6 12 7 5 H31,32,33/L50,53,56 H50,52,53,54,56,58,61 H50,52,53,54,56,58,61 L27D,27E,28,30,32 L27D,27E,28,30,32 possible diversity 7 2.8 x 10 7 1.6 x 10 14 2.68 x 10 8 1.05 x 10 6 8 8 7 size 6.4 x 10 2.2 x 10 2.57 x 10 7.95 x 10 functionality 90 % 67.5 % 73 % 60 % 3.2.9.2 Immunotube selection of library 1 (CDRH1/CDRL2) IZI-06.1 scFv library 1 (L1) was selected on huTNFR1-Fc and moTNFR1-Fc coated immunotubes using conditions of high stringency (i.e. low amounts of coated antigen, long washing steps). Binding of enriched phage antibodies to huTNFR1-Fc and moTNFR1-Fc was confirmed by polyclonal phage ELISA. No signals were found for phage selected on moTNFR1-Fc indicating that mutations at these positions are not able to confer binding to mouse TNFR1. Clones from round 2 and 3 were screened for binding to huTNFR1-Fc and moTNFR1-Fc using soluble scFv produced in non-suppressor strain HB2151. In total 27 positive clones (19 different in sequence, see Table 3-7) were identified out of 192 screened. 81 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Table 3-7: Sequences of individual clones selected from library 1 (immunotube selection). CDRH1 D F Y position L1 hu_A1 L1 hu_G3 L1(2) hu_A1 L1(2) hu_G3 L1 hu_A4 L1(2) hu_F5 L1 hu_D3 L1 hu_B5 L1 hu_E2 L1 hu_F10 L1 hu_E3 L1 hu_C5 L1 hu_A11 L1(2) hu_G6 L1 hu_E4 L1 hu_D1 L1 hu_H4 L1 hu_H5 L1 hu_E12 H31 T T T T D L S E S D E Q (tag) E D S Y Q A A H32 Y Y F F Y Y Y D F F F F N N N M M A H H33 F F F F F L L L Y Y V F M M M Y M F L IN CDRL2 T L1 hu_A1 L1 hu_F10 L1(2) hu_F5 L1(2) hu_G3 L1(2) hu_A1 L1(2) hu_G6 L1 hu_E12 L1 hu_E2 L1 hu_B5 L1 hu_C5 L1 hu_E4 L1 hu_H4 L1 hu_H5 L1 hu_E3 L1 hu_A4 L1 hu_G3 L1 hu_D3 L1 hu_A11 L1 hu_D1 L50 N N N N N N N N N Q Q Q Q Q T T T E E VS N RF S L53 K K K K K A A N Q K K K K Q H Q K K Q L56 T T T T M E A K K N K M Q A H H S N K Sequence analysis of enriched amino acids at the six randomized positions in CDRH1 and CDRL2 of these clones (Figure 3-43) revealed a preference for certain residues at some positions, e.g. Asn or Gln at position L50 and Lys at position L53. Furthermore, in CDRH1 a preference for aromatic residues was observed at position H32 and H33, i.e. retaining the original pattern, while at position H31 a trend towards hydrophilic residues (T, D, S, E) was observed. Figure 3-43: Sequence analysis of the selected clones of library 1 (CDRH1/CDRL2). Changed amino acids in CDRH1 are shown in red, changed amino acids in CDRL2 are shown in blue. Recurrence of original amino acids (present in IZI-06.1_wt) is indicated in green. 82 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.2.9.3 Immunotube selection of library 2 (CDRH2/CDRL1) IZI-06.1 scFv library 2 (L2) was selected on huTNFR1-Fc and moTNFR1-Fc coated immunotubes as described for L1. However, screening of individual clones of round two and three did not result in the identification of positive clones. Presumably, randomized positions affected one or more critical residues, which were not present in the correct composition in library 2 covering only a small fraction of all possible combinations. Therefore, library 2 was subdivided into two libraries L2a (CDRH2) and L2b (CDRL1). 3.2.9.4 Immunotube selection of library 2a (CDRH2) IZI-06.1 scFv library 2a (L2a) was selected on huTNFR1-Fc and moTNFR1-Fc coated immunotubes as described for libraries L1 and L2. In total 65 clones positive for huTNFR1-Fc binding were observed out of 282 screened, thereof 24 clones were sequenced and 21 positive clones (16 different in sequence, see Table 3-8) were identified. No clones were found that bind to moTNFR1-Fc. An analysis of the frequency of enriched residues revealed a preference for certain residues at some positions (Figure 3-45). At position H50 and H61 the original residue reoccurred, i.e. Glu at H50 and Glu (or the conserved Asp) at H61. New residues were selected for the remaining 5 residues, with for example a strong preference for Lys at position H52 (Tyr in wt) and Lys at position H58 (Tyr in wt). None of the wild type residues were enriched at these 5 positions. Table 3-8: Sequences of individual clones selected from library L2a (immunotube selection). CDRH2 WIG E I Y P Y S G H A Y Y N E position Lib2a_hu2R_C2 Lib2a_hu2R_C4 Lib2a_hu2R_D8 Lib2a_hu2R_F9 Lib2a_hu2R_C12 Lib2a_hu2R_E2 Lib2a_hu2R_G4 Lib2a_hu2R_F8 Lib2a_hu2R_E6 H50 E E K E E E E E E H52 L K V V K K K K K H53 T Q D T D T I D E H54 Q E Q Q E E E E E H56 T Q N E T Q A N T H58 H V K N E Q H A K H61 E E D E D T K E E Lib2a_hu3R_D12 Lib2a_hu3R_A5 Lib2a_hu3R_D4 Lib2a_hu3R_D11 Lib2a_hu3R_G11 Lib2a_hu3R_B3 Lib2a_hu3R_B2 Lib2a_hu3R_F1 Lib2a_hu3R_H10 E E E E E E E E E K K K E E K K L L E E E H H D D E E E E E T T M M Q Q T T T K K A A V T K K K E E K K K N E E E D D A A D P 83 KFK Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.2.9.5 Equilibrium selection of library 2a (CDRH2) IZI-06.1 scFv library 2a (L2a) was also selected using biotinylated antigen in solution. Prior to the first selection round a negative selection with moTNFR1-Fc was performed. Subsequently, 6 rounds of selection were performed with decreasing antigen concentrations, phage numbers and Dynabeads and increasing incubation times and washing steps. Binding of enriched phage antibodies to huTNFR1-Fc was confirmed by polyclonal phage ELISA (Figure 3-44). Figure 3-44: Polyclonal phage ELISA of selection rounds of L2a on huTNFR1-Fc (antigen concentrations indicated) with increased incubation times and washing steps. From 2nd – 4th round 186 clones were screened, out of those 38 were found to be positive for binding to huTNFR1-Fc. 20 clones were sequenced and 9 unique clones were identified (Table 3-9). From the 5th and 6th round 27 (R5) and 67 (R6) positive clones were identified out of 141 screened from each round. 20 clones were sequenced and were found to be identical in CDRH2-sequence (Table 3-9). Table 3-9: Sequences of individual clones selected from library 2a (equilibrium selection). CDRH2 WIG E I Y P Y S G H A Y Y N E position Lib2a_huB2R_B1 Lib2a_huB2R_E6 Lib2a_huB2R_F1 Lib2a_huB2R_F4 H50 E E E E H52 E Q K K H53 E A A N H54 Y H E D H56 P T E E H58 K T D E H61 D E D K Lib2a_huB3R_A9 Lib2a_huB3R_H10 E E Q H K P A K P H K T Q E Lib2a_huB4R_B6 Lib2a_huB4R_B9 Lib2a_huB4R_G6 E E E K K K D T E E E E T N T Q (tag) T K K A E Lib2a_huB5R_IA2 Lib2a_huB5R_IID3 E E V V T T Q Q E E K K D D Lib2a_huB6R_IE2 Lib2a_huB6R_IA11 Lib2a_huB6R_IG11 Lib2a_huB6R_IH6 Lib2a_huB6R_IIA10 Lib2a_huB6R_IIG12 E E E E E E K V V V V V D T T T T T E Q Q Q Q Q T E E E E E Q (tag) K K K K K K D D D D D 84 KFK Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results The analysis of the frequency of enriched amino acid residues resulted in a similar pattern as for the immunotube selection (Figure 3-45). At position H50 and H61 the original residue reoccurred, i.e. Glu at H50 and Glu (or the conserved Asp) at H61. New residues were selected for the remaining 5 residues. A difference between the two selection methods was seen at position H52 (Tyr in wt), at which Val was preferred (Lys in immunotube selection). The strong preference for Lys at position H58 (Tyr in wt) was seen in both selections. None of the wild type residues were enriched at these 5 positions. Figure 3-45: Sequence analysis of the selected clones of library 2a (CDRH2). Changed amino acids in CDRH2 are shown in red. Recurrence of original amino acids (present in IZI-06.1_wt) is indicated in green. 3.2.9.6 Immunotube selection of library 2b (CDRL1) IZI-06.1 scFv library 2b (L2b) was selected on huTNFR1-Fc and moTNFR1-Fc coated immunotubes using conditions of high stringency as described for L1 and L2a. Binding of enriched phage antibodies to huTNFR1-Fc was confirmed by polyclonal phage ELISA. Clones from round 1 and 2 were screened for binding to huTNFR1-Fc and moTNFR1-Fc using soluble scFv produced in non-suppressor strain HB2151. In total 67 positive clones were observed out of 271 screened, thereof 48 clones were sequenced and 21 positive clones (17 different in sequence) were identified. Amino acids at the 5 85 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results randomized positions in CDRL1 of these clones are shown in Table 3-10. No clones were found that bind to moTNFR1-Fc. Table 3-10: Sequences of individual clones selected from library 2b (immunotube selection). CDRL1 RSSQSLL H position Lib2b_hu1R_F3 Lib2b_hu1R_E2 Lib2b_hu1R_F7 Lib2b_hu1R_D10 Lib2b_hu1R_D11 Lib2b_mo2R_F7 Lib2b_mo2R_D9 Lib2b_hu1R_E6 Lib2b_hu1R_D8 Lib2b_hu1R_A11 Lib2b_hu1R_G5 Lib2b_hu1R_E11 Lib2b_hu2R_IH1 Lib2b_hu2R_E3 Lib2b_hu2R_C12 Lib2b_hu1R_F10 Lib2b_hu1R_C10 Lib2b_hu1R_E7 Lib2b_hu1R_H9 Lib2b_hu2R_B4 Lib2b_hu1R_C8 L27D S S S S S S S S S S S S S S S S T L L D N S N L27E D D D D D V V S S S A A T T M P P P S T T L28 S S S S S N N S S H T H N S D A S S N H A G N L30 L L L L L V V Q I A L L I V S A L V S L V T Y LH L32 F F F F F P P L L A Y S Y K M Y P P P Q L An analysis of the frequency of enriched residues of clones selected from L2b revealed a preference for certain residues at some positions (Figure 3-46). Thus, a strong preference for Ser was found at position L27D (His in wt) and position L28 (Asn in wt). A preference for hydrophobic residues was seen at position L30. At position L27E, L28 and L32 the original amino acid residues (as present in the wild type) reappeared to a small extent. 86 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Figure 3-46: Sequence analysis of the selected clones of library 2b (CDRL1). Changed amino acids in CDRL1 are shown in blue. Recurrence of original amino acids (present in IZI-06.1_wt) is indicated in green. 3.2.9.7 Summary of selections of CDR H1, H2, L1, L2 A summary of the results from selections of library 1, 2a and 2b on huTNFR1-Fc is shown in Figure 3-47. Figure 3-47: Summary of enriched residues in CDRL1, L2, H1, H2. Original and the selected prevalent residues are shown. Structures were visualized with PyMol (http://www.pymol.org). 87 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results 3.2.9.8 ScFv IZI-06.1_mutants and combined scFv Individual clones as well as scFv molecules combining all preferred residues (scFv kze1-4) were subcloned into expression vector pAB1, produced in E. coli TG1 and purified by IMAC. Table 3-11 shows the amino acid sequence of the CDRs of the different scFvs. Table 3-11: Differences in CDRs of scFvIZI-06.1 mutants and combined scFvs and production yields. The origin of the CDRs in the combined scFvs are indicated in parentheses (H1/H2/L1/L2). name CDRH1 CDRH2 CDRL1 CDRL2 scFv IZI-06.1_wt DFYIN WIGEIYPYSGHAYYNEKFK SLLHSNGNTYLH LLIYTVSNRFS yield [mg/l] 0.32-0.7 scFvL1(2)_hu2R_G3 TFFIN WIGEIYPYSGHAYYNEKFK SLLHSNGNTYLH LLIYNVSKRFT 0.36 scFvL2a_huB6R_IG11 DFYIN WIGEIVPTQGEAKYNDKFK SLLHSNGNTYLH LLIYTVSNRFS 0.94 ± 0.3 scFvL2a_hu3R_A5 DFYIN WIGEIKPEEGTAKYNEKFK SLLHSNGNTYLH LLIYTVSNRFS 0.87 scFvL2b_hu1R_F3 DFYIN WIGEIYPYSGHAYYNEKFK SLLSDSGLTFLH LLIYTVSNRFS 0.78 scFv kze1 (G3/A5/F3/G3) scFv kze2 (A1/A5/F3/G3) scFv kze3 (G3/IG11/F3/G3) scFv kze4 (G3/IG11/wt/G3) TFFIN WIGEIKPEEGTAKYNEKFK SLLSDSGLTFLH LLIYNVSKRFT 0.38-0.41 NFMIN WIGEIKPEEGTAKYNEKFK SLLSDSGLTFLH LLIYNVSKRFT 0.58-0.8 TFFIN WIGEIVPTQGEAKYNDKFK SLLSDSGLTFLH LLIYNVSKRFT 0.34 TFFIN WIGEIVPTQGEAKYNDKFK SLLHSNGNTYLH LLIYNVSKRFT 0.5-0.8 3.2.9.9 Binding and activity of scFv IZI-06.1 derivates Purified scFvs (Figure 3-48a,b; Figure 3-49a) were tested in ELISA for binding to huTNFR1-Fc (Figure 3-48c). ScFv kze3 as well as the four scFv with individually changed CDRs (see Table 3-11) showed binding to huTNFR1-Fc, while scFv kze1 and kze2 were inactive (not shown). Except for scFv L2b_F3 and scFv L2a_A5, all scFvs showed similar binding as wild type scFv IZI-06.1. Figure 3-48: Characterization of purified scFvs. a) SDS-PAGE analysis of purified scFvs. 15% SDS-PAGE, reducing conditions, 2 µg purified scFv/lane, Coomassie staining. b) Western blot analysis of purified scFvs. 15% SDS-PAGE, reducing conditions, 0.5 µg purified scFv/lane, WB: anti-His-HRP 1/1000, ECL. c) Binding of scFv derivates to human TNFR1-Fc (1 µg/ml) in ELISA (n=3). Data were normalized to Y=0 becomes 0 % for all data set and the largest value in each data set becomes 100 %. Data were fitted to the approximate equation of one site – specific binding Y = Bmax * X/(EC50 + X), where Bmax is the extrapolated maximum specific binding and EC50 is the concentration needed to achieve halfmaximum binding at equilibrium. 88 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results Because CDRL1 seems to have a negative effect on binding, a new scFv kze4 was generated based on scFv kze3, in which the CDRL1 was converted back to wild type. In ELISA binding to huTNFR1-Fc was slightly weaker compared to scFv IZI-06.1_wt and scFv kze3. Figure 3-49: Characterization of scFvkze4. a) SDS-PAGE (15%) analysis of purified scFvkze4 under reducing (1) and nonreducing (2) conditions (Coomassie staining). b) Binding of scFvkze 4 to immobilized huTNFR1-Fc in ELISA. Bound scFv was detected by HRP-conjugated anti-His antibody (1/2000) (n=3). Data were normalized to Y=0 becomes 0 % for all data set and the largest value in each data set becomes 100 %. Data were fitted to the approximate equation of one site – specific binding Y = Bmax * X/(EC50 + X), where Bmax is the extrapolated maximum specific binding and EC50 is the concentration needed to achieve half-maximum binding at equilibrium. Affinities of scFv IZI-06.1 derivates were determined by QCM measurements on immobilized huTNFR1-Fc (Table 3-12). The wild type scFv IZI-06.1 showed an affinity of 2.2 nM. Of the selected mutants only scFv L2a_IG11 showed an 2-fold higher affinity (1.2 nM) while scFv L1(2)_G3 showed a comparable affinity of 2.8 nM. Clones scFv L2a_A5 and scFv L2b_F3 showed decreased affinities of 15.2 nM and 44.6 nM, respectively. ScFv kze1 and kze2 (containing CDRH2 of clone L2a_A5 and CDRL1 of L2b_F3) showed no binding to huTNFR1-Fc in these experiments. ScFv kze3 that contains CDRH2 of clone L2a_IG11 bound to huTNFR1-Fc with an affinity of 9.7 nM. An affinity of 7.3 nM was determined for scFv kze4 in which CDRL1 was back-mutated to wild type. Table 3-12: Summary of binding kinetics of monovalent scFv IZI-06.1 derivates. sample n kon (M-1s-1) scFvIZI-06.1_wt 5 3.541 x 10 5 1.772 x 10 5 9.484 x 10 scFvkze4 1 koff (s-1) KD (nM) B (Hz) residual Ssq -4 2.236 7.212 0.3066 -3 7.291 7.839 0.1308 -4 9.687 7.459 0.1626 -4 1.158 8.423 0.2593 -4 2.757 7.809 0.2016 -3 15.17 6.947 0.2370 -3 44.58 7.869 0.1731 7.584 x 10 1.292 x 10 scFvkze3 1 0.979 x 10 5 scFvL2a_IG11 2 2.269 x 10 5 2.606 x 10 scFvL1(2)_G3 1 2.134 x 10 5 5.884 x 10 scFvL2a_A5 1 1.261 x 10 5 1.913 x 10 scFvL2b_F3 2 1.016 x 10 5 3.077 x 10 The antagonistic effects of scFv IZI-06.1_wt, individual clones and designed scFvs were analyzed for TNF-mediated cytotoxicity on Kym-1 cells (Figure 3-50). Of the individual clones only scFv L2a_IG11 89 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Results showed a higher blocking activity (IC50 value: approximately 10 nM) compared to scFv IZI-06.1_wt (IC50 value: approximately 30 nM). ScFv L1(2)_G3 showed similar blocking activity (IC50 value: approximately 30 nM) compared to scFv IZI-06.1_wt. Both scFv L2b_F3 and scFv L2a_A5 showed an about 300-fold reduced blocking activity (IC50 value: approximately 1000 nM) and scFv kze3 (which comprises CDRL1 of L2b_F3) showed no blocking activity at all, although ELISA and QCM experiments showed binding to TNFR1-Fc. The modified variant scFv kze4 (CDRL1 mutated back to the wild type residues) on the other hand, showed blocking activity although to a weaker extend compared to the wild type scFv IZI-06.1 (IC50 value: approximately 200 nM). Figure 3-50: Inhibition of TNF-mediated cytotoxicity on Kym-1 cells. a) Killing of Kym-1 cells upon TNF stimulation. b) IC50 values of scFvs. c,d) Inhibition of TNF-mediated cytotoxicity (1.25 ng/ml TNF) on Kym-1 cells by IZI-06.1 scFv mutants. Cells were analyzed after 7 h by crystal violet staining (n=3). Maximum (40 % viability of control) and half maximum (70 % viability of control) are depicted in dotted lines. 