EN-DE Automat-u-Roboter.xlsx
Transcrição
EN-DE Automat-u-Roboter.xlsx
EN ‐DE: slovar avtomatizacije in robotike [elektrische] Eigenbedarfsanlage auxiliaires [elektrische] Spannung [elektronischer] Analogrechner [gegenseitige] Verriegelung [gegenseitige] Verriegelung [harmonischer] Oszillator [industrielles] Robotersystem [kombiniertes] Dichte‐ und Feuchtemessgerät [lineares] System mit konstanten Koeffizienten [lineares] System mit konstanten Koeffizienten [logisch‐]funktioneller Entwurf [logische] Ausschließung [logische] Einschließung [mittleres] logarithmisches Energiedekrement [numerischer] Algorithmus [optischer] parametrischer Oszillator [Pontrjaginsches] Maximumprinzip [Pontrjaginsches] Maximumprinzip [positive] Rückmeldung [rechtwinklige] Kartesische Komponenten [schematisches] Fließbild [schematisches] Fließbild [Shannonsches] Abtasttheorem [ver]mengen [ver]mengen [ver]mengen [‐Verhalten 1 R‐Typ 2‐Achse eines Industrieroboters A L‐Blockstruktur Abänderung eines Roboterprogramms Abarten eines Programms Abbauprozess Abbautemperatur Abbesche Sinusbedingung Abbescher Sinussatz Abbildung Abbildungssystem Abbildungstheorie Abblasesystem abbrechen abbrechen abbrechen Abbremsung Abbruch Abbruch Abbruch Abbruchbedingung Abbruchreaktion Abdeckplatte Abelsche Integralgleichung Aberrationskonstante Aberregung Abfallaufarbeitung mittels Roboters Abfallberichtigung Abfallbeseitigung mittels Roboters Abfallgrenze Abfallprodukt Abfallsicherheitsfaktor Abfallwert Abfangmoment Abfragebetrieb Abfrageeinrichtung Abfragefrequenz Abfragefrequenz interrogation pulse 344 Abfrageimpuls Abfrageordnung Abfragepuffer Abfrageregister Abfragesteuerung Abfragesystem Abfragesystem mit Wiederholung Abführoperation eines Industrieroboters Abführungsgerät Abgasanlage abgearbeitet auxiliary [electrical] system voltage [electronic] analog computer blocking interlock[ing] oscillator robot system, industrial robot system density/moisture meter constant‐coefficient system [linear] system of constant coefficients functional design exclusion inclusion average logarithmic energy decrement computational algorithm [optical] parametric oscillator maximum principle Pontrjagin maximum principle acknowledgement acknowledge, ACK, answerback [rectangular] Cartesian components process diagram flow sheet sampling theorem blend v mix v mingle v integral action robot type, industrial robot type Z‐axis of [industrial] robot AL block structure modification of robot program varieties of program decomposition process breaking down temperature Abbe's sine theorem Abbe's sine theorem mapping image system theory of mapping blow‐down system interrupt v break v abort v braking interruption break[ing] abort truncation condition terminating reaction covering plate Abel integral equation aberration constant deenergization waste treatment by robot droop correction waste disposal by robot critical limit waste product safety factor for drop‐out rate of decrease moment of interception direct trunking answering equipment interrogation frequency interrogation frequency interrogation pulse values inquest order auxiliary feature interrogation register inquiry control interrogation system request repeat system unloading operation of industrial robot unloading device exhaust gas plant empty stran 1 od 326 EN ‐DE: slovar avtomatizacije in robotike abgebbare Leistung abgeglichene bipolare Schaltung abgeglichene Brücke abgeglichene Leitung abgegrenzte Betriebsweise abgekapptes Rauschen abgekürzte Adressierung abgelenkter Strahl abgeschirmte Leitung abgeschlossenes Intervall abgeschnittenes Rauschen abgestimmter Detektor abgestufter Spannungsteiler abgetastete Werkstückkontur abgetrennt abgetrennt Abgleich Abgleichdetektor Abgleicheinstellung abgleichen abgleichen Abgleichkreis Abgleichpotentiometer Abgleichpunkt Abgleichschaltung Abgleichschaltung Abgleichsignal Abgleichsignal Abgleichvorrichtung Abgleichwiderstand compensation Abgratroboter Abgrenzungsmethode abhängig verzögerter Selbstauslöser abhängige Variable abhängiger Prozessor Abhängigkeitsfaktor Abhebeformroboter Abkappkreis Abkappungsverstärker abklingende Impulse abklingende Schwingungen abklingende Schwingungen abklingende Sinusoide abklingende Sinusschwingung Abklingkonstante Abklingkonstante Abklingkonstante Abklingkurve Abklingkurve Abklingperiode Abklingzeit Abkuppeln mittels Manipulators Ablage von Werkstücken Ablagemessung Ablagemuster für IR (Werkstückordnung) Ablagerung Ablaßautomatik Ablaufeigenschaft Ablauffolgeprüfung Ablauffolgesteuerung Ablaufplanungsmodell Ablaufplanungsmodell Ablaufprogramm Ablaufprogrammierung eines IR Ablaufschema Ablaufsteuerung Ablaufsteuerung Ablaufsteuerung Ablaufsteuerung Ablaufsteuerungsspeicher Ablaufsteuerungsspeicher Ablaufverfolgungsprogramm Ablaufverfolgungsspeicher Ablaufzeitpunkt ablegen (Werkstück) Ableitung available power balanced bipolar circuit balanced bridge balanced line local mode clipped noise abbreviated addressing deflected beam shielded line closed interval clipped noise tuned detector graded potentiometer sampled contour offline autonomous alignment balance detector balancing balance v match v null circuit balancing potentiometer balance point balancing circuit incremental equivalent circuit compensating action compensation signal incremental equivalent circuit balancing resistance deburring robot determination method inverse time‐lag circuit‐breaker dependent variable support processor, slave processor control interaction factor relieving form robot clipper circuit clipper amplifier decaying pulses convergent oscillations damped oscillations damped sinusoid damped sinusoid attenuation factor damping coefficient damping factor damping curve decay curve damping period decay time manipulator coupling‐off depot of s distance difference measurement depot sample for IR deposit outlet automatics flowing property sequence checking sequence control scheduling model sequencing model development program trace programming of IR operating schedule, flow diagram operating control run‐off control series control sequential control development control memory development control memory (store) trace program trace memory expiry date sack to (workpiece) derivative stran 2 od 326 EN ‐DE: slovar avtomatizacije in robotike Ablenkamplitude Ablenkbarkeit Ablenkempfindlichkeit Ablenkempfindlichkeit Ablenkfehler Ablenkfeld Ablenkpotentiometer Ablenkspannung Ablenksystem Ablenkungseingriff Ablenkungskoeffizient Ablenkungskoeffizient Ablenkungsmodulation Ablenkungsmoment Ablenkungssynchronisierung Ablenkverstärker Ablesefehler Ablesefunktion Ablesegenauigkeit Ablesegerät Ablösung durch Roboter Abmessung der Zangengreifeinheit Abmessung eines Greifers Abnahme von Nennwerten der Bauelementeparameter Abnahmeprüfeinrichtung Abnahmeprüfeinrichtung Abnahmeprüfung Abnahmeversuch abnehmende Schwingungen abnehmende Schwingungen abnehmende Zeitfunktion Abnehmer betriebsbereit abproduktfreie Technologie abproduktfreier Prozess Abrufbefehl Abrufbefehl Abruf‐Interruptsystem Abrufphase Abrufregister Abrufsignal Abruftechnik Absackvorrichtung Absaugmanipulator Absaugvorrichtung Abschaltcharakteristik einer Strombegrenzungssicherung Abschaltelement abschalten Abschalten abschalten Abschalten Abschalten Abschalter Abschalter Abschaltgenauigkeit eines IR‐Schaltkreises Abschaltleistung Abschaltung Abschaltung Abschaltung Abschaltungsbedingung Abschaltverzögerung Abschaltverzögerung Abschaltzeit Abschaltzeit Abschätzung Abschätzung Abschlußimpedanz abschneiden Abschwächung Abschwächung des Feldes absichtlich eingeführte Nichtlinearität Absinken der Leistung absolut konvergent Absolutassembler absolute Adresse absolute Aktivität absolute Assemblersprache maximum deflection deflectability deflecting sensibility deflection sensitivity deflection aberration deflecting field deflection potentiometer deflecting voltage deflection system deflection action deflection coefficient deflection factor deflection modulation deflecting torque deflection synchronization deflection amplifier error of reading reading function accuracy of reading indicating instrument detachment by robot dimension of pincer gripper dimension component derating acceptance checkout equipment acceptance checkout equipment, ACE acceptance test acceptance test convergent oscillations damped oscillations decreasing time function acceptor operable, AO waste‐free technology waste‐free process calling instruction call statement polling interrupt system polling phase call register polling signal polling technique bagging machine extraction manipulator of robot suction fixture cut‐off characteristic of a current‐limiting fuse disconnection element disconnect v switching off cut off v trip out tripping cut‐off cut‐off switch disconnection accuracy of IR circuit breaking capacity switching off trip out tripping cut‐off condition shut‐down delay opening delay breaking time turn‐off time appreciation evaluation load impedance cut off v attenuation field reduction intentional nonlinearity decay of power absolutely convergent absolute assembler absolute address absolute activity absolute assembler language, AAL stran 3 od 326 EN ‐DE: slovar avtomatizacije in robotike absolute Bewegung absolute bolometrische Größe absolute Dämpfung absolute Digitalsteuerung absolute Effektororientierung absolute Effektororientierung absolute Effektorposition absolute Empfindlichkeit absolute Energieskale absolute Feuchte absolute Häufigkeit absolute kartesische Koordinaten absolute Kodierung absolute Messmethode absolute Stabilität absolute Temperatur absolute Temperaturskale absolute Verzögerung absolute Wahrscheinlichkeit absolute Wärmetönung absolute Zerfallsrate Absoluteichung absoluter Druck absoluter Fehler absoluter Feuchtegehalt absoluter Index absoluter Kode absoluter Lader absoluter Nullpunkt absoluter Vektor absoluter Wärmeeffekt absoluter Wert absoluter Wirkungsquerschnitt absolutes Elektrometer absolutes Format absolutes Koordinatensystem absolutes Laden absolutes Maximum absolutes Minimum absolutes Programmieren absolutes System Absoluthöhenmesser Absolutkoordinaten eines IR Absolutlader Absolutmessverfahren Absolutposition eines Manipulators Absolutwertdarstellung Absolutzähler Absorber Absorber Absorber absorbierbar absorbieren Absorbieren Absorbieren absorptiometrische Methode Absorption Absorption Absorption durch Fotoeffekt Absorptionsanalyse Absorptionsapparat Absorptionsapparat Absorptionsapparat Absorptionsäquivalent Absorptionsband Absorptionschromatografie Absorptionseinheit Absorptionsfähigkeit Absorptionsfilter Absorptionsfilter Absorptionsfläche Absorptionsfotometer Absorptionsfrequenzmesser Absorptionsgleichgewicht Absorptionsgrad Absorptionskante absolute motion absolute bolometric magnitude absolute damping absolute digital control absolute effector orientation absolute effector orientation absolute effector position absolute sensitivity absolute energy scale absolute humidity absolute frequency absolute Cartesian coordinates absolute coding absolute measuring method absolute stability absolute temperature absolute temperature scale absolute delay absolute probability absolute heating effect absolute disintegration rate absolute calibration absolute pressure absolute error absolute moisture content absolute index absolute code absolute loader absolute zero absolute vector absolute heating effect absolute value absolute cross section absolute electrometer absolute format absolute coordinate system absolute loading absolute maximum absolute minimum absolute programming absolute system absolute altimeter absolute coordinates of IR absolute loader absolute measuring method absolute position of manipulator absolute value representation absolute counter absorber absorbing apparatus absorption apparatus absorbable absorb v absorption absorbing absorption measuring method absorption absorbing photoelectric absorption absorption analysis absorber absorbing apparatus absorption apparatus absorption equivalent absorption band absorption chromatography absorption unit absorption capacity absorbent filter absorption filter absorption plane absorption photometer absorption frequency meter absorption equilibrium absorption index absorption edge stran 4 od 326 EN ‐DE: slovar avtomatizacije in robotike Absorptionskoeffizient Absorptionskreis Absorptionskurve Absorptionslinie Absorptionsmedium Absorptionsmesser Absorptionsmodulation Absorptionsprozess Absorptionspunktschätzung Absorptionsregelung Absorptionsröntgenspektrum Absorptionssättigung Absorptionssäule Absorptionssignal Absorptionsspektralfotometer Absorptionsspektrum Absorptionsspitze Absorptionssprung Absorptionstechnik Absorptionstemperatur Absorptionstrockner Absorptionsverfahren Absorptionsvermögen Absorptionsversuch Absorptionswahrscheinlichkeit Absorptionswellenmesser absperren absperren Absperrventil absstandsgetreue Impulse Abstandsberichtigung Abstandsdiskriminator Abstandsfunktion Abstandsmesser Abstandssensor absteigend Abstellhebel für Automatik Abstimmeinheit abstimmen abstimmen abstimmen abstimmen Abstimmregelung Abstimmskale Abstimmskale Abstimmskale Abstimmtafel Abstimmung abstrakte Automatentheorie abstrakte Rechenmaschine abstrakte Theorie abstrakte Verbindung abstrakte Zahl abstrakter Automat abstrakter Entwurf abstrakter Kode abstrakter Kode abstrakter Wert abstraktes Modell abstraktes Typenkonzept Abstraktion Absuchen Absuchen Absuchen Abszisse der absoluten Konvergenz Abszissenachse Abszissenachse Abtast Abtast Abtastblock Abtastblock Abtasteinrichtung Abtasten Abtasten Abtasten abtastendes Laserradargerät absorption coefficient absorption circuit absorption curve absorption line absorbing medium absorptiometer absorption modulation absorption process last‐event estimator absorption control absorption spectrum of X‐rays absorption saturation absorption column absorption signal absorption spectrophotometer absorption spectrum absorption peak absorption discontinuity technology of absorption absorbing temperature absorption dehumidifier absorption process absorption capacity absorption experiment absorption probability absorption wavemeter close v bar v stop valve equispaced pulses range correction range discriminator metric position finder distance sensor descending disconnecting lever for mechanism adjusting device adjust v align v tune v trim v tuning control regulation scale tuning scale tuning dial tuning board setting abstract theory of automata abstract computer abstract theory of automata abstract connection abstract number abstract automaton abstract design abstract code pseudo‐code abstract value abstract model abstract type concept abstraction balayage scanning exploration abscissa of absolute convergence abscisse axis X‐axis sample sampling scanner scanning unit sampler balayage scanning exploration scanning laser radar stran 5 od 326 EN ‐DE: slovar avtomatizacije in robotike Abtaster Abtaster Abtaster Abtastgeschwindigkeit Abtastgeschwindigkeit Abtastgeschwindigkeit durch Sensoren Abtastglied Abtastglied Abtastglied Abtastglied Abtastglied Abtasthalteglied Abtastimpuls Abtastintervall Abtastkreis Abtastoszillograf Abtastperiode Abtastphase Abtastpunkt Abtastrate Abtastregelsystem Abtastregelung Abtastregelung Abtastregelung Abtastregelung Abtaströntgenstrahlmikroanalysator Abtastsensor Abtastservosystem Abtastsignaleingang Abtastspannung Abtastspektrometer Abtaststromkreis Abtastsystem Abtastsystem mit stochastischen Eingaben Abtastung Abtastung Abtastung mit hoher Geschwindigkeit Abtastung mit konstanter Geschwindigkeit Abtastverfahren Abtastvorgang Abtastwerte Abtastzeit Abtastzeit Abtastzeit Abtastzeitintervall Abtastzyklus Abtrennanzeige Abtrennung (durch Roboter) abweichen abweichende Grunddatei Abweichung Abweichung Abweichung des Greifzentrums Abweichung vom Sollwert Abweichung vom Sollwert Abweichungsamplitude Abweichungsanzeiger Abweichungsfläche Abweichungsgröße Abweichungsmesser Abweichungsverhältnis Abweichungsverhältnis Abweichungsverhältnis bei Manipulation von Teilen Abweichungsverhältnis bei Simultanbewegungen abzählbare Menge abzählbare Menge Abzweigen Abzweigen (Bewegen eines HHO) Achsantrieb eines Industrieroboters Achsenbezeichnung Achseneinstellung Achsenposition Achsenregelung achsensymmetrisch Achsgeschwindigkeit Achskombinationen eines Industrieroboters sampler scanner scanning unit sampling rate scanning speed scanning speed by sensors detector element sampler sensing element sensor detector sample‐and‐hold element reading pulse sampling interval sampling circuit sampling oscillograph sampling period sweep phase action spot sampling rate sampled‐data control system sampled‐data control sampled‐data control system sampling control scanning control scanning X‐ray microanalyzer scanning sensor sampling servosystem scanning signal input scanning voltage scanning spectrometer scanning circuit scanning system random input sampled‐data system sampling sampling [action] high‐velocity scanning constant‐speed scanning scanning technique scanning action sampled data sampling period sampling time scanning time sampling period scanning cycle disconnect indication dissociation (by robot) offset v different basic file offset drift deviation of gripping centre deviation from nominal (ordered) value deviation from nominal value deviation amplitude deviation indicator deviation area deviation value deviometer deviation ratio offset ratio deviation ratio at manipulation of parts deviation ratio at simultaneous movements countable set enumerable set branching branching (movement of handling object) axis drive of industrial robot, robot axis drive marking of axis axial adjustment axis position axial adjustment axisymmetric axle speed robot axis combinations, axis combinations of industrial robot stran 6 od 326 EN ‐DE: slovar avtomatizacije in robotike Achsregelung Achsregelungsstruktur Achswirkungslinie Achterkreis Achterkreis Achterstromkreis double Achterstromkreis double Adapter Adapter für asynchrone Datenübertragung Adapter für asynchrone Datenübertragung Adapter für asynchrone Datenübertragung Adapter für Fernabfrageeinheit distance Adapter für gepufferte Übertragung Adapter für gepufferte Übertragung Adapter für Thermoelemente Adapter für Widerstandsgeber adaptive differentielle Pulskodemodulation adaptive differentielle Pulskodemodulation adaptive digitale Schaltung adaptive Handhabung adaptive Maschine adaptive Optimalfilterung adaptive Optimierung adaptive Regelung adaptive Regelung adaptive Robotersteuerung adaptive Schwellwertelemente adaptive Sensorführung adaptive sensorgeführtes System adaptive Steuerung adaptive Steuerungsoptimierung adaptive Steuerungsoptimierung adaptive Vorverzerrung adaptiver Ausgleich adaptiver Ausgleich adaptiver Greifkopf adaptiver Leitweg adaptiver lernender Regler adaptiver Prozess adaptiver Roboter adaptiver robotertechnischer Komplex adaptiver Schweißroboter adaptiver sensorgeführter Roboter adaptiver Steuerprozess adaptiver Umformer des lernenden Systems adaptiver Zeichenleser adaptives digitales Element adaptives digitales Element adaptives digitales Netzwerk adaptives Glied adaptives Lernsystem adaptives Modell adaptives Regelsystem adaptives Regelsystem adaptives Regelungssystem adaptives Regelungssystem adaptives Robotersystem adaptives sensorgeführtes System adaptives System adaptives System adaptives Verhalten adaptives Verhalten von Handhabungssystemen adaptives Verhalten von Handhabungssystemen Adder Adder Adder Addierkreis löherer Ordnung Addierstufe Addierwerk Addierwerk Addierwerk Additionsbefehl Additionsgatter Additionsimpuls Additionsstelle Additionsstelle axis regulation axis regulation structure action line of axis double phantom circuit superphantom circuit double phantom circuit superphantom circuit adapter asynchronous communications interface adapter, AC1A asynchronous communications interface adapter ACIA remote inquiry unit adapter buffered communication adapter buffered communication adapter, BCA thermocouples adapter resistance transmitters adapter adaptive differential pulse code modulation ADPCM adaptive digital network adaptive manipulation adapting machine adaptive optimum filtration adaptive control optimization actuator adaptive control system adaptive control system adaptive robot control adaptive threshold elements adaptive sensor guide adaptive sensor‐guided system adaptive control adaptive control optimization adaptive control optimization, ACO adaptive predistortion adaptive equalization adaptive equalization, AEQ adaptive grip head adaptive routing adaptive learning controller adaptive process adaptive robot adaptive robot‐technical complex adaptive welding robot adaptive sensor‐guided robot adaptive control process adaptive converter of learning system adaptive character reader adaptive digital element adaptive digital element, AD‐DIE adaptive digital network adaptive element adaptive learning system adaptive model adaptive control system self‐adjusting system actuator adaptive control system adaptive control system adaptive robot system adaptive sensor‐guided system adaptable system adaptive system adaptive behavior adaptive behavior of manipulation systems adaptive behaviour of manipulation systems adder adding element summator high‐order add circuit addition cascade adder adding element summator add instruction add gate add impulse adder stage adder stran 7 od 326 EN ‐DE: slovar avtomatizacije in robotike Additionsstelle Additionsstelle Additionsstelle Additionstheorem Additionstor Additionsübertrag Additionszeit additive Größe additive Gruppe additive Inverse additive Mischstufe additive Mischung additive Wirkung Additivitätseigenschaft Additivkreis Additivverfahren Adhäsionsbeiwert adiabatische Äquivalenztemperatur adiabatischer Prozess adiabatischer Sättigungsprozess adiabatisches Verfahren adjungiert adjungierte Matrix adjungierte Rechentechnik adjungiertes System adjungiertes System Adjustierung Adjustierung Admittanz Adress[ier]leitung Adressauswertung Adressbereich Adressbuchstabe eines IR‐Programms Adreßbus eines Rechners Adresse Adresse eines Mikroprogrammspeichers Adressenabtastimpuls Adressenabtastimpuls Adressenabtastimpuls Adressenänderung Adressenausdruck Adressenberechnung Adressenberechnung Adressenbildung Adressenbildung Adressenfeld Adressenformat Adressenhauptlinie Adresseninkrementregister Adressenkode