90 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion 4 Discussion 4.1 Hsp70-specific antibodies for cancer therapy 4.1.1 Chimerization of cmHsp70.1 (IgG tumex) In this study, the variable regions of mouse antibody cmHsp70.1 were cloned and various recombinant antibodies (scFv, scFv-Fc, chimeric IgG) could be produced in E. coli or mammalian cells. For all of them, an identical antigen binding activity was demonstrated as compared to the parental antibody cmHsp70.1. A sequence analysis revealed no differences between the variable lambda light chain domain and the closest mouse Vλ germline gene. In contrast, 8 differences were found between the cloned VH sequence and the closest mouse V germline gene, 7 of them located in framework regions (FR1, FR3) and only one in CDR1. The first three substitutions at positions 1, 3, and 5 are most likely due to cloning artifacts caused by the degenerate primer used for amplification of the VH sequence. Because production and/or antigen binding might be influenced by these alterations, a variant (variant 1) having these 3 residues exchanged by the germline residues was produced. However, both the originally cloned sequence as well as the variant (variant 1), showed an identical binding behavior in ELISA when produced as scFv molecules in E. coli, indicating that these residues have no influence on the antigen binding activity (Seitter 2010). Also, no substantial improvement of expression in E. coli for variant 1 was observed. A possibility to improve the expression of scFv tumex might be the co-expression of chaperones, as already shown for various other scFv molecules (Bothmann and Pluckthun 2000; Ow et al. 2010). Recently, Friedrich and co-workers described cloning of the cmHsp70.1 variable domain (Friedrich et al. 2010) and they also observed low production levels in E. coli for recombinant chimeric Fab fragments including sequence-optimized derivatives, e.g. generated by correcting, as in this study, the N-terminal sequence of the cloned VH and VL domains to that obtained by Edman sequencing and by codon optimization of two rare codons (encoding V47 and V48) of the VL domain. In their study, yields were dramatically increased (more than 100-fold) by co-expression of two thiol-disulfide oxidoreductases (DsbA, DsbC) and two peptidyl-prolyl cis/trans-isomerases with chaperone activity (FkpA, SurA) indicating that disulfide bond formation and cis/trans-isomeriation of prolyliminopeptide bonds are the rate-limiting steps (Friedrich et al. 2010). In initial experiments, low production yields were also found for the scFv-Fc and IgG molecules composed of the variable mouse sequences. An extensive screening of stably transfected cells was required to identify clones with an improved production of tumex IgG. In the case of scFv-Fc and 91 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion chimeric IgG produced by mammalian cells through the secretion process, the protein should be correctly folded and include the internal disulfide bond formation also in the variable domains. These results indicate that the low production yields are not solely due to disulfide bond formation, but also other disadvantages may result from the mouse variable domains. Both the scFv-Fc tumex and the chimeric IgG tumex recognized recombinant human Hsp70 (rhHSP70SBD) in ELISA with similar sensitivity as cmHsp70.1 and showed crossreactivity with mouse Hsp70 in immunoblot experiments, thereby confirming that the antigen-binding site of cmHsp70.1 was successfully cloned. 4.1.2 Humanization of cmHsp70.1 (IgG humex) In this study the variable region of the Hsp70 specific antibody cmHsp70.1 were successfully humanized through CDR grafting. In this strategy, one usually chooses a framework sequence that is most similar to the murine donor sequence in order to avoid differences in core packing and framework confirmation, which could have a disadvantageous effect on CDR conformation and thus on antigen affinity (Worn et al. 2000). A sequence identity of at least 65 % has been suggested for a successful humanization process (Hinton et al. 2004), as the antigen–binding affinity of the humanized antibody correlates with the degree of homology between the human and murine framework sequences. Beside the overall homology, key positions play a crucial role for successful humanization, e.g. residues at the VH/VL interface or in the Vernier zone can have a significant impact on antigen binding. This is especially true for murine Vλ domains, which show several amino acid substitutions at the VH/VL interface compared with the closest human homologue (Ewert et al. 2004). In this work, the subclass of the murine λ light chain donor framework was retained and a human germline λ sequence with identical canonical structure and a similarity of 67.27 % (V3-2, IGLV7-4*01) was chosen. At two positions, which are important for VH/VL interface, the donor and acceptor framework sequences differed: position L44 is a Phe in VL tumex and a Pro in V3-2, position L87 is a Phe in VL tumex and a Tyr in V3-2. Because position L44 is one of six residues that constitute the core of the VH/VL interface (Al-Lazikani et al. 1997) and Pro is the by far most frequently occurring amino acid at this position, the mouse residue was not retained. At position L87 both Phe and Tyr occur, but Tyr with more than two-fold higher frequency compared to Phe, which was the reason to keep the residue (Tyr) present in the human acceptor germline sequence. So far, there are very rare examples of successful antibody humanization with a human λ chain serving as acceptor (Schlapschy et al. 2009). A reason for that may be that κ chains are more frequent in mouse antibodies than λ chains (Mole et al. 1994). 92 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion Similarity search for the VH tumex revealed a number of human germline genes with high homology. The germline sequence showing the highest homology (IGHV2-70: 67.12 % similarity, z-score: -1.793) and the germline sequence showing the highest humanness (IGHV4-28: 66.44 % similarity, z-score: 0.143) were chosen for virtual CDR grafting and modeling. Probably because both acceptor sequences were of distinct canonical classes, they failed to retain the canonical structure in the modeled humanized version. Therefore, an additional similarity search was performed for each FR separately and a human germline sequence was chosen which was less homologue (IGHV3-66, DP86: FR1: 53.3 %, FR2: 84.6 %, FR3: 56.2%) but of the identical canonical class as VH tumex. The Vernier zone residues are located in the β-sheet FR regions closely underlying the CDRs and have been known to critically affect antigen binding by directly contacting the antigen, affecting CDR loop conformation, and/or influencing packing interactions between β-sheet strands (Foote and Winter 1992; Al-Lazikani et al. 1997; Makabe et al. 2008). The donor Vernier zone residues probably directly contacting the antigen (covered by the contact CDR definition) were preserved at sites where the sequences differed, while the Vernier zone residues located in the FR regions (FR3 of each of the heavy and the light chain) were changed to those present in the acceptor framework sequence. Humanization of cmHsp70.1 resulted in variable domains with improved production in E. coli and thermal stability, which also translated into improved production of whole IgG in mammalian cells, with initial cell pools of stable transfected cells already producing more than 23 mg/l supernatant and no need for extensive screening. Although it cannot be excluded that integration position effects may contribute to net expression in mammalian cells. Nevertheless, this finding confirms that humanization can have a beneficial effect on productivity and stability (Damschroder et al. 2007; Honegger 2008) and that rather framework residues than the CDRs account for the poor production of the mouse variable domains. Importantly, specificity and affinity was not affected by CDR grafting onto closely related human germline sequences. No back-mutations of mouse framework residues were necessary, while in literature it is described that the generation of humanized antibodies often results in a decrease of affinity (Saldanha et al. 1999; Schlapschy et al. 2004) and generally requires additional transfer of one or more framework-region residues from the parent mouse antibody (Gonzales et al. 2005). Other humanization methods have been described, like humanization by resurfacing first described by Padlan (Padlan 1991). The murine framework surface residues that are not observed in human antibodies are changed based on the observation that the immunogenicity of a protein is determined by the accessible and protruding residues (Novotny et al. 1986). However, CDR grafting remains the 93 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion most successful applied method and the approved humanized therapeutic antibodies were all generated by CDR grafting. Interestingly, the VH sequence of cmHsp70.1 contains an N-glycosylation site (N – X - S) at position 68 of FR3 of the VH domain, not found in the closest mouse germline sequence. It is established that 20 – 30 % of polyclonal human IgG molecules bear N-linked oligosaccharides within the Fab region (Jefferis 2005). Such variable domain N-glycans can influence antigen binding and also neutralizing activity of antibodies (Wright and Morrison 1993; Jacquemin et al. 2006). For example, it was shown that removal of a N-glycosylation site at position 73 of the VH domain during humanization of antiCD33 monoclonal antibody M195 led to a several fold increase in affinity (Co et al. 1992; Co et al. 1993). In other cases, e.g. humanization of anti-p185Her2 monoclonal antibody 4D5 containing a Nglycosylation site at position 65 of the VL domain, no differences in affinity were found between the glycosylated and aglycosylated form of this antibody (Carter et al. 1992). Glycosylation at position 68 of IgG tumex VH domain was indicated by an increased reduction of the molecular mass (4 kDa) of the heavy chain of IgG tumex after PNGase treatment as compared to IgG humex, which lacks this Nsequon and showed only a reduction by 2 kDa, caused by removal of the N-glycan in the CH2 domain. Binding to Hsp70 in ELISA was observed for the bacterially produced scFv tumex (i.e. not glycosylated) as well as scFv-Fc tumex produced in HEK293 cells. Furthermore, affinity of humex IgG was identical to that of cmHps70.1 and tumex IgG, indicating that the VH N-glycan does not contribute to antigen binding. Beside influencing antigen binding, glycosylation can also cause anaphylactic reactions as reported for cetuximab (Chung et al. 2008). Hypersensitivity to cetuximab, is caused by preexisting IgE antibodies against an oligosaccharide present on the recombinant molecule at Asn88 in the Fab portion (heavy chain) with a range of sugars, including galactose-α-1,3-galactose. Cetuximab is produced in the mouse cell line SP2/0 (unlike most other mAb), which expresses the gene for α-1,3galactosyltransferase (Koike et al. 2007). In conclusion, IgG-Fab glycosylation can impact differentially on the structural and functional characteristics of IgG and for a therapeutic antibody it might be advantageous if controlling of glycoform fidelity is restricted to one site (in the IgG-Fc region). 4.1.3 Epitope mapping of Hsp70-specific antibodies The mouse monoclonal antibody cmHsp70.1 (clone C92F3B1; (Gehrmann et al. 2004)) was raised by repeated immunization with the Hsp70 peptide TKDNNLLGRFELSG (TKD peptide; aa 450-463) with complete Freud's adjuvants and screening for reactivity with the inducible 72 kDa heat shock protein (HSPA1A, human gene 3303) but not with Hsc70 protein (HSPA8, human gene 3312) in Western blot analysis, and for its capacity to react with cell surface-bound Hsp70 on viable tumor cell lines 94 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion (Multhoff 2007). By peptide scanning (pepscan analysis), the sequence NLLGRFEL within the TKD peptide was identified as the relevant portion of the cmHsp70.1 epitope (Multhoff 2007). Contrary to that, this study showed that soluble peptides comprising this TKD sequence were not capable of inhibiting binding to Hsp70 in ELISA of cmHsp70.1 as well as the chimeric and humanized derivative. Also, recombinant fragments of Hsp70 containing this peptide sequence but terminating at residue 475 and 495, respectively, (fragments 2 and 8, Figure 3-16) did not show binding of the antibodies. This finding indicates that a larger portion of the SBD is required for full binding of the antibodies in immunoblotting experiments. Using various Hsp70 fragments, a region (aa 473-504) capable of binding the antibodies in immunoblotting experiments was identified. N- or C-terminal deletions of this region resulted in a complete loss of binding, indicating that the entire region is required. These results suggest a discontinuous or partially conformational epitope. In a structural model of Hsp70, this region, composed of 3 β-strands, is located adjacent to a β-strand containing the TKD sequence (see Figure 3-17). Antibodies recognizing this larger epitope region might have been enriched during the screening process on full-length Hsp70. Affinity data for binding of the Hsp70-specific antibodies to this minimal region (FR18) and fragments also containing the TKD sequence are currently not available. Such kinetic data would show if the TKD sequence is required to retain full antibody binding activity. The identified epitope region is identical to the corresponding sequence of mouse Hsp70, in line with the observation that cmHsp70.1, tumex IgG and humex IgG bind to human and mouse Hsp70, e.g. as shown by immunoblotting experiments. In contrast, three residues (489, 491, and 498) are different to the constitutively expressed Hsc70 (see also Figure 3-17). Because cmHsp70.1 does not bind Hsc70, the conclusion is that these residues directly contribute to antigen specificity. Further studies have to be performed to analyze the cell binding activity of the chimeric and humanized antibodies in comparison to the parental antibody and to demonstrate antitumor activity. Friedrich and co-workers already demonstrated cell-binding activity of a chimeric Fab fragment derived from cmHsp70.1 containing the identical CDRs as used in our humanized version (Friedrich et al. 2010). Membrane-bound Hsp70 has no proliferative activity, hence antitumor effects of the antimHsp70 antibody will be primarily exerted through ADCC and CDC and not by blocking of mHsp70 (Gastpar et al. 2004). The capacity to mediate ADCC in vitro was already shown for cmHsp70.1 monoclonal antibody (Stangl et al. 2010). In this study, also in vivo homing of the fluorescent-labeled antibody to CT26 mouse tumors and rapid internalization was shown. However, various studies with cmHsp70.1 have shown that rather low amounts of Hsp70 are exposed in the membrane of tumor cells (Hantschel et al. 2000). Thus, the parental and humanized antibody, exhibiting a nanomolar affinity for Hsp70, may benefit from affinity maturation (Hoogenboom 2005; Presta 2006). 95 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion Furthermore, engineering of the Fc region to exhibit an increased binding to FcγRIII and/or C1q, e.g. through protein or glyco-engineering, might be a suitable option to improve the cytotoxic activity and thus therapeutic efficacy (Presta 2008; Natsume et al. 2009). With the original as well as the humanized sequences of the variable domains of cmHsp70.1 now available, such modifications can be implemented in further developments of this anti-mHsp70 antibody as therapeutic reagent. 4.2 TNFR1-specific antibodies for the therapy of inflammatory diseases 4.2.1 Mono- and bivalent derivatives of humanized IZI-06.1 The second part of this thesis describes the generation of two monovalent albumin-fusion derivatives (IZI-06.1 scFv-HSA and IZI-06.1 Fab-HSA) and the generation of an IgG1 derivative (ATROSAB) of the humanized TNFR1-specific monoclonal antibody IZI-06.1 (Kontermann et al. 2008). The initially reason for the generation of monovalent antibody formats was the anticipated advantageous for use as a pure receptor antagonist that can block ligand binding to a receptor without cross-linking and potentially activating the receptor. The fusion to human serum albumin should extend the terminal half-life of the antibody fragments (scFv, Fab) (Kontermann 2009). Prolonged circulation times were found for various albumin fusion proteins in various animals; like Fab and scFv-albumin fusion proteins (Smith et al. 2001), rhIL2-rHSA (albuleukin (Melder et al. 2005)), and TNF-ligand (TNF, TRAIL, TWEAK) fused to albumin (Muller et al. 2010). So far only few data are available on the pharmacokinetic characteristics in humans. For an albumin-interferon-α fusion protein a prolonged circulation time was reported in a phase I/II clinical trial (Balan et al. 2006). The monovalent albumin-fusion antibodies showed some production and purification issues, such as degradation and a tendency to aggregate. However, both constructs retain antigen binding even though the affinity of IZI-06.1 scFv-HSA for human TNFR1-Fc was approximately 10-fold reduced compared to IZI-06.1 scFv. A reason for the decreased affinity may be sterical hindrance by the albumin. Further development of monovalent albumin-fusion derivatives based on IZI-06.1 will require engineering for improved stability, solubility and production. A starting point could be the peptide linker. Several studies have been made on the linker selection and suggest that the linker conformation, flexibility, hydrophilicity and length (distance between protein domains) are important not to disturb the functions of the linked domains (Crasto and Feng 2000). The IgG format (IgG ATROSAB) was chosen because of its long half-life, established production and increased binding due to bivalency. In order to avoid induction of antibody-mediated effector functions, ATROSAB possesses an Fc-region deficient in activation of ADCC and CDC (Armour et al. 1999; Shields et al. 2001). 96 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion Receptor-selective inhibition by ATROSAB and the parental mouse antibody resulted in blocking of distinct signaling pathways of TNFR1, as shown by inhibition of TNF-mediated cell death and NF-κB induced IL-6 and IL-8 release. Both cytokines are biomarkers of inflammation and are elevated e.g. during episodes of active disease in RA (Terato et al. 1989). The antagonistic activity of the murine H398 and the humanized monovalent Fab was described to be based on interference with ligand binding (Thoma et al. 1990; Moosmayer et al. 1995; Kontermann et al. 2008). Using deletion mutants the epitope recognized on TNFR1 was previously described to include the membrane-distal CRD1. By using a domain swapping strategy for chimeric mouse/human TNFR1-Fc fusion proteins, it was now shown that the epitope recognized by ATROSAB and H398 also includes subdomain A1 of CRD2, i.e. the total epitope is covered by amino acids 1 to 70 in the N-terminal region of TNFR1. The finding that also subdomain A1 of CRD2 is required for antibody binding hints toward sterical blockage as cause for neutralization of TNF action. The structure of TNFR1 with bound TNF (Figure 3-39) shows that the identified epitope region at least partially overlaps with the TNF binding site which is mainly located in CRD2 and CRD3 (Banner et al. 1993). Additionally, site directed mutagenesis revealed that residues Pro23 and Gln24 of subdomain A1 of CRD1 directly contribute to antigen and species specificity. This is of interest as CRD1 is not directly involved in ligand binding (Banner et al. 1993) but is critically involved in TNFR1 signaling. CRD1 controls high affinity ligand binding by stabilizing the conformation of the subsequent CRD2 (Branschadel et al. 2009) and removal of CRD1 results in loss of ligand binding (Chan et al. 2000; Siegel et al. 2000; Branschadel et al. 2009). In addition, CRD1 comprises a homophilic receptor/receptor interaction site, the pre-ligand-binding assembly domain (PLAD) which is essential for generation of functional TNFR signal complexes (Chan et al. 2000; Boschert et al. 2010). Hence, binding of ATROSAB to CRD1 could not only displace TNF by sterical hindrance or by inducing a conformational change but could also interfere with homotypic PLAD interactions, thereby blocking the formation of functional TNFR signal complexes. ATROSAB showed a slightly reduced antagonistic activity compared to H398. This is probably not due to altered affinity since affinities of both antibodies for recombinant human TNFR1 were similar as determined by quartz crystal microbalance measurements and in flow cytometry measurements using TNFR1-expressing cells. However, also in competition ELISA (Figure 3-30) 5 - 10-fold more ATROSAB was required to compete against binding of H398 to human TNFR1-Fc. Furthermore, both antibodies showed slight differences in binding to chimeric TNFR1-Fc in the epitope mapping experiments, albeit this could be also caused by the different detection systems used. Currently, it cannot be excluded that ATROSAB and H398 bind in a slightly different way or to a slightly different area within the identified region (aa 1-70) containing the epitope. Further epitope mapping by site 97 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion directed mutagenesis of exposed residues will provide insights into the exact localization of the conformational epitope of ATROSAB and H398 and the mechanism of ligand blocking. In absence of TNF, both antibodies (H398 and ATROSAB) also showed some minor agonistic activities at low nanomolar concentrations. This marginal effect of the bivalent antibodies on the cytokine release might be explained by cross-linking of receptors because monovalent Fab fragments of ATROSAB and H398 did not exhibit any agonistic activities (not shown). However, IL-6 and IL-8 levels increased only by 2 – 6 % compared to levels induced by TNF treatment. In these cell assays, IL-6 levels of up to 700 pg/ml were induced by TNF, comparable to IL-6 serum levels (400 - 600 pg/ml) observed in rhesus monkeys suffering from collagen-induced arthritis (Vierboom et al. 2007). ATROSAB showed no agonistic activity in experiments with human PBMCs (peripheral blood mononuclear cells) and PMNs (polymorphonuclear neutrophils). PBMCs and PMNs express both TNF receptors (Gehr et al. 1992) and showed cytokine production (IL-6, IL-8) or degranulation, respectively, upon TNF-stimulation. It has been shown that antibodies with agonistic activity at TNFR1 (e.g. Htr-9) mimicked the effect of TNF, while antagonistic antibody (e.g. TBP-2) lead to inhibition of PMN response to TNF (Zeman et al. 1996). Menegazzi and co-workers investigated the ability of H398 to influence superoxide (O2-) generation of PMN adherent to biologic surfaces. Although H398 incubated alone (10 µg/ml equates to 62.5 nM) with adherent PMN, stimulated PMN with a kinetic similar to TNF (10 µg/ml equates to 200 nM), no stimulation of superoxide production by PMN in suspension was observed (Menegazzi et al. 1994). Recently, two groups described the generation of antibodies antagonizing the activating receptor NKG2D on natural killer cells (Kwong et al. 2008; Steigerwald et al. 2009). Both groups reported agonistic activity of the antibodies under certain conditions, like immobilized antibody or antibody presented by cells bearing a high density of FcγR, leading to extensively cross-linking of NKG2D. Because bivalent binding appeared neutral and showed antagonistic effects in the presence of activating ligands, agonistic effects may be mediated only by cross-linking of the antibodies. Therefore, non-depleting antibody formats like Fab, F(ab)2 or antibodies with mutated Fc regions to diminish or eliminate Fc-receptor binding were suggested for application of these antibodies in inflammatory or autoimmune diseases. Importantly, binding of ATROSAB to rhesus TNF-R1 with a similar affinity as for human TNF-R1 could be demonstrated, thus allowing for in vivo evaluation of ATROSAB in rhesus monkeys. The collageninduced arthritis (CIA) model is the recognized standard for potential RA therapeutics and could be already reproducibly induced in rhesus macaques (Bakker et al. 1990). Because of the wellestablished proximity (physiological, anatomical, genetic, microbiological and immunological) with humans, CIA in rhesus monkeys represents a very useful preclinical model for evaluation of safety 98 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion and efficacy of novel therapies (t Hart et al. 2004) and enables the analysis of ATROSAB’s neutralizing activity and safety in non human primates. 4.2.2 Optimization of IZI-06.1 Attempts towards affinity maturation of IZI-06.1 resulted in a pool of mutant scFv, thereof only mutant scFv IG11 (library L2a, mutated in CDRH2) showed a two-fold increase in antigen-binding affinity over the parental scFv IZI-06.1, which also translated into improved blocking activity of TNFmediated cytotoxicity in an in vitro cell assay. One mutant (scFv G3, library L1, mutated in CDRH1/CDRL2) showed similar affinity and blocking activity compared to the wild type. Affinity maturation of antibodies is often associated with increased in vitro biological activity (Chowdhury and Wu 2005; Hoogenboom 2005) which may translate into increased in vivo activity. Antibody affinity may be significantly improved by applying directed evolution technologies. These technologies are characterized by several rounds of mutation, display, selection and amplification steps. Selecting the appropriate technology to affinity mature an antibody depends upon the origin of the antibody and the desired format (Wark and Hudson 2006). The library-construction strategies vary from substitutions of specific selected residues within the CDR loops (rational design) to random mutagenesis of the entire variable fragment (Fv). The several display technologies include phage display, ribosome display (Luginbuhl et al. 2006), and yeast display (Graff et al. 2004). Thereof phage display continues to be the most popular technology to screen antibody libraries and achieved increased affinities from the nanomolar to picomolar range (Yang et al. 1995; Schier et al. 1996a). While antibodies isolated from naïve or synthetic libraries have typically low dissociation constants (KD) in the micromolar range (Yau et al. 2005), not sufficient for therapeutic applications, antibodies generated in vivo can reach affinities up to 100 pM (Lowe and Jermutus 2004). The mouse mAb H398, generated by immunization of mice with purified TNF receptor material (Thoma et al. 1990) has a quite high huTNFR1-binding affinity of approximately 200 pM. This affinity could be retained for the humanized version ATROSAB (approximately 350 pM), yet it showed weaker blocking activity and might benefit from affinity maturation. Furthermore, the antibody has to compete with soluble TNF for binding to TNFR1, which has a high affinity of approximately 100 pM (Kontermann et al. 2008; Boschert et al. 2010). The CDRs, in particular CDRs3, which contain the most extensive sequence variation, are commonly targeted for in vitro mutagenesis. Because mAb H398 has been matured in vivo and already shows good affinity, it was assumed that CDRH3 and CDRL3, which contribute most of the binding energy, may not be amenable for further mutations. The antigen binding site of antibodies that recognize 99 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion large protein antigens are generally planar (Jones and Thornton 1996), and large antigens often contact antibody residues at the edge of the combining site and interact with more apical portions of the CDR loops (MacCallum et al. 1996). In the ideal case where high-resolution antibody structure or, preferably, antibody-antigen complex structures are available, determination of contact residues is straightforward and this information can be applied to guide the maturation process (Clark et al. 2006). However, also a molecular model of the antibody, like used in this study, can provide a useful starting point for predicting the site of useful mutations, because residues that make contact with the antigen are necessarily those at the surface. Site directed mutagenesis was used to introduce mutations into the CDRs 1 and 2 of both light and heavy chain, and targeted exposed residues. It is difficult to make libraries greater than 107 – 108 clones, which limits the number of amino acids to diversify as well as the extent of randomization. One of the main problems associated with affinity maturation by phage display is that of library completeness. Experience with phage display libraries supports the prediction that the probability of the identification of higher-affinity clones increases with the size and functionality of the display library (the number of clones that is displayed with sufficient efficiency to be potentially selectable) (Perelson and Oster 1979; Bradbury and Marks 2004). Therefore, four different libraries were generated with mutations either in CDRH1/CDRL2 (L1), CDRH2/CDRL1 (L2), CDRH2 (L2a) or CDRL1 (L2b) and selected in