Adressenkode Adressenkonstante Adressenlöser Adressenrechenwerk Adressenrechenwerk Adressenrechnung Adressenrechnung Adressenregister Adressenregister Adressenregister Adressensprache Adressensubstitution Adressenteil im Befehlswort Adressenteil im Befehlswort Adressenwahlschalter Adressenzahl Adresserzeugung adressierbarer Speicher adressierbarer Speicher adressierbarer Steuerungsbaustein adressierbarer Zwischenspeicher adressierbares Auffangregister Adressiermaschine Adressiersystem adressierte Einrichtung adressierter DAM‐Baustein adding element counting stage summator addition theorem add gate add carry add time additive quantity additive group additive inverse additive circuit additive mixing additive action additivity property additive circuit additive process adhesion coefficient adiabatic equivalent temperature adiabatic process adiabatic saturation process adiabatic process adjoint adjoint matrix adjoint computing technique ad joint system adjoint system adjustment adjusting admittance address line address evaluation address range address letter of IR‐program computer address bus address microprogram memory (store) address address data strobe, ADS, address reading pulse address data strobe address reading pulse address modification address expression address calculation address computation address calculation address computation address array address format, AFR address main line index register address code address part address constant, ADCON address decoder address arithmetic[al] element address arithmetical element address calculation address computation address register base register index accumulator address language address substitution address code address part address selection switch address number address generation addressable memory addressable store addressable control module addressable latch addressable latch addressing machine addressing system addressed device addressed DAM‐element stran 8 od 326 EN ‐DE: slovar avtomatizacije in robotike Adressierungskonzeption Adressierungsvermögen Adressrechner Adresssignalverzögerungszeit Adressverzögerungszeit Adsorptionserscheinung Adsorptionsmessung Adsorptionsprozess Adsorptionstrocknungsanlage Adsorptionsverfahren Adsorptionsvorgang Adsorptionswirkungsgrad aerodynamische Eigenschaften Aggregation Aggregationsoperator Aggregationsoperator ähnliche Transformation Ähnlichkeit Ähnlichkeit Ähnlichkeit Ähnlichkeitsbedingungen Ähnlichkeitsbedingungen Ähnlichkeitsregel Ähnlichkeitstheorie Ähnlichkeitstransformation Aiken‐Kode Aitkensche Interpolationsmethode Akkumulation Akkumulationskoeffizient Akkumulatorregister akkumulieren akkumulierter Fehler akkumulierter Fehler Akteur Aktinograf Aktinometer Aktion Aktionsakzeptor Aktionsfeld Aktionspotential Aktionssystem Aktionszentrum aktiv gekoppelt Aktivator aktive Datei aktive Druckrückführung aktive Führung aktive Führung aktive Kontrolle aktive Ziellenkung aktive Ziellenkung aktiver Datensatz aktiver Fügemechanismus aktiver Fügemechanismus in aktiver Laserkursverfolger aktiver Prozess aktiver Satellit aktiver Sensor aktiver Stromkreis aktiver Teilnehmer aktiver Wandler aktiver Wandlern? aktiver Wellenleiter aktives Ausgabegerät aktives Eingabegerät aktives Element aktives Filter aktives Glied aktives Kreuzgelenk aktives Laserkursfolgesystem aktives Lasermedium aktives Magazin aktives optisches Element aktives Robotergelenk aktives System aktives Ultrarotstrahlenerfassungssystem addressing concept address capability address computer address delay time address delay time adsorption phenomenon adsorption measurement adsorption process adsorption dehumidification system adsorption process adsorption phenomenon adsorption efficiency aerodynamic properties aggregation aggregation operator aggregator similarity transformation conformity similitude similarity similarity conditions similitude conditions law of similarity law of similarity similarity transformation Aiken code Aitken's interpolation method accumulation accumulation coefficient accumulator register accumulate v accumulated error stored error joint, acting element actinograph actinometer action action acceptor action field action potential action system action centre actively coupled activator active file active pressure feedback active guidance active homing active check active guidance active homing active data record active joint mechanism active joint mechanism active laser tracking system awake process active satellite active sensor active circuit active abonent active transducer active transducer active waveguide active output device active input device active element active filter active element active swivel joint active laser tracking system [active] laser medium active magazine active optical component active robot joint active system active infrared detection system stran 9 od 326 EN ‐DE: slovar avtomatizacije in robotike aktivieren Aktivierung Aktivierungsanalyse Aktivierungsausbeute Aktivierungsdetektor Aktivierungsenergie Aktivierungsgeschwindigkeit Aktivierungsintegral Aktivierungsmechanismus Aktivierungswärme Aktivitätsabfall Aktivitätsanalyse Aktivitätseinheit Aktivitätskoeffizient Aktivitätskurve Aktivitätsmessung Aktivitätsniveau Aktivitätsniveau Aktivitätsniveau Aktivitätspegel Aktivitätspegel Aktivitätspegel Aktivitätsverteilung Aktivsender Aktivspeicher Aktivwandler Aktorik Aktualparameter aktuelle Effektorposition aktuelle Gelenkwinkel von Roboterkoordinaten aktuelle Robotergerätedaten pl aktueller Manipulatorzustand aktueller Orientierungsvektor aktueller Parameter aktueller Parameterbereich aktueller Parameterbereich aktueller Roboter aktueller Roboterzustand aktueller Systemzustand aktuelles Robotermodell aktuelles Roboterprogramm akustische Brücke akustische Eichvorrichtung akustische Größe akustische Kommunikation akustische Programmierung akustische Rückkopplung akustische Signalerfassung akustische Übertragung akustische Verzögerungsleitung akustische Verzögerungsleitung akustische Verzögerungsstrecke akustische Verzögerungsstrecke akustische Vibrationen akustische Warnanlage akustische Warnvorrichtung akustischer Ablenkkreis akustischer Aufnehmer akustischer Höhenmesser akustischer Höhenmesser akustischer Kanal akustischer Koppler akustischer Laufzeitspeicher akustischer Sensor akustischer Sensor (Aufnehmer) akustischer Speicher akustischer Speicher akustischer Speicher akustisches Bild akustisches Echolot akustisches Erkennungssystem akustisches Erkennungssystem akustisches Interferometer akustisches Programmieren akustisches Radiometer akustisches Rechnersignal activate v activation activation analysis activation yield activation detector activation energy activation speed activation integral activation machanism activation heat activity decay activity analysis activity unit activity coefficient activity curve activity measurement activity level level of activity level of process activity level level of activity level of process activity distribution active transducer active store active transducer actorics actual parameter actual effector position actual joint angles of robot coordinates actual robot device data actual manipulator state actual orientation vector actual parameter actual parameter area actual parameter area, APT actual robot actual robot state actual system state actual robot model actual robot program acoustic bridge acoustic calibrator acoustic quantity acoustic communications acoustic programming acoustic feedback acoustic signal acquisition acoustic transmission acoustic delay line sonic delay line acoustic delay line sonic delay line sonic vibrations aural warning device aural warning device acoustic deflection circuit acoustic sensor acoustic altimeter echo altimeter acoustical channel acoustic coupler, ACU acoustic delay line memory acoustic sensor acoustic sensor acoustic memory acoustic storage acoustic store acoustic image acoustic altimeter acoustic identification system acoustic indentifaction system acoustical interferometer acoustic programming acoustic radiometer acoustic computer signal stran 10 od 326 EN ‐DE: slovar avtomatizacije in robotike akustisches Relais acoustic relay akustisches Signal acoustic signal acoustic overload signal akustisches Überlastsignal akustisch‐phonetische Verarbeitung acoustic‐phonetic processing Akustooptik acoustooptics akustooptisch acoustooptic[al] akustooptische Signalverarbeitung acoustooptic signal processing akustooptische Wechselwirkung acoustooptic interaction akustooptischer Effekt acoustooptic effect akustooptischer Modulator acoustooptical modulation device akustooptischer Modulator acoustooptical modulator akustooptisches Ablenkungsgerät acoustooptical deflection device akustooptisches System acoustooptic system akzeptabel acceptable acceptable design akzeptabler Entwurf Akzeptanzdiagramm acceptance pattern Akzeptanzwinkel acceptance angle acceptable limit akzeptierbarer Grenzwert Akzeptierbarkeitskriterium acceptability criterion akzeptieren accept v Akzeptor acceptor Akzeptor betriebsbereit acceptor operable, AO Akzeptorendichte acceptor density Akzeptorfehler acceptor error, AE Akzeptorniveau acceptor level Alarmanlage alarm circuit Alarmanlage alarm set Alarmeinrichtung alarm annunciator Alarmgerät alarm device Alarmkontakt alarm contact Alarmprogramm alarm program Alarmrelais alarm relay Alarmzustand alert condition Algebra der Logik algebra of logic Algebra der Logik Boolean algebra algebraische Addiereinrichtung algebraic adder algebraische Auswahlmethode algebraic selection method algebraische Automatentheorie algebraic automaton theory algebraische Funktion algebraic function algebraische Gleichung höheren Grades algebraic equation of higer degree algebraische Struktur algebraic structure algebraic sum algebraische Summe algebraische Summe der Impulse algebraic sum of impulses algebraischer Addierer algebraic adder algebraischer fehlerkorrigierender Kode algebraic error‐correcting code algebraisches Komplement algebraic complement algebraic product algebraisches Produkt algebraisches Stabilitätskriterium algebraic stability criterion Algorithmentheorie algorithm theory algorithmisch algorithmic algorithmische Ausarbeitung algorithmic elaboration algorithmische Betätigung algorithmic manipulation algorithmische Minimisierung algorithmic minimizing algorithmische Minimisierung algorithmisch orientierte Spracalgorithmic minimizing algorithmische prozedurale Sprache algorithmic procedural language, APL algorithmische Sprache algorithmic language algorithmische Unlösbarkeit algorithm insolubility algorithmisches System algorithmic system Algorithmus algorithm Algorithmus für arithmetische Operation algorithm for arithmetic operation Algorithmus für die Inversion algorithm for the inversion Algorithmus für Division algorithm for division Algorithmus für Division division algorithm Algorithmus für quadratische Interpolation algorithm for quadratic interpolation Allbetriebregler multiples Analogrechner all‐purpose controller Allbetriebregler multiples Analogrechner all‐regime controller exclusive access alleiniger Zugriff allgemeine Anwendung in der Automatisierung general application in automation allgemeine