parallel for binding to both human and mouse TNFR1-Fc. Selection and screening of library L2 (CDRH2/CDRL1) did not result in identification of clones binding to human TNFR1, presumably randomized positions affected one or more critical residues, which were not present in the correct composition in library 2 covering only a small fraction of all possible combinations. Selection of libraries L1, L2a and L2b on the other hand yielded a number of mutant scFv showing binding to human TNFR1. Unfortunately, none of the selections on mouse TNFR1-Fc resulted in cross-reactive clones, indicating that mutations at the chosen positions are not able to confer binding to mouse TNFR1. Probably, the sequence-relatedness between mouse and human TNFR1 is not high enough and the epitope is not conserved. Two approaches have been used for the selection of higher affinity clones from diversified libraries: Selection with immobilized antigen and selection with antigen in solution. None of the mutants selected on immobilized antigen in immunotubes was predominant, although sequence analysis revealed preferences for certain amino acid residues at the mutated positions. ScFv from each library, representing the preferred amino acid, were bacterially produced and the antigen-binding affinity was analyzed. None of the mutants showed increased affinity, only scFv L1_G3 showed similar affinity and blocking activity compared to wild type scFv IZI-06.1. This may be due to the selection method with immobilized antigen, which is likely to result in the selection of phage displaying multiple copies of the scFv on the surface or phage displaying dimeric scFv which have a 100 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion higher functional affinity (avidity) but the monovalent binding constant is no higher than the wild type (Schier et al. 1996b). This is important when selecting scFv libraries, where it is known that the scFv can spontaneously dimerize, like IZI-06.1 scFv does (see SEC analysis,Figure 3-18). Interestingly, the only mutant (Lib2a_IG11) showing at least two-fold higher affinity compared to IZI-06.1 scFv, resulted from six rounds of equilibrium selection. In this method phage were incubated with soluble biotinylated antigen at decreasing concentrations (ideally below the equilibrium constant) and bound phage were recovered using streptavidin-coated magnetic beads. It is described that reduction of the antigen concentration leads to the selection of higher affinity scFv (Boder and Wittrup 1998). The higher affinity of clone L2a_IG11 resulted from a 1.6-fold increase in kon and a 3-fold decrease in koff. Increases in affinity achieved by display technology are typically due to reductions in dissociation rate. But also increases in association rate have been reported for antibodies that have undergone affinity maturation using display technology and targeted screening or selection strategies (Razai et al. 2005; Wu et al. 2005). Beneficial mutations from independently randomized CDRs can be combined in single clones and often further increase affinity in an additive or synergistic manner (Wells 1990). Although this strategy has been successfully employed for optimization of several antibodies, not all mutations have been additive (Yang et al. 1995; Schier et al. 1996c). This is no surprise since the CDRs lie in close spatial proximity and many residues pack against one another. In this work, the combination of the CDRs of the best candidates from immunotube selections in two scFv (kze1 and kze2) resulted in complete loss of antigen binding. This is probably due to unfavorable combination of CDRL1 (clone L2b_F3) and CDRH2 (clone L2a_A5), which both had lower affinities than the parental scFv, with CDRH1 and CDRL2 (clone L1_G3) which had similar affinity. Changing the CDRH2 to the sequence of mutant L2a_IG11 (scFv kze3) restored antigen binding and indicates the importance of CDRH2. However, no blocking activity was seen for scFv kze3. Mutating CDRL1 back to wild type results in a scFv (scFv kze4) with blocking activity, although the activity is weaker compared to scFv IZI-06.1 and L2a_IG11. The results for affinity maturation suggest that improvement of antigen-binding by mutation of CDR1 and 2 is possible and for CDRH2 and CDRL1 a strong impact on antigen binding was shown. Furthermore, the selection method was crucial for identification of high affinity binders, for that reason, selection of libraries L1 and L2b should be repeated using selection with soluble antigen. Other selection methods should also be considered, like off-rate selection, that is selections based on binding kinetics, in which the phage are allowed to saturate with the labeled antigen before a large molar excess of unlabeled antigen is added to the mix for a given amount of time. The majority of the 101 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Discussion bound wild type clones or clones with lower affinity will dissociate while the improved mutants remain bound on the labeled antigen (Hawkins et al. 1992). This method selects for mutants with a slower off-rate (koff) which is typically the major kinetic mechanism resulting in higher affinity when V genes are mutated (Marks et al. 1992). Additionally, the screening process could be optimized by using quartz crystal microbalance measurements for identifying the best candidates directly based on the off rate from unpurified samples. A sequential mutation strategy based on clone scFv L2a_IG11 might be most promising, given that combination of separately optimized CDRs had negative effects on binding. Also the mutation of CDRH3 and CDRL3 should be considered, these CDRs generally make more extensive contact with the antigen. However, it is not guaranteed that substituting any of the contact residues will improve binding. Successful affinity maturation may also be achieved using other methods like CDR walking (Barbas et al. 1994), hot-spot mutagenesis (Ho et al. 2005) or random mutagenesis of the complete variable domains by error-prone PCR (Luginbuhl et al. 2006), chain shuffling or using in vivo sytems like “mutator” E. coli strains or mammalian cells (B cells). Randomization and selection studies often yields substitutes residues that are not in contact with the antigen (Valjakka et al. 2002). Hence, it is extremely complicated to determine which residues make up the binding site, which of them can be improved, and which peripheral residues should also be considered. Alternatively, randomization of the antigen binding site of IZI-06.1 and selection to bias an epitope shift could result in antibodies with improved neutralization activity. In conclusion, the results of this study demonstrate that a number of prerequisites for the development of ATROSAB as a therapeutic are fulfilled, like lowest possible immunogenicity, high affinity and potency, high stability, cross-reactivity with relevant animals and defined biological activity. The next step would be the evaluation of the in vivo efficacy in a relevant disease model. Additionally, the results indicate that further engineering of ATROSAB offers a number of benefits for its therapeutic efficacy, and both affinity maturation and alternative antibody formats should be taken into consideration. TNFR1-selective antagonist, such as ATROSAB, will permit new therapeutic options for diseases where anti-TNF therapeutics failed or even exacerbate disease progression, including multiple sclerosis, congestive heart failure, metabolic diseases (type II diabetes), cytokine release syndrome, septic shock, acute (stroke) and chronic (Alzheimer and Parkinson disease) neurodegenerative diseases. ATROSAB could be an especially useful therapeutic alternative in diseases already known to clinically respond to anti-TNF treatment and particularly in those diseases where specific blockage of TNFR1 and maintenance of TNFR2 function appears as a promising therapeutic approach. 102 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References 5 References Abhinandan, K. R. and Martin, A. C. (2007). "Analyzing the "degree of humanness" of antibody sequences." J Mol Biol 369(3): 852-862. Adams, G. P., Schier, R., Marshall, K., Wolf, E. J., McCall, A. M., Marks, J. D. and Weiner, L. M. (1998). "Increased affinity leads to improved selective tumor delivery of single-chain Fv antibodies." Cancer Res 58(3): 485-490. Adams, G. P., Schier, R., McCall, A. M., Simmons, H. H., Horak, E. M., Alpaugh, R. K., Marks, J. D. and Weiner, L. M. (2001). "High affinity restricts the localization and tumor penetration of singlechain fv antibody molecules." Cancer Res 61(12): 4750-4755. Adams, G. P. and Weiner, L. M. (2005). "Monoclonal antibody therapy of cancer." Nat Biotechnol 23(9): 1147-1157. Aggarwal, S. (2009). "What's fueling the biotech engine--2008." Nat Biotechnol 27(11): 987-993. Al-Lazikani, B., Lesk, A. M. and Chothia, C. (1997). "Standard conformations for the canonical structures of immunoglobulins." J Mol Biol 273(4): 927-948. Alegre, M. L., Peterson, L. J., Xu, D., Sattar, H. A., Jeyarajah, D. R., Kowalkowski, K., Thistlethwaite, J. R., Zivin, R. A., Jolliffe, L. and Bluestone, J. A. (1994). "A non-activating "humanized" anti-CD3 monoclonal antibody retains immunosuppressive properties in vivo." Transplantation 57(11): 1537-1543. Almagro, J. C. and Fransson, J. (2008). "Humanization of antibodies." Front Biosci 13: 1619-1633. Armour, K. L., Clark, M. R., Hadley, A. G. and Williamson, L. M. (1999). "Recombinant human IgG molecules lacking Fcgamma receptor I binding and monocyte triggering activities." Eur J Immunol 29(8): 2613-2624. Baert, F., Noman, M., Vermeire, S., Van Assche, G., G, D. H., Carbonez, A. and Rutgeerts, P. (2003). "Influence of immunogenicity on the long-term efficacy of infliximab in Crohn's disease." N Engl J Med 348(7): 601-608. Bakker, N. P., van Erck, M. G., Zurcher, C., Faaber, P., Lemmens, A., Hazenberg, M., Bontrop, R. E. and Jonker, M. (1990). "Experimental immune mediated arthritis in rhesus monkeys. A model for human rheumatoid arthritis?" Rheumatol Int 10(1): 21-29. Balan, V., Nelson, D. R., Sulkowski, M. S., Everson, G. T., Lambiase, L. R., Wiesner, R. H., Dickson, R. C., Post, A. B., Redfield, R. R., Davis, G. L., Neumann, A. U., Osborn, B. L., Freimuth, W. W. and Subramanian, G. M. (2006). "A Phase I/II study evaluating escalating doses of recombinant human albumin-interferon-alpha fusion protein in chronic hepatitis C patients who have failed previous interferon-alpha-based therapy." Antivir Ther 11(1): 35-45. Banner, D. W., D'Arcy, A., Janes, W., Gentz, R., Schoenfeld, H. J., Broger, C., Loetscher, H. and Lesslauer, W. (1993). "Crystal structure of the soluble human 55 kd TNF receptor-human TNF beta complex: implications for TNF receptor activation." Cell 73(3): 431-445. Barbas, C. F., 3rd, Hu, D., Dunlop, N., Sawyer, L., Cababa, D., Hendry, R. M., Nara, P. L. and Burton, D. R. (1994). "In vitro evolution of a neutralizing human antibody to human immunodeficiency virus type 1 to enhance affinity and broaden strain cross-reactivity." Proc Natl Acad Sci U S A 91(9): 3809-3813. Beck, A., Wurch, T., Bailly, C. and Corvaia, N. (2010). "Strategies and challenges for the next generation of therapeutic antibodies." Nat Rev Immunol 10(5): 345-352. Beck, A., Wurch, T. and Corvaia, N. (2008). "Therapeutic antibodies and derivatives: from the bench to the clinic." Curr Pharm Biotechnol 9(6): 421-422. Benedict, C. A., MacKrell, A. J. and Anderson, W. F. (1997). "Determination of the binding affinity of an anti-CD34 single-chain antibody using a novel, flow cytometry based assay." J Immunol Methods 201(2): 223-231. Berard, F., Blanco, P., Davoust, J., Neidhart-Berard, E. M., Nouri-Shirazi, M., Taquet, N., Rimoldi, D., Cerottini, J. C., Banchereau, J. and Palucka, A. K. (2000). "Cross-priming of naive CD8 T cells 103 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References against melanoma antigens using dendritic cells loaded with killed allogeneic melanoma cells." J Exp Med 192(11): 1535-1544. Bibeau, F., Lopez-Crapez, E., Di Fiore, F., Thezenas, S., Ychou, M., Blanchard, F., Lamy, A., PenaultLlorca, F., Frebourg, T., Michel, P., Sabourin, J. C. and Boissiere-Michot, F. (2009). "Impact of Fc{gamma}RIIa-Fc{gamma}RIIIa polymorphisms and KRAS mutations on the clinical outcome of patients with metastatic colorectal cancer treated with cetuximab plus irinotecan." J Clin Oncol 27(7): 1122-1129. Black, R. A., Rauch, C. T., Kozlosky, C. J., Peschon, J. J., Slack, J. L., Wolfson, M. F., Castner, B. J., Stocking, K. L., Reddy, P., Srinivasan, S., Nelson, N., Boiani, N., Schooley, K. A., Gerhart, M., Davis, R., Fitzner, J. N., Johnson, R. S., Paxton, R. J., March, C. J. and Cerretti, D. P. (1997). "A metalloproteinase disintegrin that releases tumour-necrosis factor-alpha from cells." Nature 385(6618): 729-733. Boder, E. T. and Wittrup, K. D. (1998). "Optimal screening of surface-displayed polypeptide libraries." Biotechnol Prog 14(1): 55-62. Bolt, S., Routledge, E., Lloyd, I., Chatenoud, L., Pope, H., Gorman, S. D., Clark, M. and Waldmann, H. (1993). "The generation of a humanized, non-mitogenic CD3 monoclonal antibody which retains in vitro immunosuppressive properties." Eur J Immunol 23(2): 403-411. Bongartz, T., Sutton, A. J., Sweeting, M. J., Buchan, I., Matteson, E. L. and Montori, V. (2006). "AntiTNF antibody therapy in rheumatoid arthritis and the risk of serious infections and malignancies: systematic review and meta-analysis of rare harmful effects in randomized controlled trials." Jama 295(19): 2275-2285. Boschert, V., Krippner-Heidenreich, A., Branschadel, M., Tepperink, J., Aird, A. and Scheurich, P. (2010). "Single chain TNF derivatives with individually mutated receptor binding sites reveal differential stoichiometry of ligand receptor complex formation for TNFR1 and TNFR2." Cell Signal. Bothmann, H. and Pluckthun, A. (2000). "The periplasmic Escherichia coli peptidylprolyl cis,transisomerase FkpA. I. Increased functional expression of antibody fragments with and without cis-prolines." J Biol Chem 275(22): 17100-17105. Botzler, C., Li, G., Issels, R. D. and Multhoff, G. (1998). "Definition of extracellular localized epitopes of Hsp70 involved in an NK immune response." Cell Stress Chaperones 3(1): 6-11. Bradbury, A. R. and Marks, J. D. (2004). "Antibodies from phage antibody libraries." J Immunol Methods 290(1-2): 29-49. Branschadel, M., Aird, A., Zappe, A., Tietz, C., Krippner-Heidenreich, A. and Scheurich, P. (2009). "Dual function of cysteine rich domain (CRD) 1 of TNF receptor type 1: conformational stabilization of CRD2 and control of receptor responsiveness." Cell Signal 22(3): 404-414. Calderwood, S. K., Theriault, J. R. and Gong, J. (2005). "Message in a bottle: role of the 70-kDa heat shock protein family in anti-tumor immunity." Eur J Immunol 35(9): 2518-2527. Carter, P. (2001). "Improving the efficacy of antibody-based cancer therapies." Nat Rev Cancer 1(2): 118-129. Carter, P., Bedouelle, H. and Winter, G. (1985). "Improved oligonucleotide site-directed mutagenesis using M13 vectors." Nucleic Acids Res 13(12): 4431-4443. Carter, P., Presta, L., Gorman, C. M., Ridgway, J. B., Henner, D., Wong, W. L., Rowland, A. M., Kotts, C., Carver, M. E. and Shepard, H. M. (1992). "Humanization of an anti-p185HER2 antibody for human cancer therapy." Proc Natl Acad Sci U S A 89(10): 4285-4289. Carter, P., Smith, L. and Ryan, M. (2004). "Identification and validation of cell surface antigens for antibody targeting in oncology." Endocr Relat Cancer 11(4): 659-687. Carter, P. J. (2006). "Potent antibody therapeutics by design." Nat Rev Immunol 6(5): 343-357. Cartron, G., Dacheux, L., Salles, G., Solal-Celigny, P., Bardos, P., Colombat, P. and Watier, H. (2002). "Therapeutic activity of humanized anti-CD20 monoclonal antibody and polymorphism in IgG Fc receptor FcgammaRIIIa gene." Blood 99(3): 754-758. 104 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Cartron, G., Watier, H., Golay, J. and Solal-Celigny, P. (2004). "From the bench to the bedside: ways to improve rituximab efficacy." Blood 104(9): 2635-2642. Chan, A. C. and Carter, P. J. (2010). "Therapeutic antibodies for autoimmunity and inflammation." Nat Rev Immunol 10(5): 301-316. Chan, F. K., Chun, H. J., Zheng, L., Siegel, R. M., Bui, K. L. and Lenardo, M. J. (2000). "A domain in TNF receptors that mediates ligand-independent receptor assembly and signaling." Science 288(5475): 2351-2354. Chirino, A. J., Ary, M. L. and Marshall, S. A. (2004). "Minimizing the immunogenicity of protein therapeutics." Drug Discov Today 9(2): 82-90. Chowdhury, P. S. and Wu, H. (2005). "Tailor-made antibody therapeutics." Methods 36(1): 11-24. Choy, E. H., Hazleman, B., Smith, M., Moss, K., Lisi, L., Scott, D. G., Patel, J., Sopwith, M. and Isenberg, D. A. (2002). "Efficacy of a novel PEGylated humanized anti-TNF fragment (CDP870) in patients with rheumatoid arthritis: a phase II double-blinded, randomized, dose-escalating trial." Rheumatology (Oxford) 41(10): 1133-1137. Chung, C. H., Mirakhur, B., Chan, E., Le, Q. T., Berlin, J., Morse, M., Murphy, B. A., Satinover, S. M., Hosen, J., Mauro, D., Slebos, R. J., Zhou, Q., Gold, D., Hatley, T., Hicklin, D. J. and Platts-Mills, T. A. (2008). "Cetuximab-induced anaphylaxis and IgE specific for galactose-alpha-1,3galactose." N Engl J Med 358(11): 1109-1117. Clark, L. A., Boriack-Sjodin, P. A., Eldredge, J., Fitch, C., Friedman, B., Hanf, K. J., Jarpe, M., Liparoto, S. F., Li, Y., Lugovskoy, A., Miller, S., Rushe, M., Sherman, W., Simon, K. and Van Vlijmen, H. (2006). "Affinity enhancement of an in vivo matured therapeutic antibody using structurebased computational design." Protein Sci 15(5): 949-960. Clynes, R. A., Towers, T. L., Presta, L. G. and Ravetch, J. V. (2000). "Inhibitory Fc receptors modulate in vivo cytoxicity against tumor targets." Nat Med 6(4): 443-446. Co, M. S., Avdalovic, N. M., Caron, P. C., Avdalovic, M. V., Scheinberg, D. A. and Queen, C. (1992). "Chimeric and humanized antibodies with specificity for the CD33 antigen." J Immunol 148(4): 1149-1154. Co, M. S., Scheinberg, D. A., Avdalovic, N. M., McGraw, K., Vasquez, M., Caron, P. C. and Queen, C. (1993). "Genetically engineered deglycosylation of the variable domain increases the affinity of an anti-CD33 monoclonal antibody." Mol Immunol 30(15): 1361-1367. Coiffier, B., Lepretre, S., Pedersen, L. M., Gadeberg, O., Fredriksen, H., van Oers, M. H., Wooldridge, J., Kloczko, J., Holowiecki, J., Hellmann, A., Walewski, J., Flensburg, M., Petersen, J. and Robak, T. (2008). "Safety and efficacy of ofatumumab, a fully human monoclonal anti-CD20 antibody, in patients with relapsed or refractory B-cell chronic lymphocytic leukemia: a phase 1-2 study." Blood 111(3): 1094-1100. Cragg, M. S. and Glennie, M. J. (2004). "Antibody specificity controls in vivo effector mechanisms of anti-CD20 reagents." Blood 103(7): 2738-2743. Crameri, A., Cwirla, S. and Stemmer, W. P. (1996). "Construction and evolution of antibody-phage libraries by DNA shuffling." Nat Med 2(1): 100-102. Crasto, C. J. and Feng, J. A. (2000). "LINKER: a program to generate linker sequences for fusion proteins." Protein Eng 13(5): 309-312. Dall'Acqua, W. F., Kiener, P. A. and Wu, H. (2006). "Properties of human IgG1s engineered for enhanced binding to the neonatal Fc receptor (FcRn)." J Biol Chem 281(33): 23514-23524. Damschroder, M. M., Widjaja, L., Gill, P. S., Krasnoperov, V., Jiang, W., Dall'Acqua, W. F. and Wu, H. (2007). "Framework shuffling of antibodies to reduce immunogenicity and manipulate functional and biophysical properties." Mol Immunol 44(11): 3049-3060. Desai, S. B. and Furst, D. E. (2006). "Problems encountered during anti-tumour necrosis factor therapy." Best Pract Res Clin Rheumatol 20(4): 757-790. Di Gaetano, N., Cittera, E., Nota, R., Vecchi, A., Grieco, V., Scanziani, E., Botto, M., Introna, M. and Golay, J. (2003). "Complement activation determines the therapeutic activity of rituximab in vivo." J Immunol 171(3): 1581-1587. 105 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Duncan, A. R. and Winter, G. (1988). "The binding site for C1q on IgG." Nature 332(6166): 738-740. Duncan, A. R., Woof, J. M., Partridge, L. J., Burton, D. R. and Winter, G. (1988). "Localization of the binding site for the human high-affinity Fc receptor on IgG." Nature 332(6164): 563-564. Dunkelberger, J. R. and Song, W. C. (2010). "Complement and its role in innate and adaptive immune responses." Cell Res 20(1): 34-50. Ehrlich, P. (1906). Collected studies on immunity, Wiley. Ewert, S., Honegger, A. and Pluckthun, A. (2004). "Stability improvement of antibodies for extracellular and intracellular applications: CDR grafting to stable frameworks and structurebased framework engineering." Methods 34(2): 184-199. Farkas, B., Hantschel, M., Magyarlaki, M., Becker, B., Scherer, K., Landthaler, M., Pfister, K., Gehrmann, M., Gross, C., Mackensen, A. and Multhoff, G. (2003). "Heat shock protein 70 membrane expression and melanoma-associated marker phenotype in primary and metastatic melanoma." Melanoma Res 13(2): 147-152. Figini, M., Marks, J. D., Winter, G. and Griffiths, A. D. (1994). "In vitro assembly of repertoires of antibody chains on the surface of phage by renaturation." J Mol Biol 239(1): 68-78. Foote, J. and Winter, G. (1992). "Antibody framework residues affecting the conformation of the hypervariable loops." J Mol Biol 224(2): 487-499. Fredericks, Z. L., Forte, C., Capuano, I. V., Zhou, H., Vanden Bos, T. and Carter, P. (2004). "Identification of potent human anti-IL-1RI antagonist antibodies." Protein Eng Des Sel 17(1): 95-106. Friedrich, L., Stangl, S., Hahne, H., Kuster, B., Kohler, P., Multhoff, G. and Skerra, A. (2010). "Bacterial production and functional characterization of the Fab fragment of the murine IgG1/lambda monoclonal antibody cmHsp70.1, a reagent for tumour diagnostics." Protein Eng Des Sel 23(4): 161-168. Fujimori, K., Covell, D. G., Fletcher, J. E. and Weinstein, J. N. (1989). "Modeling analysis of the global and microscopic distribution of immunoglobulin G, F(ab')2, and Fab in tumors." Cancer Res 49(20): 5656-5663. Gastpar, R., Gehrmann, M., Bausero, M. A., Asea, A., Gross, C., Schroeder, J. A. and Multhoff, G. (2005). "Heat shock protein 70 surface-positive tumor exosomes stimulate migratory and cytolytic activity of natural killer cells." Cancer Res 65(12): 5238-5247. Gastpar, R., Gross, C., Rossbacher, L., Ellwart, J., Riegger, J. and Multhoff, G. (2004). "The cell surfacelocalized heat shock protein 70 epitope TKD induces migration and cytolytic activity selectively in human NK cells." J Immunol 172(2): 972-980. Gehr, G., Gentz, R., Brockhaus, M., Loetscher, H. and Lesslauer, W. (1992). "Both tumor necrosis factor receptor types mediate proliferative signals in human mononuclear cell activation." J Immunol 149(3): 911-917. Gehrmann, M., Brunner, M., Pfister, K., Reichle, A., Kremmer, E. and Multhoff, G. (2004). "Differential up-regulation of cytosolic and membrane-bound heat shock protein 70 in tumor cells by antiinflammatory drugs." Clin Cancer Res 10(10): 3354-3364. Gehrmann, M., Schmetzer, H., Eissner, G., Haferlach, T., Hiddemann, W. and Multhoff, G. (2003). "Membrane-bound heat shock protein 70 (Hsp70) in acute myeloid leukemia: a tumor specific recognition structure for the cytolytic activity of autologous NK cells." Haematologica 88(4): 474-476. Ghetie, V. and Ward, E. S. (2002). "Transcytosis and catabolism of antibody." Immunol Res 25(2): 97113. Gonzales, N. R., De Pascalis, R., Schlom, J. and Kashmiri, S. V. (2005). "Minimizing the immunogenicity of antibodies for clinical application." Tumour Biol 26(1): 31-43. Graff, C. P., Chester, K., Begent, R. and Wittrup, K. D. (2004). "Directed evolution of an anticarcinoembryonic antigen scFv with a 4-day monovalent dissociation half-time at 37 degrees C." Protein Eng Des Sel 17(4): 293-304. 106 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Green, L. L., Hardy, M. C., Maynard-Currie, C. E., Tsuda, H., Louie, D. M., Mendez, M. J., Abderrahim, H., Noguchi, M., Smith, D. H., Zeng, Y. and et al. (1994). "Antigen-specific human monoclonal antibodies from mice engineered with human Ig heavy and light chain YACs." Nat Genet 7(1): 13-21. Griffiths, A. D., Williams, S. C., Hartley, O., Tomlinson, I. M., Waterhouse, P., Crosby, W. L., Kontermann, R. E., Jones, P. T., Low, N. M., Allison, T. J. and et al. (1994). "Isolation of high affinity human antibodies directly from large synthetic repertoires." Embo J 13(14): 32453260. Gross, C., Koelch, W., DeMaio, A., Arispe, N. and Multhoff, G. (2003). "Cell surface-bound heat shock protein 70 (Hsp70) mediates perforin-independent apoptosis by specific binding and uptake of granzyme B." J Biol Chem 278(42): 41173-41181. Hanauer, S. B., Feagan, B. G., Lichtenstein, G. R., Mayer, L. F., Schreiber, S., Colombel, J. F., Rachmilewitz, D., Wolf, D. C., Olson, A., Bao, W. and Rutgeerts, P. (2002). "Maintenance infliximab for Crohn's disease: the ACCENT I randomised trial." Lancet 359(9317): 1541-1549. Hantschel, M., Pfister, K., Jordan, A., Scholz, R., Andreesen, R., Schmitz, G., Schmetzer, H., Hiddemann, W. and Multhoff, G. (2000). "Hsp70 plasma membrane expression on primary tumor biopsy material and bone marrow of leukemic patients." Cell Stress Chaperones 5(5): 438-442. Hawkins, R. E., Russell, S. J. and Winter, G. (1992). "Selection of phage antibodies by binding affinity. Mimicking affinity maturation." J Mol Biol 226(3): 889-896. Hinton, P. R., Johlfs, M. G., Xiong, J. M., Hanestad, K., Ong, K. C., Bullock, C., Keller, S., Tang, M. T., Tso, J. Y., Vasquez, M. and Tsurushita, N. (2004). "Engineered human IgG antibodies with longer serum half-lives in primates." J Biol Chem 279(8): 6213-6216. Ho, M., Kreitman, R. J., Onda, M. and Pastan, I. (2005). "In vitro antibody evolution targeting germline hot spots to increase activity of an anti-CD22 immunotoxin." J Biol Chem 280(1): 607-617. Honegger, A. (2008). "Engineering antibodies for stability and efficient folding." Handb Exp Pharmacol(181): 47-68. Hoogenboom, H. R. (2005). "Selecting and screening recombinant antibody libraries." Nat Biotechnol 23(9): 1105-1116. Hwang, W. Y. and Foote, J. (2005). "Immunogenicity of engineered antibodies." Methods 36(1): 3-10. Idusogie, E. E., Presta, L. G., Gazzano-Santoro, H., Totpal, K., Wong, P. Y., Ultsch, M., Meng, Y. G. and Mulkerrin, M. G. (2000). "Mapping of the C1q binding site on rituxan, a chimeric antibody with a human IgG1 Fc." J Immunol 164(8): 4178-4184. Idusogie, E. E., Wong, P. Y., Presta, L. G., Gazzano-Santoro, H., Totpal, K., Ultsch, M. and Mulkerrin, M. G. (2001). "Engineered antibodies with increased activity to recruit complement." J Immunol 166(4): 2571-2575. Jacquemin, M., Radcliffe, C. M., Lavend'homme, R., Wormald, M. R., Vanderelst, L., Wallays, G., Dewaele, J., Collen, D., Vermylen, J., Dwek, R. A., Saint-Remy, J. M., Rudd, P. M. and Dewerchin, M. (2006). "Variable region heavy chain glycosylation determines the anticoagulant activity of a factor VIII antibody." J Thromb Haemost 4(5): 1047-1055. Jefferis, R. (2005). "Glycosylation of recombinant antibody therapeutics." Biotechnol Prog 21(1): 1116. Jefferis, R. (2009a). "Glycosylation as a strategy to improve antibody-based therapeutics." Nat Rev Drug Discov 8(3): 226-234. Jefferis, R. (2009b). "Glycosylation of antibody therapeutics: optimisation for purpose." Methods Mol Biol 483: 223-238. Jones, P. T., Dear, P. H., Foote, J., Neuberger, M. S. and Winter, G. (1986). "Replacing the complementarity-determining regions in a human antibody with those from a mouse." Nature 321(6069): 522-525. Jones, S. and Thornton, J. M. (1996). "Principles of protein-protein interactions." Proc Natl Acad Sci U S A 93(1): 13-20. 107 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Kleinjung, T., Arndt, O., Feldmann, H. J., Bockmuhl, U., Gehrmann, M., Zilch, T., Pfister, K., Schonberger, J., Marienhagen, J., Eilles, C., Rossbacher, L. and Multhoff, G. (2003). "Heat shock protein 70 (Hsp70) membrane expression on head-and-neck cancer biopsy-a target for natural killer (NK) cells." Int J Radiat Oncol Biol Phys 57(3): 820-826. Köhler, G. and Milstein, C. (1975). "Continuous cultures of fused cells secreting antibody of predefined specificity." Nature 256(5517): 495-497. Koike, C., Uddin, M., Wildman, D. E., Gray, E. A., Trucco, M., Starzl, T. E. and Goodman, M. (2007). "Functionally important glycosyltransferase gain and loss during catarrhine primate emergence." Proc Natl Acad Sci U S A 104(2): 559-564. Kontermann, R. E. (2009). "Strategies to extend plasma half-lives of recombinant antibodies." BioDrugs 23(2): 93-109. Kontermann, R. E., Martineau, P., Cummings, C. E., Karpas, A., Allen, D., Derbyshire, E. and Winter, G. (1997). "Enzyme immunoassays using bispecific diabodies." Immunotechnology 3(2): 137144. Kontermann, R. E., Munkel, S., Neumeyer, J., Muller, D., Branschadel, M., Scheurich, P. and Pfizenmaier, K. (2008). "A humanized tumor necrosis factor receptor 1 (TNFR1)-specific antagonistic antibody for selective inhibition of tumor necrosis factor (TNF) action." J Immunother 31(3): 225-234. Kontermann, R. E., Scheurich, P. and Pfizenmaier, K. (2009). "Antagonists of TNF action - clinical experience and new developments." Expert Opin. Drug Discov. 