Lösung general solution allgemeine Prozesstheorie overall process theory allgemeine Reaktorgleichung general reactor equation allgemeines Diagramm general chart allgemeines Maschinenprogramm general machine program allgemeines Programm general routine allgemeines Programm general program allgemeines Rücksetzsignal master reset signal stran 11 od 326 EN ‐DE: slovar avtomatizacije in robotike allgemeines Überwachungsprogramm Allpassfilter Allpassfilter Allpassglied Allpassglied Alltypsensorsteuerung Allzweckmesser Allzweckmesser Allzweckrechner Allzweckregler Allzweckregler Alphabet alphabetische Information alphabetischer Kode alphabetisches Kundeninformationssystem alphabetisches Zeichen alphanumerisch alphanumerisch kodierte geometrische Information alphanumerische Anzeigeeinheit alphanumerische Ausgabe alphanumerische Darstellung alphanumerische Daten pl alphanumerische Tastatur alphanumerischer Leser alphanumerischer Speicher alphanumerisches Kodieren alphanumerisches Sichtanzeigegerät alphanumerisches Verschlüsseln alphanumerisches Zeichen AL‐Programmiersystem alternativ Alternativadresse Alternative alternative Manipulatoranordnung alternative Maschinenanordnung alternative Maschinenordnung alternative Montagelösung alternative Montageoperation alternative Roboteranordnung alternativer Teilebaum alternativer Übertragungsweg alternativer Übertragungsweg alternativer Werkstücktransportweg Alternativkanal Alternativverzweigung alternierende Reihen alternierendes Verhalten AL‐Typendeklaration ALU ALU ALU‐Betriebsart ALU‐Funktionswahl AL‐Verzweigung amerikanische Norm amerikanischer Standard amerikanischer Standardkode für Informationsaustausch amerikanischer Standardkode für Informationsaustausch Amortisationszeit (bei Roboteranwendung) ampassungsfähige Rechnerstruktur Amphibienroboter Amplidyne Amplidynservosystem Amplistatverstärker Amplitude Amplitude am Ausgang Amplitude der effektiven Erregerstromdichte Amplitudenanalysator Amplitudenanalysator‐Baugruppe Amplitudenanalysator‐Baugruppe Amplitudenanalyse Amplitudenanalyse Amplitudenbedingung Amplitudenbegrenzer Amplitudenbegrenzer amplitudenbegrenzter Ausgang amplitudenbegrenzter Eingang general monitor checking routine all‐pass filter all‐pass element all‐pass filter all‐pass element all‐type sensor control all‐purpose meter multimeter general‐purpose computer all‐purpose controller all‐regime controller alphabet alphabetic information alphabetic code alphabetic customer's information system alphabetic character alphanumeric alphanumeric‐coded geometric information alphanumeric indicating unit alphanumeric output alphanumeric representation alphanumeric data alphanumeric keyboard alphanumeric reader alphanumeric store alphameric coding, alphanumeric coding alphanumeric display alphameric coding, alphanumeric coding alphanumeric character AL programming system alternative adj alternative address alternative alternative manipulator arrangement alternative machine arrangement alternative machine order alternative assembly solution alternative assembly operation alternative robot arrangement alternative piece tree alternate route alternate route, ARU alternating contact alternative transport route alternative channel alternative branching alternating series alternating behaviour AL type declaration arithmetic‐logic unit ALU operation mode of arithmetic‐logic unit, ALU‐mode of operatio ALU‐function selection, function selection of arithmetic‐logic u AL branching American standard American standard American standard code of information interchange ASCII amortization time (at robot application) adaptive architecture amphibian robot amplidyne amplidyne servosystem amplistat amplitude output amplitude effective driving‐current density amplitude amplitude analyzer amplitude analyzing assembly pulse height analizing assembly amplitude analysis pulse amplitude analyzing root‐locus amplitude (magnitude) condition peak limiter clipper circuit bounded output bounded input stran 12 od 326 EN ‐DE: slovar avtomatizacije in robotike Amplitudenbegrenzung Amplitudencharakteristik Amplitudencharakteristik Amplitudendichte‐Spektrum Amplitudendiskriminator Amplitudeneinstellung Amplitudenfaktor Amplitudenfehler Amplitudenfernmesssystem Amplitudenfrequenzentzerrung Amplitudenfrequenzspektrum Amplitudengang Amplitudengang Amplitudengang Amplitudengeräuschbegrenzer Amplitudenkennlinie Amplitudenkennlinie Amplitudenkennlinie Amplitudenlinearität Amplitudenmodulation amplitudenmodulierte Schwingungen amplitudenmodulierter Geber amplitudenmodulierter Impuls amplitudenmodulierter Sender amplitudenmodulierter Signalverfolger amplitudenmodulierter Träger Amplitudenniveau Amplitudennormierungsfaktor Amplituden‐Phasen‐Charakteristik transfert Amplitudenrand Amplitudenreserve Amplitudenreserve Amplitudenresonanz Amplitudenschnittfrequenz Amplitudenschwankung Amplitudenskalierungsfaktor Amplitudenspektrum amplitudenstabilisierter Laser Amplitudenvektor Amplitudenverteilung Amplitudenverzerrung Amplitudenverzerrung Amplitudenverzerrung Amplitudenverzögerung Amplitudenwähler Analog analog arbeitender Sensor analog arbeitender Sensor Analog‐ Digital‐Umsetzer analogarbeitender Prozessrechner Analogausgabebasis Analogdarstellung Analogdaten pl analog‐digitale Simulation analog‐digitale Simulation Analog‐Digital‐Konverter Analog‐Digital‐Schleife Analog‐Digital‐Schleife Analog‐Digital‐Technik Analog‐Digital‐Umwandlung Analog‐Digital‐Wandler Analog‐Digital‐Wandler analoge Ausgabe analoge Darstellung analoge Darstellung analoge Eingabe analoge Gerätetechnik analoge Größe analoge mathematische Simulation analoge Messung analoge Punkt‐Punkt‐Steuerung analoge Punkt‐Punkt‐Steuerung analoge Rechentechnik analoge Rechnereingabe analoge Rechnereingabe analoge Schaltung amplitude limitation amplitude characteristic amplitude response amplitude‐density spectrum amplitude discriminator amplitude adjustment amplitude factor amplitude error amplitude telemetering system amplitude‐frequency correction amplitude‐frequency spectrum amplitude response magnitude plot Bode diagram amplitude noise limiter amplitude locus amplitude characteristic amplitude response linearity in amplitude amplitude modulation amplitude‐modulated oscillations amplitude‐modulated transmitter amplitude‐modulated pulse amplitude‐modulated transmitter amplitude‐modulated signal tracer amplitude‐modulated carrier amplitude level amplitude scale factor gain‐phase characteristic amplitude margin gain margin amplitude margin amplitude resonance gain cross‐over frequency fluctuation of amplitude amplitude scale factor amplitude spectrum amplitude‐stabilized laser amplitude vector amplitude distribution amplitude distortion harmonic distortion waveform distortion amplitude delay amplitude selector analog[ue] analog‐active sensor analogue‐active sensor analog‐digital converter analog process computer analogue output basis analog display analog data analog‐digital simulation analognumerical simulation analog‐digital converter analog‐digital loop analogue‐digital loop analog‐digital technique analog‐digital conversion analog‐to‐digital converter analog‐digital converter analog output analog display analog representation analog input actual hardware system simulation analogue quantity analog mathematical simulation analog measurement analog point‐to‐point control analogue point‐to‐point control analog computing technique computer analog input computer analogue input, CAI analog circuit stran 13 od 326 EN ‐DE: slovar avtomatizacije in robotike analoge Verarbeitungseinheit analoge Verarbeitungseinheit Analogeingabepunkt Analogeinheit Analogeinrichtung mit leitendem Medium Analogelement Analogelement analoger Detektor analoger Eingabe‐Abtaster analoger Eingabe‐Abtaster analoger Kode analoger Prozessor analoger Prozessor analoger Prozessrechner analoger Regler analoger Regler analoger Schalter analoger Schatter analoges Eingabeabtastglied analoges Eingabeabtastglied analoges Extremalsystem analoges Modell analoges Signal analoges Signal für Robotersteuerung Analoggröße Analogie Analogieinterpolation Analogierechenmaschine Analogiestudie analogische Größe Analogkanal Analogkanal Analogkomparator Analogkorrektur Analogmodell Analogmodulation analognumerische Nachbildung analognumerische Nachbildung Analogrechentechnik Analogrechner‐Simulation Analogregelung Analogschalter Analogschalter Analogschaltung Analogschnittstelle Analogsteuerung Analogstromkreis Analogtechnik Analogübertragung Analogübertragung Analogumwandler Analogumwandler Analogvergleicher Analogverstärker Analysator für integrierte Schaltungen Analyse Analyse der Teilepassungen Analyse der Teilepassungen Analyse eines digitalen Systems mit einem Rechner Analyse fvon Maschinendefekten Analyse geometrischer Objekte Analyse instationärer Vorgänge Analyse von Manipulatordefekten Analyse von Maschinendefekten Analyse von Regelungs‐ und Steuerungssystemen Analyse von Roboterdefekten Analysengerät Analysengerät analysieren analysieren analytisch analytisch analytische Beziehung analytische Datenreflexion analytische Funktion analytische Methode analog processing unit analogue processing unit analogue input point analog unit conductive medium of analog device analog element analogue element analog detector analog input scanner analogue input scanner, AIS analog code analog processor analogue processor analog process computer analog controller analog regulator analog switch analogue switch analog input scanner analogue input scanner, AIS analog extremal system analog model analog signal analogue signal for robot control analog quantity analogy analog interpolation [electronic] analog computer analog study analog quantity analog channel analogue channel analog comparator analog correction analog model analog modulation analog‐digital simulation analognumerical simulation analog computing technique analog computer simulation analog control analog switch analogue switch analog circuitry analog interface analog control circuit analog actual hardware system simulation analog transmission analogue transmission, ATR analog converter analogue converter analog comparator analog amplifier integrated circuit analyzer analysis piece fit analysis piece adjusting analysis computer‐aided digital system analysis machine defect analysis analysis of geometric objects transient response analysis manipulator defect analysis machine defect analysis analysis of control system robot defect analysis analyser analyzer analyse v analyze v analytic[al] regular analytic relationship analytical data reflection analytical function analytic method stran 14 od 326 EN ‐DE: slovar avtomatizacije in robotike analytische Regelung analytische Simulation analytische Steuerung analytische Struktur analytische Untersuchungsmethode analytischer Ausdruck analytischer Entwurf analytisches Hochfrequenzmessverfahren analytisches Verfahren anamorphotisches Abbildungssystem anbefohlener Übertrag ändern Änderung Änderung des Bauteilparameters Änderungsausfall Änderungsgeschwindigkeit Änderungshäufigkeit Anfahrbetrieb Anfahren und Speichern (IR‐Programmierverfahren) Anfahren von Regelkreisen Anfahrfilter Anfahrinstrumentierung Anfahrprüfung Anfahrrampe Anfahrtransiente Anfahrverhalten Anfangs Anfangsadresse Anfangsaufnahmefähigkeit Anfangsauswahlfolge Anfangsautomat Anfangsbedingungen Anfangsbedingungen Anfangsbedingungen ungleich Null Anfangsdaten pl Anfangseinstellung Anfangsgeschwindigkeit Anfangsgeschwindigkeit Anfangspunkt (einer Greiferbahn) Anfangsstabilität Anfangsstörung Anfangssuszeptibilität Anfangstestprogramm Anfangswert Anfangswert Anfangswerte Anfangswerte Anfangswertproblem Anfangswertsatz Anfangszustand Anfärbbarkeit anfordern Anforderung an die Roboterprogrammierung Anforderungsblock für geladene Programme Anforderungsblock für Unterbrechungs[sbehandlung] Anforderungssignal Anfrage anfragen Anfragezeichnung Angabe im Programmtext angelegte Spannung angelegtes Signal angenäherte Bestimmung der Überregelung angenäherte Lösung angenommen angenommen angepasste Belastung angepasste Impedanz angepasste Konstruktion angepasste Rechnerkonfiguration angepasster Fasersensor angepasstes Greifersystem angepasstes Verhalten (eines IR) angeregtes Niveau angeschlossene Einheit angeschlossene Einheit analytical control analytic simulation analytical control analytical structure analytical research method analytic expression analytical design high‐frequency analytical measuring method analytic method anamorphotic image system instructed carry change v unable to learn (ro move, to change, … etc.) component parameter variation progressive failure rate of change modification frequency start‐up operation starting and storage starting of regulating circuits start‐up filter start‐up instrumentation start‐up test start‐up ramp start‐up transient start‐up behaviour initial initial address initial susceptibility initial selection sequence initial automaton initial conditions starting conditions non‐zero conditions initial data initial adjustment initial rate initial speed initial point initial stability initial displacement initial susceptibility initial test routine initial value start value initial conditions starting conditions initial‐value problem initial‐value theorem initial state Colourability, US: colorability request v requisition of robot programming loaded request block (of programs) interruption request block request signal inquiry request v enquire drawing program text specification applied voltage applied signal approximative determination of the overshooting approximate solution accepted accepted, ACC matched load matched impedance adapted design adapted computer configuration adaptive fibre sensor adapted gripper system adaptive behavior excitation level online equipment online unit stran 15 od 326 EN ‐DE: slovar avtomatizacije in robotike angeschlossene Registrieranlage angeschlossener Automat angeschlossener Prozessor angeschlossenes Gerät angeschlossenes Gerät angeschlossenes Prozessorsystem angewandte Schaltungssynthese angezeigter Roboterfehler angezeigter Winkel Anhalten am Ende der Reihe Anhalten bei Ende des Satzes anharmonisches Verhältnis ??? Anhäufung anheben anisochrone Verbindung anisochrone Verbindung Anlage Anlage Anlage Anlagenausfall Anlagenauslegung Anlagenleistung Anlagensicherheit Anlagensteuerung Anlagenstruktur Anlagensystem anlagentechnischer Entwurf Anlagenüberwachung Anlagenvorbereitung Anlauf‐ und Bremskurve Anlaufkonstante Anlaufkontrolle Anlaufregler Anlaufzeit Anlaufzeit Anlaufzeit Anlaufzeitbegrenzerrelais anlegen anlegen Annäherung Annäherung Annäherungsfühler Annäherungsgeschwindigkeit Annäherungslösung Annäherungsstufe Annäherungsverzögerung Annäherungswert Annäherungswert Annahme Annahme der Anforderung Annahme der Anforderung Annahmeprüfeinrichtung Annahmeprüfeinrichtung Annahmesteuerung Annahmesteuerung annehmbar annehmbare Qualitätsstufe annehmbare Qualitätsstufe annehmbare Station annehmbare Station annehmbare Zuverlässigkeitsstufe annehmbare Zuverlässigkeitsstufe annehmbare Zuverlässigkeitsstufe annehmbares Programm annehmen Anodenbelastung Anodendetektor Anodenkorrektion anomal anomale Ausbreitung anordnen Anordnung Anordnung des Speichersystems Anordnung des Speichersystems Anordnung eines Industrieroboters Anordnungsplanung connected recording equipment connected automaton attached processor, AP online equipment online unit attached processor system applied circuit synthesis indicated robot error indicated angle stop at end of sequence stop at end of sequence anharmonic relation disturbance storage bootstrap v asynchronous connection anisochronous connection equipment installation fitting out machine failure plant design system capacity plant safety plant control plant structure equipment system plant design plant control plant preparation starting and breaking curve acceleration constant start‐up control acceleration controller build[ing]‐up time transient period rise time overall starting‐time relay design v construct v approximation approach approximate sensitive element approach speed approximate solution degree of approximation retardation of approximation approximate quantity approximate value acceptance accept of request accept of request, ARQ acceptance checkout equipment acceptance checkout equipment, ACE acceptor control acceptor control, AC acceptable acceptable quality level acceptable quality level, AQL accepting station accepting station, AS acceptance reliability level, ARL, acceptable reliability level acceptable reliability level acceptance reliability level acceptable program accept v anode load anode bend detector anode correction anomalous anomalous propagation order v layout arrangement of the memory system store system arrangement robot arrangement, industrial robot arrangement arrangement planning stran 16 od 326 EN ‐DE: slovar avtomatizacije in robotike Anordnungsprinzip arrangement principle Anordnungsvariante arrangement variant anormales Ende der Aufgabe abnormal end of task, ABEND anpassbare Montagebedingung adaptable assembly condition anpassbare Robotersteuerung adaptable robot control anpassbares Datenbanksystem adaptable data bank system anpassbares Manipulatorobjekt (Objekt) adaptable [manipulator] object anpassen match v Anpassung adaptation Anpassung adapting Anpassung matching Anpassung der Greiferstruktur adaptation of gripper structure Anpassung der Robotermechanik adaptation of robot mechanics Anpassung eines Greifers gripper adaptation Anpassung eines Roboterprogramms matching of robot program Anpassung feines Manipulators adaptation of manipulator Anpassungsbedingung matching condition adapter Anpassungseinheit matching device Anpassungseintrichtung matching equipment Anpassungseintrichtung adaptive logic anpassungsfähige Logik anpassungsfähiger Effektor adaptable effector anpassungsfähiger Roboter adaptable robot anpassungsfähiger Robotereffektor adaptable robot effector anpassungsfähiger Sensor adaptable sensor anpassungsfähiges (anpassbares) programmierbares Montageadaptable programmable assembly system anpassungsfähiges Anlagensystem adaptable system of equipment anpassungsfähiges Fingersystem versatile finger system anpassungsfähiges integriertes Werkzeugsystem flexible integrated tool system anpassungsfähiges programmierbares Montagesystem adaptable programmable assembly system anpassungsfähiges Regelungssystem adaptive control system anpassungsfähiges System adaptable system anpassungsfähiges System adaptive system adaptability Anpassungsfähigkeit compatibility Anpassungsfähigkeit Anpassungsfehler matching error Anpassungsmechanismus adaptation mechanism Anpassungsparameter adaptation parameter Anpassungsregelung adaptive regulation, adaptive control Anpassungswiderstand matching impedance rise time Anregelzeit anregen activate v Anregung activation Anregungsbedingung excitation condition Anregungsfunktion excitation function Anregungsgröße forward signal Anregungskurve excitation curve Anregungsniveau excitation level Anreizung activation Anrufrelais calling relay Anrufrelais line relay Anrufrelais ringing relay Anschauungsmodell demonstration model Anschlageinstellung positioning of stop Anschlaglinie line of stop anschließen associate v anschließen connect to anschließen join v Anschlussbild interface Anschlusskanal interface channel Anschlussklemme terminal connection head Anschlusskopf Anschlussmultiplexer terminal multiplexer connection point Anschlusspunkt point of connection Anschlusspunkt interface circuit Anschlussschaltung Anschlussstandard interface standard Anschlussstelle interface interface controller Anschlusssteuereinheit terminal pin Anschlussstift Anschlusstechnik interfacing technique Ansprechempfindlichkeit operating threshold sensibility Ansprechgrenze response limit Ansprechmoment pull‐up torque Ansprechschwelle operation threshold Ansprechschwelle response threshold stran 17 od 326 EN ‐DE: slovar avtomatizacije in robotike Ansprechsicherheitsfaktor Ansprechspannung Ansprechspannung Ansprechspannung des Leistungsrichtungsrelais Ansprechvermögen Ansprechvermögen Ansprechwahrscheinlichkeit Ansprechwert Ansprechzeit Ansprechzeit Ansprechzeitfehler Ansprechzeitkonstante anstehende Unterbrechungsanforderung anstehender Interrupt Ansteuerschaltung Anstieggeschwindigkeit Anstiegs Anstiegsantwort Anstiegsantwort Anstiegsantwort Anstiegsfunktion Anstiegsfunktion Anstiegszeit Anstiegszeit Anstiegszeit Anstiegszeit bei maximaler Amplitude Anstrichroboter Anstückelungsmethode Anteil der Handmontage anthropomorpher Manipulator Antikoinzidenzkreis Antikoinzidenzmethode Antikoinzidenzschaltung Antilogarithmus antiparallel Antiparallelschaltung Antiparallelschaltung Antiresonanz Antiresonanz Antivalenzglied Antizipationssignal Antrieb des Stellgliedes Antrieb eines Industrieroboters Antrieb eines Industrieroboters Antrieb eines Rundtisches Antriebsbaugruppe Antriebsbewegung Antriebscharakteristik Antriebsdaten pl eines Industrieroboters Antriebsdimensionierung Antriebsdrehbewegung Antriebsdrehwinkel Antriebselement Antriebselementedynamik Antriebsfunktion Antriebsgelenkzahl Antriebsgeschwindigkeit Antriebsgeschwindigkeitsverlauf Antriebsgestaltung Antriebsgetriebe Antriebsgetriebe Antriebsgliederzahl Antriebsgliederzahl Antriebsgliederzahl Antriebsimpuls Antriebsimpuls Antriebsimpuls Antriebskraft Antriebsmechanismus Antriebsmechanismus Antriebsmechanismus Antriebsmoment Antriebsmoment Antriebsmoment Antriebsmomenterzeugung Antriebsmotor safety factor for pick‐up response voltage threshold voltage operating voltage of power‐direction relay ability to respond response capacity detector efficiency responding value operating time response time response time error responsive time constant pending interrupt pending interrupt selection circuit rise speed tamp ramp‐forced response tamp response ramp function response ramp function tamp function build[ing]‐up time transient period rise time rise time et maximal amplitude painting robot method of solutions sewing hand assembly part anthropomorpheral manipulator anticoincidence circuit anticoincidence method anticoincidence circuit antilogarithm antiparallel antiparallel connexion inverse‐parallel antiresonance parallel phase resonance anticoincidence element anticipatory signal drive of regulated unit robot drive, industrial robot drive [industrial] robot