4(3): 279-292. Krause, S. W., Gastpar, R., Andreesen, R., Gross, C., Ullrich, H., Thonigs, G., Pfister, K. and Multhoff, G. (2004). "Treatment of colon and lung cancer patients with ex vivo heat shock protein 70peptide-activated, autologous natural killer cells: a clinical phase i trial." Clin Cancer Res 10(11): 3699-3707. Krippner-Heidenreich, A., Tubing, F., Bryde, S., Willi, S., Zimmermann, G. and Scheurich, P. (2002). "Control of receptor-induced signaling complex formation by the kinetics of ligand/receptor interaction." J Biol Chem 277(46): 44155-44163. Kruppa, G., Thoma, B., Machleidt, T., Wiegmann, K. and Kronke, M. (1992). "Inhibition of tumor necrosis factor (TNF)-mediated NF-kappa B activation by selective blockade of the human 55kDa TNF receptor." J Immunol 148(10): 3152-3157. Kubota, T., Niwa, R., Satoh, M., Akinaga, S., Shitara, K. and Hanai, N. (2009). "Engineered therapeutic antibodies with improved effector functions." Cancer Sci 100(9): 1566-1572. Kwong, K. Y., Baskar, S., Zhang, H., Mackall, C. L. and Rader, C. (2008). "Generation, affinity maturation, and characterization of a human anti-human NKG2D monoclonal antibody with dual antagonistic and agonistic activity." J Mol Biol 384(5): 1143-1156. Labrijn, A. F., Aalberse, R. C. and Schuurman, J. (2008). "When binding is enough: nonactivating antibody formats." Curr Opin Immunol 20(4): 479-485. Laemmli, U. K. (1970). "Cleavage of structural proteins during the assembly of the head of bacteriophage T4." Nature 227(5259): 680-685. Lazar, G. A., Dang, W., Karki, S., Vafa, O., Peng, J. S., Hyun, L., Chan, C., Chung, H. S., Eivazi, A., Yoder, S. C., Vielmetter, J., Carmichael, D. F., Hayes, R. J. and Dahiyat, B. I. (2006). "Engineered antibody Fc variants with enhanced effector function." Proc Natl Acad Sci U S A 103(11): 4005-4010. Lindquist, S. and Craig, E. A. (1988). "The heat-shock proteins." Annu Rev Genet 22: 631-677. Lobo, E. D., Hansen, R. J. and Balthasar, J. P. (2004). "Antibody pharmacokinetics and pharmacodynamics." J Pharm Sci 93(11): 2645-2668. Locksley, R. M., Killeen, N. and Lenardo, M. J. (2001). "The TNF and TNF receptor superfamilies: integrating mammalian biology." Cell 104(4): 487-501. Loh, D. Y., Bothwell, A. L., White-Scharf, M. E., Imanishi-Kari, T. and Baltimore, D. (1983). "Molecular basis of a mouse strain-specific anti-hapten response." Cell 33(1): 85-93. Lonberg, N. (2005). "Human antibodies from transgenic animals." Nat Biotechnol 23(9): 1117-1125. 108 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Lonberg, N., Taylor, L. D., Harding, F. A., Trounstine, M., Higgins, K. M., Schramm, S. R., Kuo, C. C., Mashayekh, R., Wymore, K., McCabe, J. G. and et al. (1994). "Antigen-specific human antibodies from mice comprising four distinct genetic modifications." Nature 368(6474): 856859. Low, N. M., Holliger, P. H. and Winter, G. (1996). "Mimicking somatic hypermutation: affinity maturation of antibodies displayed on bacteriophage using a bacterial mutator strain." J Mol Biol 260(3): 359-368. Lowe, D. and Jermutus, L. (2004). "Combinatorial protein biochemistry for therapeutics and proteomics." Curr Pharm Biotechnol 5(1): 17-27. Luginbuhl, B., Kanyo, Z., Jones, R. M., Fletterick, R. J., Prusiner, S. B., Cohen, F. E., Williamson, R. A., Burton, D. R. and Pluckthun, A. (2006). "Directed evolution of an anti-prion protein scFv fragment to an affinity of 1 pM and its structural interpretation." J Mol Biol 363(1): 75-97. MacCallum, R. M., Martin, A. C. and Thornton, J. M. (1996). "Antibody-antigen interactions: contact analysis and binding site topography." J Mol Biol 262(5): 732-745. Makabe, K., Nakanishi, T., Tsumoto, K., Tanaka, Y., Kondo, H., Umetsu, M., Sone, Y., Asano, R. and Kumagai, I. (2008). "Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528." J Biol Chem 283(2): 1156-1166. Marchetti, L., Klein, M., Schlett, K., Pfizenmaier, K. and Eisel, U. L. (2004). "Tumor necrosis factor (TNF)-mediated neuroprotection against glutamate-induced excitotoxicity is enhanced by Nmethyl-D-aspartate receptor activation. Essential role of a TNF receptor 2-mediated phosphatidylinositol 3-kinase-dependent NF-kappa B pathway." J Biol Chem 279(31): 3286932881. Marks, J. D., Griffiths, A. D., Malmqvist, M., Clackson, T. P., Bye, J. M. and Winter, G. (1992). "Bypassing immunization: building high affinity human antibodies by chain shuffling." Biotechnology (N Y) 10(7): 779-783. Martin, A. C. (2001). Protein Sequence and structural analysis of antibody variable domains, Springer Heidelberg. Martin, A. C. and Thornton, J. M. (1996). "Structural families in loops of homologous proteins: automatic classification, modelling and application to antibodies." J Mol Biol 263(5): 800-815. Mayer, M. P. and Bukau, B. (2005). "Hsp70 chaperones: cellular functions and molecular mechanism." Cell Mol Life Sci 62(6): 670-684. McCafferty, J., Griffiths, A. D., Winter, G. and Chiswell, D. J. (1990). "Phage antibodies: filamentous phage displaying antibody variable domains." Nature 348(6301): 552-554. Melder, R. J., Osborn, B. L., Riccobene, T., Kanakaraj, P., Wei, P., Chen, G., Stolow, D., Halpern, W. G., Migone, T. S., Wang, Q., Grzegorzewski, K. J. and Gallant, G. (2005). "Pharmacokinetics and in vitro and in vivo anti-tumor response of an interleukin-2-human serum albumin fusion protein in mice." Cancer Immunol Immunother 54(6): 535-547. Mole, C. M., Bene, M. C., Montagne, P. M., Seilles, E. and Faure, G. C. (1994). "Light chains of immunoglobulins in human secretions." Clin Chim Acta 224(2): 191-197. Moosmayer, D., Dubel, S., Brocks, B., Watzka, H., Hampp, C., Scheurich, P., Little, M. and Pfizenmaier, K. (1995). "A single-chain TNF receptor antagonist is an effective inhibitor of TNF mediated cytotoxicity." Ther Immunol 2(1): 31-40. Morrison, S. L., Johnson, M. J., Herzenberg, L. A. and Oi, V. T. (1984). "Chimeric human antibody molecules: mouse antigen-binding domains with human constant region domains." Proc Natl Acad Sci U S A 81(21): 6851-6855. Moser, C., Schmidbauer, C., Gurtler, U., Gross, C., Gehrmann, M., Thonigs, G., Pfister, K. and Multhoff, G. (2002). "Inhibition of tumor growth in mice with severe combined immunodeficiency is mediated by heat shock protein 70 (Hsp70)-peptide-activated, CD94 positive natural killer cells." Cell Stress Chaperones 7(4): 365-373. 109 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Muller, D., Karle, A., Meissburger, B., Hofig, I., Stork, R. and Kontermann, R. E. (2007). "Improved pharmacokinetics of recombinant bispecific antibody molecules by fusion to human serum albumin." J Biol Chem 282(17): 12650-12660. Muller, D., Trunk, G., Sichelstiel, A., Zettlitz, K. A., Quintanilla, M. and Kontermann, R. E. (2008). "Murine endoglin-specific single-chain Fv fragments for the analysis of vascular targeting strategies in mice." J Immunol Methods 339(1): 90-98. Muller, N., Schneider, B., Pfizenmaier, K. and Wajant, H. (2010). "Superior serum half life of albumin tagged TNF ligands." Biochem Biophys Res Commun 396(4): 793-799. Multhoff, G. (2002). "Activation of natural killer cells by heat shock protein 70." Int J Hyperthermia 18(6): 576-585. Multhoff, G. (2007). "Heat shock protein 70 (Hsp70): membrane location, export and immunological relevance." Methods 43(3): 229-237. Multhoff, G. (2009). "Activation of natural killer cells by heat shock protein 70. 2002." Int J Hyperthermia 25(3): 169-175. Multhoff, G., Botzler, C., Jennen, L., Schmidt, J., Ellwart, J. and Issels, R. (1997). "Heat shock protein 72 on tumor cells: a recognition structure for natural killer cells." J Immunol 158(9): 43414350. Multhoff, G., Botzler, C., Wiesnet, M., Muller, E., Meier, T., Wilmanns, W. and Issels, R. D. (1995). "A stress-inducible 72-kDa heat-shock protein (HSP72) is expressed on the surface of human tumor cells, but not on normal cells." Int J Cancer 61(2): 272-279. Multhoff, G., Pfister, K., Botzler, C., Jordan, A., Scholz, R., Schmetzer, H., Burgstahler, R. and Hiddemann, W. (2000). "Adoptive transfer of human natural killer cells in mice with severe combined immunodeficiency inhibits growth of Hsp70-expressing tumors." Int J Cancer 88(5): 791-797. Multhoff, G., Pfister, K., Gehrmann, M., Hantschel, M., Gross, C., Hafner, M. and Hiddemann, W. (2001). "A 14-mer Hsp70 peptide stimulates natural killer (NK) cell activity." Cell Stress Chaperones 6(4): 337-344. Musolino, A., Naldi, N., Bortesi, B., Pezzuolo, D., Capelletti, M., Missale, G., Laccabue, D., Zerbini, A., Camisa, R., Bisagni, G., Neri, T. M. and Ardizzoni, A. (2008). "Immunoglobulin G fragment C receptor polymorphisms and clinical efficacy of trastuzumab-based therapy in patients with HER-2/neu-positive metastatic breast cancer." J Clin Oncol 26(11): 1789-1796. Myszka, D. G. (1997). "Kinetic analysis of macromolecular interactions using surface plasmon resonance biosensors." Curr Opin Biotechnol 8(1): 50-57. Myszka, D. G. and Morton, T. A. (1998). "CLAMP: a biosensor kinetic data analysis program." Trends Biochem Sci 23(4): 149-150. Natsume, A., In, M., Takamura, H., Nakagawa, T., Shimizu, Y., Kitajima, K., Wakitani, M., Ohta, S., Satoh, M., Shitara, K. and Niwa, R. (2008). "Engineered antibodies of IgG1/IgG3 mixed isotype with enhanced cytotoxic activities." Cancer Res 68(10): 3863-3872. Natsume, A., Niwa, R. and Satoh, M. (2009). "Improving effector functions of antibodies for cancer treatment: Enhancing ADCC and CDC." Drug Des Devel Ther 3: 7-16. Nielsen, U. B., Adams, G. P., Weiner, L. M. and Marks, J. D. (2000). "Targeting of bivalent anti-ErbB2 diabody antibody fragments to tumor cells is independent of the intrinsic antibody affinity." Cancer Res 60(22): 6434-6440. Nimmerjahn, F. and Ravetch, J. V. (2006). "Fcgamma receptors: old friends and new family members." Immunity 24(1): 19-28. Novotny, J., Bruccoleri, R. E. and Saul, F. A. (1989). "On the attribution of binding energy in antigenantibody complexes McPC 603, D1.3, and HyHEL-5." Biochemistry 28(11): 4735-4749. Novotny, J., Handschumacher, M., Haber, E., Bruccoleri, R. E., Carlson, W. B., Fanning, D. W., Smith, J. A. and Rose, G. D. (1986). "Antigenic determinants in proteins coincide with surface regions accessible to large probes (antibody domains)." Proc Natl Acad Sci U S A 83(2): 226-230. 110 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Ober, R. J., Radu, C. G., Ghetie, V. and Ward, E. S. (2001). "Differences in promiscuity for antibodyFcRn interactions across species: implications for therapeutic antibodies." Int Immunol 13(12): 1551-1559. Oflazoglu, E. and Audoly, L. P. (2010). "Evolution of anti-CD20 monoclonal antibody therapeutics in oncology." MAbs 2(1): 14-19. Olleros, M. L., Vesin, D., Lambou, A. F., Janssens, J. P., Ryffel, B., Rose, S., Fremond, C., Quesniaux, V. F., Szymkowski, D. E. and Garcia, I. (2009). "Dominant-negative tumor necrosis factor protects from Mycobacterium bovis Bacillus Calmette Guerin (BCG) and endotoxin-induced liver injury without compromising host immunity to BCG and Mycobacterium tuberculosis." J Infect Dis 199(7): 1053-1063. Ow, D. S., Lim, D. Y., Nissom, P. M., Camattari, A. and Wong, V. V. (2010). "Co-expression of Skp and FkpA chaperones improves cell viability and alters the global expression of stress response genes during scFvD1.3 production." Microb Cell Fact 9: 22. Padlan, E. A. (1991). "A possible procedure for reducing the immunogenicity of antibody variable domains while preserving their ligand-binding properties." Mol Immunol 28(4-5): 489-498. Perelson, A. S. and Oster, G. F. (1979). "Theoretical studies of clonal selection: minimal antibody repertoire size and reliability of self-non-self discrimination." J Theor Biol 81(4): 645-670. Pfister, K., Radons, J., Busch, R., Tidball, J. G., Pfeifer, M., Freitag, L., Feldmann, H. J., Milani, V., Issels, R. and Multhoff, G. (2007). "Patient survival by Hsp70 membrane phenotype: association with different routes of metastasis." Cancer 110(4): 926-935. Pope, R. M. (2002). "Apoptosis as a therapeutic tool in rheumatoid arthritis." Nat Rev Immunol 2(7): 527-535. Popkov, M., Jendreyko, N., Gonzalez-Sapienza, G., Mage, R. G., Rader, C. and Barbas, C. F., 3rd (2004). "Human/mouse cross-reactive anti-VEGF receptor 2 recombinant antibodies selected from an immune b9 allotype rabbit antibody library." J Immunol Methods 288(1-2): 149-164. Presta, L. G. (2002). "Engineering antibodies for therapy." Curr Pharm Biotechnol 3(3): 237-256. Presta, L. G. (2006). "Engineering of therapeutic antibodies to minimize immunogenicity and optimize function." Adv Drug Deliv Rev 58(5-6): 640-656. Presta, L. G. (2008). "Molecular engineering and design of therapeutic antibodies." Curr Opin Immunol 20(4): 460-470. Qiao, S. W., Kobayashi, K., Johansen, F. E., Sollid, L. M., Andersen, J. T., Milford, E., Roopenian, D. C., Lencer, W. I. and Blumberg, R. S. (2008). "Dependence of antibody-mediated presentation of antigen on FcRn." Proc Natl Acad Sci U S A 105(27): 9337-9342. Racila, E., Link, B. K., Weng, W. K., Witzig, T. E., Ansell, S., Maurer, M. J., Huang, J., Dahle, C., Halwani, A., Levy, R. and Weiner, G. J. (2008). "A polymorphism in the complement component C1qA correlates with prolonged response following rituximab therapy of follicular lymphoma." Clin Cancer Res 14(20): 6697-6703. Razai, A., Garcia-Rodriguez, C., Lou, J., Geren, I. N., Forsyth, C. M., Robles, Y., Tsai, R., Smith, T. J., Smith, L. A., Siegel, R. W., Feldhaus, M. and Marks, J. D. (2005). "Molecular evolution of antibody affinity for sensitive detection of botulinum neurotoxin type A." J Mol Biol 351(1): 158-169. Reichert, J. M. (2010). "Antibodies to watch in 2010." MAbs 2(1): 84-100. Reichert, J. M., Rosensweig, C. J., Faden, L. B. and Dewitz, M. C. (2005). "Monoclonal antibody successes in the clinic." Nat Biotechnol 23(9): 1073-1078. Roopenian, D. C. and Akilesh, S. (2007). "FcRn: the neonatal Fc receptor comes of age." Nat Rev Immunol 7(9): 715-725. Saldanha, J. W., Martin, A. C. and Leger, O. J. (1999). "A single backmutation in the human kIV framework of a previously unsuccessfully humanized antibody restores the binding activity and increases the secretion in cos cells." Mol Immunol 36(11-12): 709-719. Salfeld, J. G. (2007). "Isotype selection in antibody engineering." Nat Biotechnol 25(12): 1369-1372. 