drive circular table drive, rotary attachment feed gear drive assembly drive movement characteristic of drive drive data of robot, drive data of industrial robot drive dimensioning drive rotation movement drive rotation angle drive element drive element dynamics function of drive drive joint number drive speed course of drive speed drive design drive gear operating mechanism drive element number, element number of manipulator drive drive element number element number of manipulator drive actuating pulse control pulse driving pulse driving power actuator mechanism operating mechanism drive gear drive moment controlling torque driving torque generation of drive moment drive motor stran 18 od 326 EN ‐DE: slovar avtomatizacije in robotike Antriebsparameter Antriebsregler Antriebsschubbewegung Antriebsschubweg Antriebsstromkreis Antriebsstromkreis Antriebsstromkreis Antriebssystem antriebstechnische Baugruppe antriebstechnisches Bauelement Antriebsweg eines Greifers Antwort Antwort auf Rampenfunktion als Eingang Antwort auf Rampenfunktion als Eingang Antwortannahme Antwortannahme Antwortbake Antwortbetriebsart Antworteinheit Antwortfunktion Antwortfunktion der homogenen Zustandsgleichung Antwortfunktion der inhomogenen Zustandsgleichung Antwortimpuls Antwortschaltkreis Antwortsender Antwortsender mit Frequenzversetzung Anwahlautomatik Anwahlautomatik Anwahlautomatik Anwenderanpassung Anwenderelektronik Anwenderprogramm Anwenderprogrammabschnitt Anwenderprogrammiersystem Anwenderprogrammierung Anwenderprogrammparameter Anwenderprogrammstart Anwenderprogrammstopp Anwendung Anwendung Anwendung Anwendung in Netzen Anwendung syntaktischer Algorithmen Anwendungsbereich von Greifeinheiten Anwendungsfall Anwendungsgebiet Anwendungsgebiet Anwendungsgebiet für Effektoren Anwendungsgebiet für Effektoren Anwendungshilfen Anwendungslücke anwendungsorientiert Anwendungsproblem Anwendungsprogramm Anwendungssteuerung Anwendungssteuerung Anwendungsstudie Anwendungsweise Anwesenheit Anwesenheitszeichen Anzahl der Antriebsbewegungen Anzahl der Freiheitsgrade Anzahl der Freiheitsgrade (eines Greifers) Anzahl der Programmpositionen Anzahl der Speicherplätze Anzahl von Robotertypen Anzeige Anzeige feines Roboterfehlers Anzeige für die Nichtbestätigung Anzeige für die Nichtbestätigung Anzeige für die Nichtbestätigung Anzeigebereich Anzeigebereich Anzeigebetriebsarten Anzeigegerät Anzeigelampe parameter of drive drive regulator drive sliding movement drive sliding path control circuit steering circuit driving circuit drive system drive‐technical assembly drive‐technical component drive path of gripper response ramp‐forced response ramp function response accept of response accept of response, ARP, response acceptance responder response mode answer unit, AU response function zero‐input response zero‐state response replay pulse replay circuit responder frequency offset transponder automatic selectivity control automatic selection control automatic selective user matching user electronics user program application program division, APD, user program division, use user programming system user programming user program parameter user program start user program stop application use employment network application applying of syntactic algorithms application field of grip units case of application application field area of application effector field of use effector field of application application aids gap of application application‐oriented application problem application program application control application control, AC application study mode of application presence presence signal drive movement number number of degrees of freedom number of freedom degree program position number memory location number, store location number robot type number, type number of robot indication robot error indication, fault indication of robot acknowledge run flag, ARF, display for non‐validation acknowledged run flag display for non‐validation indicating range range of indication display modes indicating instrument check indicator stran 19 od 326 EN ‐DE: slovar avtomatizacije in robotike Anzeigelampe anzeigeloser Regler Anzeigemultiplexer anzeigender Regler anzeigender Selsyn anzeigendes und selbsttätig abgleichendes Potentiometer Anzeigeposition Anzeiger eines Rechners Anzeigerelais Anzeigerelais Anzeigerelais Anzeigestelle Anzeigesteuerung Anzeigetechnik Anzeigeverfahren Anzeigevorrichtung Anzeigevorrichtung anziehen Anziehen der Schraube aperiodisch aperiodisch aperiodisch aperiodisch gedämpft aperiodisch gedämpft aperiodisch gedämpftes Glied aperiodisch gedämpftes Instrument aperiodische Arbeitsweise aperiodische Bewegung aperiodische Bewegung aperiodische Dämpfung aperiodische Dämpfung aperiodische Dämpfung aperiodische Stabilität aperiodischer Betriebszustand aperiodischer Betriebszustand aperiodischer Frequenzteiler aperiodischer Grenzfall aperiodischer Grenzfall) aperiodischer Kreis aperiodischer Verstärker aperiodischer Vorgang aperiodisches Exponentialsignal aperiodisches Glied Apparatur Apparatur Apparatur Apparatur Apparatur Applikation Applikationder Sensortechnik Approximation Approximation im Frequenzbereich Approximation im Zeitbereich Approximation mit der Tschebyscheffschen Approximation von Exponentialfunktionen Approximation von Zeitfunktionen Approximationsfehler Approximationsgüte Approximationsmethode Approximationstheorie approximative Darstellung approximierte Berechnung approximierte Berechnung äquidistanter Kode Äquipotentiallinie äquivalente Admittanz äquivalente Admittanz äquivalente Belastung äquivalente Binärstellenzahlen äquivalente Einwirkung äquivalente Impedanz eines nichtlinearen Gliedes äquivalente Rauschleistung äquivalente Rauschleistung äquivalente Strukturwandlung Äquivalenteinwirkung äquivalenter Verstärkungskoeffizient m indicating lamp non‐indicating controller display multiplexor indicating controller indicating selsin indicating self‐balancing potentiometer display position computer indicator indicating relay indicator relay annunciator relay display position display control display technique display technique display device display unit absorb v tightening of screw aperiodic overdamped dead‐beat aperiodic damping overdamped aperiodic element aperiodic instrument aperiodic regime a periodic motion aperiodic motion a periodic damping, a periodic attenuation aperiodic attenuation aperiodic damping aperiodic stability a periodic regime (working condition) aperiodic regime aperiodic frequency divider critically damped, D = 1 critical damping aperiodic circuit aperiodic amplifier aperiodic phenomenon aperiodic exponential signal aperiodic link jig fixture appliance device facility application of sensor technique; application of sensor technique, application of sensorics approximation approximation in the frequency domain approximation in the time domain Chebyshev approximation approximation of exponential functions approximation of time functions error of approximation error of approximation approximation method approximation theory approximative representation (of a physical phenomenon) approximate calculation approximate computation equidistant code equipotential line describing function equivalent admittance equivalent load equivalent binary digits equivalent action equivalent impedance of a non‐linear element equivalent power of noise noise equivalent power equivalent structure transformation equivalent action describing function stran 20 od 326 EN ‐DE: slovar avtomatizacije in robotike äquivalenter Verstärkungskoeffizient m äquivalenter Zustand Äquivalenz logischer Schaltungen Äquivalenz von Algorithmen Äquivalenzrelation arbeiten arbeitender Sensor Arbeitsablauf Arbeitsablaufdiagramm Arbeitsablaufplan Arbeitsanpassung Arbeitsbahn eines Robotergreifers Arbeitsbedingungen einer Schalteinrichtung Arbeitsbefehl Arbeitsbefehl Arbeitsbereich Arbeitsbereich Arbeitscharakteristik Arbeitscharakteristik Arbeitsdruck Arbeitsdruck Arbeitsebene eines Manipulators Arbeitselemente Arbeitsfeld Arbeitsfeld Arbeitsgeschwindigkeit Arbeitsgeschwindigkeit Arbeitsgeschwindigkeit Arbeitsgeschwindigkeit Arbeitsgeschwindigkeit eines Systems Arbeitsintensität Arbeitskontakt Arbeitskontakt Arbeitskontakt Arbeitskontrolle Arbeitsmakro Arbeitsmaschine Arbeitsmittelmanipulator Arbeitsmittelstruktur eines IR Arbeitsorgan eines IR Arbeitsphase Arbeitsphase Arbeitsplatzanalyse Arbeitsplatzanordnung Arbeitsplatzposition Arbeitsposition (eines IR) Arbeitsprinzip Arbeitsproduktivitätssteigerung (durch Robotereinsatz) Arbeitsprogramm Arbeitsprozess Arbeitspunkt Arbeitspunkt Arbeitsraum Arbeitsraum (eines Manipulators) Arbeitsraum eines Roboters Arbeitsraumkoordinaten Arbeitsschwellwertempfindlichkeit Arbeitsseite feines IR Arbeitssicherheit Arbeitsspeicher Arbeitsstation Arbeitsstation Arbeitsstellung Arbeitsstellung Arbeitsstellung Arbeitsstromschaltung Arbeitstakt des Relaisgerätes relais Arbeitstemperatur Arbeitsverfahren‐ Kennlinie Arbeitsverfügbarkeit Arbeitsvermögen Arbeitsvorgangszeitmesser Arbeitsweise Arbeitswicklung Arbeitswinkel Arbeitszyklus equivalent admittance equivalent state logical circuits equivalence algorithm equivalence equality relation operate v active sensor operation procedure process chart plan of operation sequence working matching gripper working path [of robot] work conditions of switching device work instruction working command operating range working range operating characteristic working characteristic operating pressure working pressure manipulator working plane work elements operating range working range operating speed circuit speed operation speed switching speed overall system speed working intensity operating contact back contact normally open contact work check[ing] action macro working machine working medium handler operating medium structure ofIR working organ of IR duty cycle work cycle workplace analysis workplace layout workplace position working position (of IR) operating principle increase of labour productivity (by application of robots), incr working program operating procedure operating point working point working area, operating area working room, working zone (of manipulator) operating space of robot working space coordinates operating threshold sensibility robot operating side industrial safety operating memory work station working station working position operative position operating position circuit‐closing connection relay device operation cycle working temperature process characteristic availability factor working capacity process timer operating mode power winding operating angle duty cycle stran 21 od 326 EN ‐DE: slovar avtomatizacije in robotike Arbeitszyklus Arbeitszylinder für Roboter Architektur eines Echtzeit‐Betriebssystems Architektur feines Roboterrechners Ardometer Argonlaser Argument Argument einer Funktion Arithmetikeinheit ??? Arithmetik‐Logik‐Einheit Arithmetik‐Logik‐Einheit Arithmetik‐Logik‐Prozessor Arithmetik‐Logik‐Prozessor Arithmetikprozessor arithmetische Daten pl arithmetische Ergibtanweisung ??? arithmetische Expression arithmetische Funktion arithmetische Konstante arithmetische Kontrolle arithmetische Kontrolle arithmetische Operation arithmetische Prüfung arithmetische Prüfung arithmetische Schreibweise arithmetische Sprachoperation arithmetische Verschiebung arithmetischer Bus arithmetischer Roboterprozessor arithmetisches Element arithmetisches Mittel Arm kante Arm mit fünf Gelenken ARMA‐Modell ARMA‐Modell ARMAX‐Model ARMAX‐Modell Armbewegungsablauf Armdrehung Armeinstellung Armelement Armelementkonfiguration Armgeometrie Armgliederverkleidung eines Roboters Armkomponente Armkonfiguration Armlagekomponente Armlängsbewegung Armleistung AR‐Modell Armposition Armrotation Armsegment Armstellung Armstellung eines Industrieroboters Armtragfähigkeit Armverschiebung Arrayprozessor Arretiervorrichtung Art des Kraftanschlusses Art eines Montageroboters ARX‐Modell ASCII ASCII ASSA Assemblerprogrammiersystem Assemblerquellprogramm Assoziation assoziativ assoziative Indexmethode assoziative Indexmethode assoziative Programmierung assoziativer Festwertspeicher work cycle actuating cylinder for robots architecture of real‐time operating system architecture of robot computer radiation pyrometer argon laser argument argument of a function arithmetic unit arithmetic‐logic unit ALU arithmetic‐logic processor arithmetic‐logic processor, ALP arithmetic processor arithmetic data arithmetic assignment statement arithmetic expression arithmetical function arithmetic constant arithmetical check[ing] mathematical check[ing] arithmetical operation arithmetical check[ing] mathematical check[ing] arithmetic notation arithmetical language operation arithmetical shift arithmetic bus, AB arithmetic robot processor arithmetic[al] element arithmetic mean arm edge arm with five joints ARMA model ARMA model, auto‐regressive moving‐average model auto‐regressive moving‐average model with extra (exogenous) variable automatic ARMAX model, auto‐regressive moving‐average model with extra (exogenous) variable arm movement running lever turning adjusting of arm arm element arm element configuration arm geometry arm element coating of robot arm component arm configuration component of arm position longitudinal movement of arm arm performance AR model, auto‐regressive model arm position arm rotation arm segment arm position position of robot arm (lever), position of industrial robot arm load‐carrying capacity of arm arm shifting, arm shift digital processor arresting device mode of power supply connection assembly robot kind ARX model, auto‐regressive model with extra (exoglnous) variable American standard code of information interchange ASCII absolute assembler assembler programming system, APS assembler source program association associative associative index method associative index method, AIM associative programming associative read‐only memory, AROM stran 22 od 326 EN ‐DE: slovar avtomatizacije in robotike assoziativer Link assoziatives Gesetz Assoziativprinzip Assoziativspeicher assoziierte Struktur assoziierte Zeichengabe astabiler Multivibrator astatische Regelstrecke astatische Regelung astatische Regelung astatische Regelung astatische Regelung mit konstanter Geschwindigkeit astatischer Regler astatischer Regler astatischer Regler astatischer Regler astatisches Gerät astatisches System asymmetrische Funktion asymmetrische Modulation asymmetrischer Graph asymmetrisches Biprozessorsystem asymmetrisches Biprozessorsystem asymmetrisches Netzwerk asymmetrisches nichtlineares Element asymmetrisches Werkstück asymmetrisches Werkstück asymmetrisch‐heterostatische Schaltung Asymptote Asymptoten asymptotisch asymptotische Beziehung asymptotische Entwicklung asymptotische Grenze asymptotische Methode asymptotische Stabilität asymptotischer Fluss asymptotischer Wert asymptotisches Optimum asymptotisches Verhalten Asynchronbetrieb Asynchrondämpfung asynchrone Antwortbetriebsart asynchrone Antwortbetriebsart asynchrone ausgeglichene Betriebsart asynchrone Betriebsweise asynchrone Betriebsweise asynchrone Erregung asynchrone Folgeschaltung asynchrone Logikschaltung asynchrone Rechenanlage asynchrone Robotersteuerung asynchrone Steuerung asynchrone Systemfalle asynchrone unterbrochene Betriebsart asynchrone unterbrochene Betriebsart asynchrone Unterdrückung asynchrone Verbindung asynchrone Verbindung asynchroner Kommunikationsadapter asynchroner Kommunikationsadapter asynchroner Stellmotor asynchrones Multiplexsystem asynchrones Relaissystem asynchrones Übertragungssystem Asynchrongerät Asynchronrechner atmosphärische Optik atmosphärische Störung atmosphärisches Bremsen Atomwärme ATS audiovisuell audiovisuell audiovisuelle Präsentation auditive (hörende) Sensoren pl associative link associative law associative principe (of a memory) contents addressable data store associated structure associated [channel] signaling astable multivibrator astatic controlled system floating control multispeed floating control null offset single‐speed floating control astatic controller integral controller floating‐action controller reset controller astatic device astatic system asymmetric[al] function asymmetric modulation asymmetric graph asymmetric biprocessor system asymmetric bi‐processor system asymmetric network asymmetric non‐linear unit asymmetric asymmetric work piece asymmetrical heterostatic circuit asymptote root‐locus asymptotes asymptotic asymptotic relation asymptotic expansion asymptotic value asymptotic method asymptotic stability asymptotic flux asymptotic value asymptotical optimum asymptotic behavior asynchronous working, asynchronous operation asynchronous quenching asynchronous response mode asynchronous response mode, ARM asynchronous balanced mode, ABM asynchronous working asynchronous working (mode) asynchronous excitation asynchronous sequential circuit asynchronous logic asynchronous computer asynchronous robot control asynchronous control asynchronous system trap, AST asynchronous disconnected mode asynchronous disconnected mode, ADM asynchronous quenching asynchronous connection anisochronous connection asynchronous communication adapter asynchronous communication adapter, ACA asynchronous servomotor non‐synchronous multiplex system asynchronous relay system asynchronous transmission system asynchronous device asynchronous computer atmospheric optics atmospheric perturbation atmospheric braking atomic heat automated transport system audiovisual audiovideo audiovisual presentation audible sensors stran 23 od 326 EN ‐DE: slovar avtomatizacije in robotike auf Karten Aufarbeitung Aufbau einer Aufnahmeeinrichtung Aufbau einer Lineareinheit Aufbau einer Manipulatorsteuerung Aufbau eines Kanals Aufbau eines Werkzeugmanipulators Aufbauprinzip Aufbereitung eines Roboterprogramms aufeinanderfolgende Stufen auffangen Auffangregister Auffrischungschaltung f Auffrischungsperiode Auffrischungssteuerung f Auffrischungszyklus Aufgabeapparat aufgabenangepasste Programmierung aufgabenangepasste Struktur aufgabenangepasster Sensor aufgabenangepasstes Montagesystem Aufgabenbeschreibung für einen Roboter aufgabenorientierter Fügemechanismus aufgabenorientierter Greifer Aufgabenprogrammierung Aufgabensteuerblock Aufgabenüberwachung Aufgabenumschaltung Aufgabenverwaltung Aufgabenwechsel Aufgabenwert Aufgabenzielplan Aufgabenzuordnung Aufgabevorrichtung Aufgeber aufgenommene Leistung aufgeschnittenes Impulssystem aufgespürter Fehler aufgeteilte Belastung Aufhängung aufklingende Schwingung aufladen aufladen Aufladeschaltung Auflage A für mechanische Teile Auflisten eines Roboterprogramms Auflösbarkeit Auflösungsvermögen Auflösungsvermögen Auflösungsvermögen Auflüsungsfunktion Aufnahmeeinrichtung Aufnahmeeinrichtung Aufnahmeeinrichtung aufnahmefähig Aufnahmegenauigkeit eines Greifers Aufnahmegerät Aufnahmegerät Aufnahmemittelaufbau aufnehmen aufrufbares Programm Aufrufbefehl Aufrufbefehl Aufruffolge eines Roboterprogramms Aufrufform calling instruction 104 Aufrufstelle aufsaugen Aufsaugverlust aufspeichern aufstellen aufstellen Aufstellungsoptimierung Aufstellungsplan Aufstellungsplan Aufstellungsprojekt aufstocken ants on cards reprocessing assembly of reception device linear unit structure assembly of manipulator control channel design tool manipulator assembly principle of construction reworking of robot program successive stages latch v latch register refresh circuit refresh period refresh control refresh cycle feed apparatus task‐adapted programming task‐adapted structure task‐adapted sensor task‐adapted assembly system robot task description task‐oriented jointing] mechanism task‐oriented gripper programming of tasks task control block task supervision task switch[ing] task management task switch[ing] prescribed value task target plan task coordination distributor distributor absorbed horsepower open‐loop pulse system traced fault split load accumulation increasing oscillation bootstrap v boost v bootstrapping circuitry support for mechanical parts listing of robot program solvability resolving power resolution power resolution capability resolution function reception device receiving device receiving gear absorbable reception accuracy of gripper input unit sensing unit assembly of reception device absorb v executable program calling instruction call statement calling sequence of robot program call form point of invocation absorb v absorption loss store v install v setup v installation optimozation installation schedule equipment layout plan arrangement planning upgrade v stran 24 od 326 EN ‐DE: slovar avtomatizacije in robotike Auftastimpuls Auftastimpuls aufteilen Aufteilung Aufteilungskoeffizient m Aufteilungskoeffizient m Auftragsverarbeitung Auftragsverwaltung Auftragsverwaltung Auftretenswahrscheinlichkeit Aufwärskompatibilität aufweisen aufzählen Aufzeichnung digitaler Messergebnisse Aufzeichnung von Ergebnissen auf‐zu Auge‐Hand‐Koordination Auge‐Hand‐Koordination der Robotersteuerung augenblickliche Regelabweichung augenblickliche Störung Augenblicksbilanz Augenblicksfrequenz Augenblicksleistung Augenblicksspannung Augenblickswert Augenblickswert Augenblickswert m. Momentan wert aus aus aus dem Gleichgewicht Ausbau nach dem Baukastenprinzip ausbauen Ausbaufähigkeit Ausbaufähigkeit Ausbaufähigkeit Ausbaufähigkeit Ausbessern elektronischer Karten Ausbreitung Ausbreitung in der Atmosphäre Ausbreitungsdämpfung Ausbreitungsgleichung Ausbreitungsmodell Ausbreitungsmodus Ausbreitungsrichtung Ausbreitungstheorie proportional 514 Ausbreitungsverhältnis Ausbreitungsverlust Ausbreitungsverzögerung propagation ausdehnbare Messzentrale Ausdehnungszahl ausdrücklich Ausfahrgeschwindigkeit eines Roboterarms Ausfall Ausfall Ausfall Ausfall der Wechselspannungsversorgung Ausfall wegen des unsachgemäßen Einsatzes Ausfalldauer Ausfallfreiheit Ausfallfreiheit ausfallgeschütztes System Ausfallrate ausfallsicher ausfallsicheres System Ausfalltest Ausfallursache Ausfallverhalten Ausfallverhalten Ausfallwahrscheinlichkeit Ausfallwahrscheinlichkeitsdichteverteilung ausfallweiches System Ausfallzeit Ausfallzeit Ausfallzeit Ausfallzeit eines Roboters ausführbar gate pulse gating pulse partition v partition[ing] partition coefficient distribution coefficient job processing job management job control probability of occurrence upward compatibility feature v increment v recording of digital