111 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Schier, R., Balint, R. F., McCall, A., Apell, G., Larrick, J. W. and Marks, J. D. (1996a). "Identification of functional and structural amino-acid residues by parsimonious mutagenesis." Gene 169(2): 147-155. Schier, R., Bye, J., Apell, G., McCall, A., Adams, G. P., Malmqvist, M., Weiner, L. M. and Marks, J. D. (1996b). "Isolation of high-affinity monomeric human anti-c-erbB-2 single chain Fv using affinity-driven selection." J Mol Biol 255(1): 28-43. Schier, R., McCall, A., Adams, G. P., Marshall, K. W., Merritt, H., Yim, M., Crawford, R. S., Weiner, L. M., Marks, C. and Marks, J. D. (1996c). "Isolation of picomolar affinity anti-c-erbB-2 singlechain Fv by molecular evolution of the complementarity determining regions in the center of the antibody binding site." J Mol Biol 263(4): 551-567. Schiff, M. H., Burmester, G. R., Kent, J. D., Pangan, A. L., Kupper, H., Fitzpatrick, S. B. and Donovan, C. (2006). "Safety analyses of adalimumab (HUMIRA) in global clinical trials and US postmarketing surveillance of patients with rheumatoid arthritis." Ann Rheum Dis 65(7): 889894. Schlapschy, M., Fogarasi, M., Gruber, H., Gresch, O., Schafer, C., Aguib, Y. and Skerra, A. (2009). "Functional humanization of an anti-CD16 Fab fragment: obstacles of switching from murine {lambda} to human {lambda} or {kappa} light chains." Protein Eng Des Sel 22(3): 175-188. Schlapschy, M., Gruber, H., Gresch, O., Schafer, C., Renner, C., Pfreundschuh, M. and Skerra, A. (2004). "Functional humanization of an anti-CD30 Fab fragment for the immunotherapy of Hodgkin's lymphoma using an in vitro evolution approach." Protein Eng Des Sel 17(12): 847860. Seitter, J. (2010). "Immunaffine und immunstimulatorische Strategien zur Tumortherapie." PhD Thesis. Universität Konstanz Sherman, M. and Multhoff, G. (2007). "Heat shock proteins in cancer." Ann N Y Acad Sci 1113: 192201. Shibata, H., Yoshioka, Y., Abe, Y., Ohkawa, A., Nomura, T., Minowa, K., Mukai, Y., Nakagawa, S., Taniai, M., Ohta, T., Kamada, H., Tsunoda, S. and Tsutsumi, Y. (2009). "The treatment of established murine collagen-induced arthritis with a TNFR1-selective antagonistic mutant TNF." Biomaterials 30(34): 6638-6647. Shibata, H., Yoshioka, Y., Ohkawa, A., Abe, Y., Nomura, T., Mukai, Y., Nakagawa, S., Taniai, M., Ohta, T., Mayumi, T., Kamada, H., Tsunoda, S. and Tsutsumi, Y. (2008a). "The therapeutic effect of TNFR1-selective antagonistic mutant TNF-alpha in murine hepatitis models." Cytokine 44(2): 229-233. Shibata, H., Yoshioka, Y., Ohkawa, A., Minowa, K., Mukai, Y., Abe, Y., Taniai, M., Nomura, T., Kayamuro, H., Nabeshi, H., Sugita, T., Imai, S., Nagano, K., Yoshikawa, T., Fujita, T., Nakagawa, S., Yamamoto, A., Ohta, T., Hayakawa, T., Mayumi, T., Vandenabeele, P., Aggarwal, B. B., Nakamura, T., Yamagata, Y., Tsunoda, S., Kamada, H. and Tsutsumi, Y. (2008b). "Creation and X-ray structure analysis of the tumor necrosis factor receptor-1-selective mutant of a tumor necrosis factor-alpha antagonist." J Biol Chem 283(2): 998-1007. Shields, R. L., Namenuk, A. K., Hong, K., Meng, Y. G., Rae, J., Briggs, J., Xie, D., Lai, J., Stadlen, A., Li, B., Fox, J. A. and Presta, L. G. (2001). "High resolution mapping of the binding site on human IgG1 for Fc gamma RI, Fc gamma RII, Fc gamma RIII, and FcRn and design of IgG1 variants with improved binding to the Fc gamma R." J Biol Chem 276(9): 6591-6604. Siegel, R. M., Frederiksen, J. K., Zacharias, D. A., Chan, F. K., Johnson, M., Lynch, D., Tsien, R. Y. and Lenardo, M. J. (2000). "Fas preassociation required for apoptosis signaling and dominant inhibition by pathogenic mutations." Science 288(5475): 2354-2357. Smith, B. J., Popplewell, A., Athwal, D., Chapman, A. P., Heywood, S., West, S. M., Carrington, B., Nesbitt, A., Lawson, A. D., Antoniw, P., Eddelston, A. and Suitters, A. (2001). "Prolonged in vivo residence times of antibody fragments associated with albumin." Bioconjug Chem 12(5): 750-756. 112 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Smith, K. G. and Clatworthy, M. R. (2010). "FcgammaRIIB in autoimmunity and infection: evolutionary and therapeutic implications." Nat Rev Immunol 10(5): 328-343. Spector, N. L. and Blackwell, K. L. (2009). "Understanding the mechanisms behind trastuzumab therapy for human epidermal growth factor receptor 2-positive breast cancer." J Clin Oncol 27(34): 5838-5847. Stangl, S., Gehrmann, M., Dressel, R., Alves, F., Dullin, C., Themelis, G., Ntziachristos, V., Staeblein, E., Walch, A., Winkelmann, I. and Multhoff, G. (2010). "In vivo imaging of CT26 mouse tumors by using cmHsp70.1 monoclonal antibody." J Cell Mol Med. Steigerwald, J., Raum, T., Pflanz, S., Cierpka, R., Mangold, S., Rau, D., Hoffmann, P., Kvesic, M., Zube, C., Linnerbauer, S., Lumsden, J., Sriskandarajah, M., Kufer, P., Baeuerle, P. A. and Volkland, J. (2009). "Human IgG1 antibodies antagonizing activating receptor NKG2D on natural killer cells." MAbs 1(2): 115-127. Steiner, K., Graf, M., Hecht, K., Reif, S., Rossbacher, L., Pfister, K., Kolb, H. J., Schmetzer, H. M. and Multhoff, G. (2006). "High HSP70-membrane expression on leukemic cells from patients with acute myeloid leukemia is associated with a worse prognosis." Leukemia 20(11): 2076-2079. Stork, R., Zettlitz, K. A., Muller, D., Rether, M., Hanisch, F. G. and Kontermann, R. E. (2008). "Nglycosylation as novel strategy to improve pharmacokinetic properties of bispecific singlechain diabodies." J Biol Chem 283(12): 7804-7812. Strohl, W. R. (2009). "Optimization of Fc-mediated effector functions of monoclonal antibodies." Curr Opin Biotechnol 20(6): 685-691. Szymkowski, D. E. (2005). "Creating the next generation of protein therapeutics through rational drug design." Curr Opin Drug Discov Devel 8(5): 590-600. t Hart, B. A., Amor, S. and Jonker, M. (2004). "Evaluating the validity of animal models for research into therapies for immune-based disorders." Drug Discov Today 9(12): 517-524. Tatusova, T. A. and Madden, T. L. (1999). "BLAST 2 Sequences, a new tool for comparing protein and nucleotide sequences." FEMS Microbiol Lett 174(2): 247-250. Terato, K., Arai, H., Shimozuru, Y., Fukuda, T., Tanaka, H., Watanabe, H., Nagai, Y., Fujimoto, K., Okubo, F., Cho, F. and et al. (1989). "Sex-linked differences in susceptibility of cynomolgus monkeys to type II collagen-induced arthritis. Evidence that epitope-specific immune suppression is involved in the regulation of type II collagen autoantibody formation." Arthritis Rheum 32(6): 748-758. Thoma, B., Grell, M., Pfizenmaier, K. and Scheurich, P. (1990). "Identification of a 60-kD tumor necrosis factor (TNF) receptor as the major signal transducing component in TNF responses." J Exp Med 172(4): 1019-1023. Tomlinson, I. M., Walter, G., Jones, P. T., Dear, P. H., Sonnhammer, E. L. and Winter, G. (1996). "The imprint of somatic hypermutation on the repertoire of human germline V genes." J Mol Biol 256(5): 813-817. Tracey, D., Klareskog, L., Sasso, E. H., Salfeld, J. G. and Tak, P. P. (2008). "Tumor necrosis factor antagonist mechanisms of action: a comprehensive review." Pharmacol Ther 117(2): 244279. Valjakka, J., Hemminki, A., Niemi, S., Soderlund, H., Takkinen, K. and Rouvinen, J. (2002). "Crystal structure of an in vitro affinity- and specificity-matured anti-testosterone Fab in complex with testosterone. Improved affinity results from small structural changes within the variable domains." J Biol Chem 277(46): 44021-44027. Vega, V. L., Rodriguez-Silva, M., Frey, T., Gehrmann, M., Diaz, J. C., Steinem, C., Multhoff, G., Arispe, N. and De Maio, A. (2008). "Hsp70 translocates into the plasma membrane after stress and is released into the extracellular environment in a membrane-associated form that activates macrophages." J Immunol 180(6): 4299-4307. Verhoeyen, M., Milstein, C. and Winter, G. (1988). "Reshaping human antibodies: grafting an antilysozyme activity." Science 239(4847): 1534-1536. 113 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz References Vierboom, M. P., Jonker, M., Tak, P. P. and t Hart, B. A. (2007). "Preclinical models of arthritic disease in non-human primates." Drug Discov Today 12(7-8): 327-335. Vultaggio, A., Matucci, A., Nencini, F., Pratesi, S., Parronchi, P., Rossi, O., Romagnani, S. and Maggi, E. (2009). "Anti-infliximab IgE and non-IgE antibodies and induction of infusion-related severe anaphylactic reactions." Allergy 65(5): 657-661. Wajant, H., Pfizenmaier, K. and Scheurich, P. (2003). "Tumor necrosis factor signaling." Cell Death Differ 10(1): 45-65. Wallach, D. and Kovalenko, A. (2009). "12th international TNF conference: the good, the bad and the scientists." Cytokine Growth Factor Rev 20(4): 259-269. Wallis, R. S. (2008). "Tumour necrosis factor antagonists: structure, function, and tuberculosis risks." Lancet Infect Dis 8(10): 601-611. Wark, K. L. and Hudson, P. J. (2006). "Latest technologies for the enhancement of antibody affinity." Adv Drug Deliv Rev 58(5-6): 657-670. Weiner, L. M., Surana, R. and Wang, S. (2010). "Monoclonal antibodies: versatile platforms for cancer immunotherapy." Nat Rev Immunol 10(5): 317-327. Wells, J. A. (1990). "Additivity of mutational effects in proteins." Biochemistry 29(37): 8509-8517. Wilson, N. S., Dixit, V. and Ashkenazi, A. (2009). "Death receptor signal transducers: nodes of coordination in immune signaling networks." Nat Immunol 10(4): 348-355. Worn, A., Auf der Maur, A., Escher, D., Honegger, A., Barberis, A. and Pluckthun, A. (2000). "Correlation between in vitro stability and in vivo performance of anti-GCN4 intrabodies as cytoplasmic inhibitors." J Biol Chem 275(4): 2795-2803. Wright, A. and Morrison, S. L. (1993). "Antibody variable region glycosylation: biochemical and clinical effects." Springer Semin Immunopathol 15(2-3): 259-273. Wu, H., Pfarr, D. S., Tang, Y., An, L. L., Patel, N. K., Watkins, J. D., Huse, W. D., Kiener, P. A. and Young, J. F. (2005). "Ultra-potent antibodies against respiratory syncytial virus: effects of binding kinetics and binding valence on viral neutralization." J Mol Biol 350(1): 126-144. Yang, W. P., Green, K., Pinz-Sweeney, S., Briones, A. T., Burton, D. R. and Barbas, C. F., 3rd (1995). "CDR walking mutagenesis for the affinity maturation of a potent human anti-HIV-1 antibody into the picomolar range." J Mol Biol 254(3): 392-403. Yau, K. Y., Dubuc, G., Li, S., Hirama, T., Mackenzie, C. R., Jermutus, L., Hall, J. C. and Tanha, J. (2005). "Affinity maturation of a V(H)H by mutational hotspot randomization." J Immunol Methods 297(1-2): 213-224. Zalevsky, J., Chamberlain, A. K., Horton, H. M., Karki, S., Leung, I. W., Sproule, T. J., Lazar, G. A., Roopenian, D. C. and Desjarlais, J. R. (2010). "Enhanced antibody half-life improves in vivo activity." Nat Biotechnol 28(2): 157-159. Zalevsky, J., Secher, T., Ezhevsky, S. A., Janot, L., Steed, P. M., O'Brien, C., Eivazi, A., Kung, J., Nguyen, D. H., Doberstein, S. K., Erard, F., Ryffel, B. and Szymkowski, D. E. (2007). "Dominant-negative inhibitors of soluble TNF attenuate experimental arthritis without suppressing innate immunity to infection." J Immunol 179(3): 1872-1883. Zeman, K., Kantorski, J., Paleolog, E. M., Feldmann, M. and Tchorzewski, H. (1996). "The role of receptors for tumour necrosis factor-alpha in the induction of human polymorphonuclear neutrophil chemiluminescence." Immunol Lett 53(1): 45-50. Zettlitz, K. A. (2007). "Recombinant Hsp70-specific Antibodies for Cancer Therapy." Diploma Thesis. Zettlitz, K. A., Seitter, J., Muller, D. and Kontermann, R. E. (2010). "Humanization of a Mouse Monoclonal Antibody Directed Against a Cell Surface-Exposed Epitope of MembraneAssociated Heat Shock Protein 70 (Hsp70)." Mol Biotechnol. 114 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Sequences 6 Sequences 6.1 human Hsp70 1 81 161 241 321 401 481 561 641 721 801 881 961 1041 1121 1201 1281 1361 1441 1521 1601 1681 atggccaaag ccgcggcgat cggcatcgac ctgggcacca cctactcctg cgtgggggtg ttccaacacg gcaaggtgga >>...................................ATPase domain....................................> m a k a a a i g i d l g t t y s c v g v f q h g k v gatcatcgcc aacgaccagg gcaaccgcac cacccccagc tacgtggcct tcacggacac cgagcggctc atcggggatg >....................................ATPase domain....................................> e i i a n d q g n r t t p s y v a f t d t e r l i g d cggccaagaa ccaggtggcg ctgaacccgc agaacaccgt gtttgacgcg aagcgcctga ttggccgcaa gttcggcgac >....................................ATPase domain....................................> a a k n q v a l n p q n t v f d a k r l i g r k f g d ccggtggtgc agtcggacat gaagcactgg cctttccagg tgatcaacga cggagacaag cccaaggtgc aggtgagcta >....................................ATPase domain....................................> p v v q s d m k h w p f q v i n d g d k p k v q v s caagggggag accaaggcat tctaccccga ggagatctcg tccatggtgc tgaccaagat gaaggagatc gccgaggcgt >....................................ATPase domain....................................> y k g e t k a f y p e e i s s m v l t k m k e i a e a acctgggcta cccggtgacc aacgcggtga tcaccgtgcc ggcctacttc aacgactcgc agcgccaggc caccaaggat >....................................ATPase domain....................................> y l g y p v t n a v i t v p a y f n d s q r q a t k d gcgggtgtga tcgcggggct caacgtgctg cggatcatca acgagcccac ggccgccgcc atcgcctacg gcctggacag >....................................ATPase domain....................................> a g v i a g l n v l r i i n e p t a a a i a y g l d aacgggcaag ggggagcgca acgtgctcat ctttgacctg ggcgggggca ccttcgacgt gtccatcctg acgatcgacg >....................................ATPase domain....................................> r t g k g e r n v l i f d l g g g t f d v s i l t i d acggcatctt cgaggtgaag gccacggccg gggacaccca cctgggtggg gaggactttg acaacaggct ggtgaaccac >....................................ATPase domain....................................> d g i f e v k a t a g d t h l g g e d f d n r l v n h ttcgtggagg agttcaagag aaaacacaag aaggacatca gccagaacaa gcgagccgtg aggcggctgc gcaccgcctg >....................................ATPase domain....................................> f v e e f k r k h k k d i s q n k r a v r r l r t a cgagagggcc aagaggaccc tgtcgtccag cacccaggcc agcctggaga tcgactccct gtttgagggc atcgacttct >....................................ATPase domain....................................> c e r a k r t l s s s t q a s l e i d s l f e g i d f acacgtccat caccagggcg aggttcgagg agctgtgctc cgacctgttc cgaagcaccc tggagcccgt ggagaaggct >....................................ATPase domain....................................> y t s i t r a r f e e l c s d l f r s t l e p v e k a ctgcgcgacg ccaagctgga caaggcccag attcacgacc tggtcctggt cgggggctcc acccgcatcc ccaaggtgca >....................................ATPase domain....................................> l r d a k l d k a q i h d l v l v g g s t r i p k v gaagctgctg caggacttct tcaacgggcg cgacctgaac aagagcatca accccgacga ggctgtggcc tacggggcgg >....................................ATPase domain....................................> q k l l q d f f n g r d l n k s i n p d e a v a y g a cggtgcaggc ggccatcctg atgggggaca agtccgagaa cgtgcaggac ctgctgctgc tggacgtggc tcccctgtcg >......ATPase domain......>>>>...............Substrate binding domain.................> a v q a a i l m g d k s e n v q d l l l l d v a p l s ctggggctgg agacggccgg aggcgtgatg actgccctga tcaagcgcaa ctccaccatc cccaccaagc agacgcagat >..............................Substrate binding domain...............................> l g l e t a g g v m t a l i k r n s t i p t k q t q cttcaccacc tactccgaca accaacccgg ggtgctgatc caggtgtacg agggcgagag ggccatgacg aaagacaaca >..............................Substrate binding domain...............................> i f t t y s d n q p g v l i q v y e g e r a m t k d n atctgttggg gcgcttcgag ctgagcggca tccctccggc ccccaggggc gtgccccaga tcgaggtgac cttcgacatc >..............................Substrate binding domain...............................> n l l g r f e l s g i p p a p r g v p q i e v t f d i gatgccaacg gcatcctgaa cgtcacggcc acggacaaga gcaccggcaa ggccaacaag atcaccatca ccaacgacaa >..............................Substrate binding domain...............................> d a n g i l n v t a t d k s t g k a n k i t i t n d gggccgcctg agcaaggagg agatcgagcg catggtgcag gaggcggaga agtacaaagc ggaggacgag gtgcagcgcg >..............................Substrate binding domain...............................> k g r l s k e e i e r m v q e a e k y k a e d e v q r agagggtgtc agccaagaac gccctggagt cctacgcctt caacatgaag agcgccgtgg aggatgaggg gctcaagggc >.......................>>>>....................C-terminal domain.....................> e r v s a k n a l e s y a f n m k s a v e d e g l k g aagatcagcg aggccgacaa gaagaaggtg ctggacaagt gtcaagaggt catctcgtgg ctggacgcca acaccttggc >..................................C-terminal domain..................................> k i s e a d k k k v l d k c q e v i s w l d a n t l 115 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz 1761 1841 1921 Sequences cgagaaggac gagtttgagc acaagaggaa ggagctggag caggtgtgta accccatcat cagcggactg taccagggtg >..................................C-terminal domain..................................> a e k d e f e h k r k e l e q v c n p i i s g l y q g ccggtggtcc cgggcctggg ggcttcgggg ctcagggtcc caagggaggg tctgggtcag gccccaccat tgaggaggta >..................................C-terminal domain..................................> a g g p g p g g f g a q g p k g g s g s g p t i e e v gattag >>> C-terminal domain d * 6.2 human TNFR1-Fc AgeI -+---1 atggagacag acacactcct gctatgggta ctgctgctct gggttccagg ttccaccggt ctggtccctc acctaggcga Igk-Leader' >>.N-terminal peptide...> g l v p h l g 81 tcgggagaag agagatagtg tgtgtcccca aggaaaatat atccaccctc aaaataattc gatttgctgt acaaagtgcc ...........>>>>.........................CDR1.A1.......................>>>>...CRD1.B2....> d r e k r d s v c p q g k y i h p q n n s i c c t k c 161 acaaaggaac ctacttgtat aatgactgtc caggcccggg gcaggatacg gactgcaggg agtgtgagag cggctccttc >..............................B2.............................>>>>.......CRD2.........> h k g t y l y n d c p g p g q d t d c r e c e s g s f 241 accgcttcag aaaaccacct cagacactgc ctcagctgct ccaaatgccg aaaggaaatg ggtcaggtgg agatctcttc >........................................CRD2.........................................> t a s e n h l r h c l s c s k c r k e m g q v e i s 321 ttgcacagtg gaccgggaca ccgtgtgtgg ctgtaggaag aaccagtacc ggcattattg gagtgaaaac cttttccagt >..............CRD2.............>>>>......................CRD3........................> s c t v d r d t v c g c r k n q y r h y w s e n l f q 401 gcttcaattg cagcctctgc ctcaatggga ccgtgcacct ctcctgccag gagaaacaga ataccgtgtg cacctgccat >.....................................CRD3.....................................>>>>...> c f n c s l c l n g t v h l s c q e k q n t v c t c h 481 gcaggtttct ttctaagaga aaacgagtgt gtctcctgta gtaactgtaa gaaaagcctg gagtgcacga agttgtgcct >........................................CRD4.........................................> a g f f l r e n e c v s c s n c k k s l e c t k l c NotI --+-----561 accccagatt gagaatgtta agggcactga ggactcaggt accacagcgg ccgcagacaa aactcacaca tgcccaccgt >.>>>>...................stem...................>> >>.........hinge..........> l p q i e n v k g t e d s g t t d k t h t c p p 641 gcccagcacc tgaactcctg gggggaccgt cagtcttcct cttcccccca aaacccaagg acaccctcat gatctcccgg >..>>>>.....................................CH2.......................................> c p a p e l l g g p s v f l f p p k p k d t l m i s r 721 acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc aactggtacg tggacggcgt >.........................................CH2.........................................> t p e v t c v v v d v s h e d p e v k f n w y v d g 801 ggaggtgcat aatgccaaga caaagccgcg ggaggagcag tacaacagca cgtaccgggt ggtcagcgtc ctcaccgtcc >.........................................CH2.........................................> v e v h n a k t k p r e e q y n s t y r v v s v l t v 881 tgcaccagga ctggctgaat ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc >.........................................CH2.........................................> l h q d w l n g k e y k c k v s n k a l p a p i e k t 961 atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg gaggagatga ccaagaacca >.....CH2.....>>>>................................CH3.................................> i s k a k g q p r e p q v y t l p p s r e e m t k n 1041 ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc gacatcgccg tggagtggga gagcaatggg cagccggaga >.........................................CH3.........................................> q v s l t c l v k g f y p s d i a v e w e s n g q p e 1121 acaactacaa gaccacgcct cccgtgctgg actccgacgg ctccttcttc ctctatagca agctcaccgt ggacaagagc >.........................................CH3.........................................> n n y k t t p p v l d s d g s f f l y s k l t v d k s 1201 1281 aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac tacacgcaga agagcctctc >.........................................CH3.........................................> r w q q g n v f s c s v m h e a l h n h y t q k s l EcoRI --+---cctgtctccg ggtaaataag aattc s l s p g k 116 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Sequences 6.3 mouse TNFR1 1 81 161 241 321 401 481 561 atggagacag acacactcct gctatgggta ctgctgctct gggttccagg ttccaccggt ctagtccctt ctcttggcga Igk-Leader' N-terminal peptide >>..................> l v p s l g tcgggagaag agggatagct tgtgtcccca aggaaagtat gtccattcta agaacaattc catctgctgt acaaagtgcc >...........>>>>.........................CRD1.A1..........................>>>>..B2...> d r e k r d s l c p q g k y v h s k n n s i c c t k c acaaaggaac ctacttggtg agtgactgtc cgagcccagg gcgggataca gtctgcaggg agtgtgaaaa gggcaccttt >...........................CRD1.B2...........................>>>>.......CRD2.........> h k g t y l v s d c p s p g r d t v c r e c e k g t f acggcttccc agaattacct caggcagtgt ctcagttgca agacatgtcg gaaagaaatg tcccaggtgg agatctctcc >........................................CRD2.........................................> t a s q n y l r q c l s c k t c r k e m s q v e i s ttgccaagct gacaaggaca ccgtgtgtgg ctgtaaggag aaccagttcc aacgctacct gagtgagaca cacttccagt >..............CRD2.............>>>>......................CRD3........................> p c q a d k d t v c g c k e n q f q r y l s e t h f q gcgtggactg tagcccctgc ttcaacggca ccgtgacaat cccctgtaag gagactcaga ataccgtgtg taactgccat >.....................................CRD3.....................................>>>>...> c v d c s p c f n g t v t i p c k e t q n t v c n c h gcagggttct ttctgagaga aagtgagtgc gtcccttgca gccactgcaa gaaaaatgag gagtgtatga agttgtgcct >........................................CRD4.........................................> a g f f l r e s e c v p c s h c k k n e e c m k l c acctcctccg cttgcaaatg tcacaaaccc ccaggactca ggtaccgcgg ccgcagacaa aactcacaca tgcccaccgt >.>>>>.................stem..................>> >>.........hinge..........> l p p p l a n v t n p q d s d k t h t c p p 6.4 rhesus TNFR1 1 81 161 241 321 401 481 561 atggagacag acacactcct gctatgggta ctgctgctct gggttccagg ttccaccggt ctggtgcccc ccctgcggga Igk-Leader N-terminal peptide >>..................> l v p p l r ccgggagaag agggacagcg tgtgccccca gggcaagtac atccaccccc agaacaactc cgtgtgctgt acaaagtgcc >...........>>>>................................CRD1..................................> d r e k r d s v c p q g k y i h p q n n s v c c t k c acaagggcac ctacctgtat aacgactgcc ccggacccgg ccaggacacc gactgcaggg aatgcgagag cggcagcttc >.............................CRD1............................>>>>.......CRD2.........> h k g t y l y n d c p g p g q d t d c r e c e s g s f accgccagcg agaaccacct gcggcactgc ctgtcctgct ccaagtgccg gaaagaaatg ggccaggtgg agatcagcag >........................................CRD2.........................................> t a s e n h l r h c l s c s k c r k e m g q v e i s ctgcaccgtg gaccgggaca ccgtgtgtgg ctgccggaag aaccagtaca gatactattg gagcgagaac ctgttccagt >............CRD2...........>> >>........................CRD3..........................> s c t v d r d t v c g c r k n q y r y y w s e n l f q gcttcaactg ctccctgtgc ctgaacggca ccgtgcacct gagctgccaa gaaaagcaga ataccgtctg cacctgccac >.....................................CRD3.....................................>>>>...> c f n c s l c l n g t v h l s c q e k q n t v c t c h gccggctttt ttctgcggga gaacgagtgc gtgtcctgtt ccaactgcaa gaaaaccctg gaatgcacca agctgtgcct >........................................CRD4.........................................> a g f f l r e n e c v s c s n c k k t l e c t k l c gccccagacc gagaacgtga agggcaccga ggacagcggc accacagcgg ccgcagacaa aactcacaca tgcccaccgt >.>>>>...................stem...................>> >>.........hinge..........> l p q t e n v k g t e d s g t t d k t h t c p p 117 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz Acknowledgements 7 Acknowledgements First of all, I am very grateful to my supervisor Roland Kontermann: thank you for arousing my interest in antibody engineering, which really feels like coming into my own. I consider the nearly five years in your lab to be a crucial learning period. Without your advice and support this thesis would not have been written. The first year of my PhD thesis project was done in collaboration with Gabriele Multhoff (München, Germany) and I have to thank for providing cmHsp70.1 and Colo+ cell line. Thanks to Julia Seitter: A problem shared is a problem halved. I would like to thank Miriam Rothdiener (Stuttgart, Germany) for help with the HPLC analysis, and Thomas Johannson (Attana, Stockholm, Sweden) for help in affinity measurements. This work was funded by a grant from the BMBF (BioChancePlus 0313686B). Special thanks are due to Roland and Klaus Pfizenmaier to admit me to the ATROSAB project after the Munich collaboration expired, that was a real life-saver. And I wish to extend special thanks also to Peter Scheurich: thanks to all three of you for tirelessly discussing my experimental results and my countless TNF-questions. I thank Sabine Münkel, who cloned the IZI-06.1 derivatives and I show appreciation to all the people at Celonic (Jülich, Germany and Basel, Switzerland) who contributed to this project. Thanks to Verena Lorenz for producing and purifying the different proteins. Special thanks are also due to Andreas Herrmann for reading each of my posters, presentations and this thesis. This work was supported by a grant from EC FP6, Project NeuroproMiSe, contract # LSHM-CT-2005-018637. I wish to extend very special thanks to Dafne Müller, for performing the flow cytometry experiments for the PMNs and especially for her interest and support in my work. Dafne, I appreciated your help and suggestion. Furthermore I thank Vanessa Kermer for isolation of PBMCs. Special thanks are also due to Nadine Fuß for her excellent technical assistance in size exclusion chromatography and her help with cloning and production of scFv. The long lab days were brightened up by all the former and present “Kontis”. Sylvia, thanks for your company in our addiction to sweets and for discussing every episode of various TV series. I also loved drinking Sekt with you and Miriam. Little Roland, the many internet researches have been so much fun. Ronny, thanks for sharing food (Müsli) with me. I also thank all the other people for the good working atmosphere at the institute. Finally, I want to express my deep gratitude to my family for their love, support and encouragement. Very special thanks go to my mother Hannah and my grandmother Margarete, both are shining examples of strong and intelligent women and inspire me every day. 118 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz CV 8 Curriculum Vitae Kirstin A. Zettlitz date of birth:05 October 1976 address: Sonnenblumenweg 3, D-65201 Wiesbaden, Germany mobile: +49 179 2914731 e-Mail: [email protected] [email protected] Experience University of Stuttgart, Germany April 2007 – July 2010 Doctorate at the Institute of Cell Biology and Immunology, Biomedical Engineering, Allmandring 31, D-70569 Stuttgart, Germany Doctorate at the group of Roland E. Kontermann. PhD thesis title: “Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases”. Humanization and characterization of a mouse monoclonal antibody specific for membrane-bound heat shock protein 70 (Hsp70) for cancer therapy. Epitope mapping, affinity maturation and functional characterization of a humanized Tumor Necrosis Factor 1 (TNFR1)-specific antibody for therapy of inflammatory diseases. Education University of Stuttgart, Germany April 2007, Diplom in Biology (technical orientation), overall grade: excellent (1.1) May 2006 – April 2007 Diploma thesis at the group of Roland E. Kontermann, Institute of Cell Biology and Immunology. Thesis title: “Recombinant Hsp70-specific Antibodies for Cancer Therapy”, grade: excellent (1.0). September 2005 – April 2006 Student research project at the group of Roland E. Kontermann, Institute of Cell Biology and Immunology. Thesis title: “Production and Characterization of modified single-chain Fv Antibody Fragments”, grade: excellent (1.0). October 2000 – April 2006 Main study period in technical biology. Major subject: Antibody Engineering, grade: excellent (1.0). Minor subjects: Industrial Genetics, grade: good (1.7); Microbiology, grade: excellent (1.0). Compulsory optional subject: Biochemistry, grade: excellent (1.3). 119 Engineered Antibodies for the Therapy of Cancer and Inflammatory Diseases Kirstin A. Zettlitz CV September 1997 – September 2000 Basic study period, Intermediate examination, overall grade: good (2.2). October 1996 – April 1997 Internship: municipal waterworks laboratory, ESWE, Wiesbaden, Germany Martin-Niemöller-Schule, Wiesbaden, Germany 1993 - 1996, Abitur (equivalent to High School Exam) Helene-Lange-Schule, Wiesbaden, Germany 1987 - 1993, comprehensive secondary school Blücherschule, Wiesbaden, Germany 1983 – 1987, elementary school Further Education Certificate Laboratory Animal Science: lecture on Laboratory Animal Science and practical course on experimental techniques at the Department of Animal Physiology, Institute of Biology (July 2007). Wall Street Institute, School of English, Diploma Advanced Stage, certificate equivalent to BULATS score of 60 (September 2005). Publications Zettlitz KA, Seitter J, Muller D and Kontermann RE. Humanization of a Mouse Monoclonal Antibody Directed Against a Cell Surface-Exposed Epitope of Membrane-Associated Heat Shock Protein 70 (Hsp70). Mol Biotechnol. 2010. Zettlitz KA, Lorenz V, Landauer KH, Muenkel S,Herrmann A, Scheurich P, Pfizenmaier K and Kontermann RE. ATROSAB, a humanized antagonistic anti-tumor necrosis factor onespecific antibody. mAbs 2010. Stork R, Zettlitz KA, Muller D, Rether M, Hanisch FG, Kontermann RE. N-glycosylation as novel strategy to improve pharmacokinetic properties of bispecific single-chain diabodies. J Biol Chem 2008;283:7804-7812. Hopp J, Hornig N, Zettlitz KA, Schwarz A, Fuss N, Muller D and Kontermann RE. The effects of affinity and valency of an albumin-binding domain (ABD) on the half-life of a single-chain diabody-ABD fusion protein. Protein Eng Des Sel 2010. Muller D, Trunk G, Sichelstiel A, Zettlitz KA, Quintanilla M, Kontermann RE: Murine endoglin-specific single-chain Fv fragments for the analysis of vascular targeting strategies in mice. J Immunol Methods 2008;339:90-98. Zettlitz KA, Generation of heavy and light chains (chimeric antibodies). In: Antibody Engineering Vol.1, Kontermann, RE and Dübel, S (eds.), Springer-Verlag Berlin Heidelberg 2010. Zettlitz KA, Protein A/G Chromatography. In: Antibody Engineering Vol.1, Kontermann, RE and Dübel, S (eds.), Springer-Verlag Berlin Heidelberg 2010. Communications PEGS Protein Engineering Summit, Boston 2010, poster presentation. IBC: Antibody Engineering, San Diego 2009, student poster scholarship. PEGS Europe: Protein Engineering Summit, Hannover 2009, poster presentation. CNIO: Recombinant Antibodies: new developments for future challenges, Madrid 2008, poster presentation. 120