results result recording on‐off eye‐hand‐coordination eye‐hand coordination of robot control instantaneous deviation of controlled variable momentary disturbance momentary balance instantaneous frequency instantaneous power instantaneous voltage momentary value instantaneous value instantaneous value off out of circuit adj off‐balance modular expansion upgrade v expandability expansibility extendibility extensibility repairing of electronic cards propagation atmospheric propagation propagation loss propagation equation propagation model propagation mode direction of propagation propagation theory propagation ratio propagation loss propagation delay extensible measuring central coefficient of expansion explicit departure speed of robot arm failure breakdown malfunction alternating‐current dump misuse failure outage time freedom of defects absence of failures fail‐safe system failure rate fail‐safe fail‐safe system failure test failure reason failure behaviour behaviour during breakdown failure probability failure probability density distribution fail‐soft system downtime failure time fault time down time of robot executable stran 25 od 326 EN ‐DE: slovar avtomatizacije in robotike ausführen ausführliches Modell Ausführungsorganisationssystem Ausführungssteuerprogramm Ausführungssteuerung Ausführungszeit Ausführungszone Ausführungszyklus Ausgabe analoger Informationen Ausgabe der Sensorinformation Ausgabe eines Roboterprogramms Ausgabe von Drucklisten Ausgabe von Steuerinformationen Ausgabeadressbereich Ausgabe‐Anforderungssignal Ausgabegeschwindigkeit Ausgabeimpuls Ausgabeinformationssignale Ausgabekonvertierung Ausgabeleitung Ausgabelogik Ausgabemarkiersignal Ausgaberate Ausgabesteuerung Ausgabesystem Ausgabetor‐ Aktivierungssignal Ausgabeverfahren Ausgangs Ausgangsachse Ausgangsamplitude Ausgangsanzeigeleitung Ausgangsbefehl Ausgangsdaten pl Ausgangselement Ausgangsfolgeachse Ausgangsgleichspannung Ausgangsgleichung Ausgangsgröße Ausgangsgröße Ausgangsimpuls Ausgangskapazität Ausgangskennwortleitung Ausgangslaserstrahl Ausgangsleitung Ausgangsleitwert bei offenem Eingang Ausgangsmatrix Ausgangspegel Ausgangsposition Ausgangsposition der Roboterhand Ausgangsrückführung Ausgangssammelleitung Ausgangssignal Ausgangsspitzenleistung peak point 472 Ausgangsstufe Ausgangsstufe Ausgangssystem Ausgangsvariable Ausgangsvektor Ausgangsverstärker Ausgangswert Ausgangswert Ausgangswicklung Ausgangszeitkonstante Ausgangszustand Ausgangszustand Ausgangszustand Ausgangszustand eines Greifers ausgeglichene Regelung ausgehängt ausgeregelte Störung ausgeschaltet Ausgießen (durch Roboter) Ausgleich Ausgleich Ausgleich Ausgleich des Leitungswiderstandes execute v detailed model executive system executive program executive control execution time performance zone execution cycle analog output output of sensor information robot program output output of print lists output of control information output address area output‐request signal output speed output pulse output information signals output conversion output line output logic output strobe signal output rate output control output system output strobe signal output action output output axis output amplitude tag line out exit instruction original data output element output axis direct current output voltage output equation output quantity output variable output pulse output capacitance tag line out outgoing laser beam output line open circuit output conductance output matrix output level initial position starting position of robot hand output feedback bus‐out output signal peak output power output cascade output state initial system output variable output vector output amplifier initial value start value output winding output time constant orginal state output cascade output state initial state of gripper balanced control off‐hook corrected perturbance off‐load sealing (by robot) equalization self‐recovery compensation line resistance compensation stran 26 od 326 EN ‐DE: slovar avtomatizacije in robotike Ausgleich von Positionierabweichungen Ausgleich von Positionierungenauigkeiten positionnement Ausgleich von Positionierungsgenauigkeiten Ausgleich von Posttionierabweichungen Ausgleich von Toleranzabweichungen Ausgleichdrosselspule Ausgleichen ausgleichen ausgleichende Zeichenerkennungslogik Ausgleicher Ausgleichgetriebe Ausgleichsbehälter Ausgleichsbewegung eines Geifers Ausgleichsbewegung eines Greifers Ausgleichsdynamometer Ausgleichseinheit Ausgleichseinheit Ausgleichseinheit eines Geifers Ausgleichseinheit eines IR Ausgleichseinheit mit elastischen Gliedern Ausgleichseinheit mit eleastischen Gliedern Ausgleichseinrichtung Ausgleichselement Ausgleichserscheinung Ausgleichsgeschwindigkeit Ausgleichsglied Ausgleichsgrad Ausgleichsimpuls Ausgleichsindikator Ausgleichsleitung Ausgleichsleitung Ausgleichsleitung Ausgleichslinie Ausgleichsmethode Ausgleichsrückkopplung Ausgleichsstrom Ausgleichsstrom Ausgleichsumspanner Ausgleichsverfahren Ausgleichsvorgang Ausgleichszeit Aushilfssystem Aushilfssystem Auskellern Auslastung von Industrierobotern Auslastung von Manipulatoren Auslastung von Manipulatoren Manipulatorfahrzeug Auslastung von Montagemaschinen Auslastungsfaktor Auslastungsfaktor Ausleger (eines Schweißroboters) Ausleger (eines Schweißroboters) Ausleger eines Manipulators Ausleger eines Robotergreifers Auslegerindustrieroboter Auslegerroboter Auslegungsmodell Auslegungsoptimierung Auslöseimpuls Auslöseimpuls Auslöseimpuls Auslösestrom Auslösung Ausmessung von Schallfeldern von Ultraschallgeräten Ausnahmebedingung ausrechnen ausrechnen Ausregelzeit Ausrichtstation Ausrichtung Ausrichtungsmechanismus Ausrüstung Ausrüstung Ausrüstung f. Hardware Ausrüstung mit Ziffernprogrammsteuerung ausrüstungsabhängige Robotertechnik (Robotik) positioning deviation compensation balancing of positioning inaccuracy balancing of positioning inaccuracy positioning deviation compensation tolerance deviation compensation smoothing reactor balancing balance v compensated character recognition logic adjuster differential gear compensating tank balancing movement of grip‐per balancing movement of gripper balancing dynamometer balancing unit balancing unit of gripper balancing unit of gripper transient unit of IR balancing unit with elastic elements balancing unit with elastic elements compliance device balancing element compensating process balancing speed equalizer coefficent of inherent regulation equalizing pulse balancing indicator balancing network compensating line compensation lead compensating curve balanced method compensating feedback balanced current transient current balancing transformer balanced method compensating process duration of self‐regulation backup system standby system pop robot utilization, industrial robot utilization manipulator utilization manipulator utilization machine utilization, assembly machine utilization stream factor utilization factor bore to to drill (by robot) boom principle of manipulator gripper boom, boom of robot gripper boom industrial robot boom industrial robot design model design optimization firing pulse initiating pulse release pulse releasing current reset[ing] sound field measurement of ultrasonic instruments exception condition calculate v compute v settling time aligner station alignment alignment mechanism equipment fitting out equipment, hardware equipment with numerical program control equipment‐dependent robots technique, equipment‐dependen stran 27 od 326 EN ‐DE: slovar avtomatizacije in robotike Ausrüstungsabnahme Ausrüstungsanordnung Ausrüstungsauslegung Ausrüstungsblock Ausrüstungsentwurf Ausrüstungserneuerung Ausrüstungsfließband Ausrüstungsgruppe Ausrüstungskosten pl Aussage Aussage Aussage Ausschalteinheit Ausschalten Ausschalten Ausschalten Ausschalten der Stromversorgung Ausschaltkontakt Ausschaltkreis Ausschaltkreis Ausschaltsensor Ausschaltstellung Ausschaltstrecke Ausschaltung Ausschaltung Ausschaltung Ausschaltverzögerung Ausschaltverzung Ausschaltverzung Ausschaltzeit Ausschaltzeit Ausschaltzeit Ausschaltzeitverzögerung ausschlagabhängiger astatischer Regler Ausschlagfaktor Ausschlagfaktor Ausschlagimpuls Ausschlagmessmethode Ausschlagmessmethode Ausschlagpotentiometer ausschlagunabhängiger astatischer Regler Ausschneiden (von Werkstücken) Ausschwingcharakteristik Ausschwingkonstante Ausschwingkonstante Ausschwingzeit Ausschwingzeit feines IR Außenbefehl Außendienst Außengreifer Außengreifereigenschaft Außeninterpolator Außenlastwiderstand Außenrückkopplungssignal Außenstation Außerbetriebsdauer äußere Abmessung äußere Abschirmung äußere Einwirkung äußere Erregung äußere Logik äußere optische Modulation äußere Regelung äußere Roboterinformation äußere Rückkopplung äußere Spannung äußere Störung äußeres Magnetfeld äußeres Rückkopplungssignal Außertrittfallen Aussetzbetriebsertrag Aussetzdauer ausstreichen Austastimpuls Austastung austauschbar acceptance of equipment equipment arrangement process equipment design equipment block process equipment design equipment innovation equipment flow‐line equipment group equipment cost conclusion proposition offering breaking unit switching off trip out tripping power‐down shut‐off contact blanking circuit quenching circuit switching‐off sensor open position break length switching off trip out tripping turn‐off delay shut‐down delay opening delay breaking time cut‐off time turn‐off time disconnection time delay proportional speed floating regulator deflection coefficient deflection factor overshoot impulse deviation measuring method direct deflection measuring method deflection potentiometer constant‐speed floating regulator finish of the cut (of s) decay curve damping constant decay constant decay time dying‐down time of IR order from outside field service external gripper external gripper property external interpolator external load external feedback signal terminal station outage time overall dimension external shielding external action external drive external logic external optical modulation external control outer robot information outer feedback external voltage external disturbance external magnetic field primary feedback signal falling out of step intermittent duty rest duration cancel v blackout pulse suppression interchangeable stran 28 od 326 EN ‐DE: slovar avtomatizacije in robotike austauschbar austauschbar austauschbar austauschbar austauschbar austauschbare Geräte austauschbare Greifervorrichtung austauschbarer Fingersatz Austauschkode Austrittsdruck Austrittsverfahren Austrittsverluste Austrittswinkel Auswahl mittels Koinzidenzströmen Auswahl von Montageunterlagen Auswahlkriterium Auswahlprinzip Auswahlregel Auswahlschalter Auswahlschaltung Auswahlsteuerung Auswahlsystem Auswahlsystem Auswahlverfahren Auswahlverhältnis auswechselbar auswechselbar auswechselbare Greiferbacken mpf auswechselbare Steuerschiene auswechselbare Werkstückaufnahme auswechselbare Werkstückaufnahme auswechselbarer Robotergreifer auswechselbares Greifersystem auswechselbares Greiforgan Auswechseln von Steuerprogrammen Ausweichbewegung Auswerteeinheit Auswerteeinheit auswerten Auswerteverfahren (für Roboterbilder) Auswertezeit Auswertung der Sensorinformation Auswertung feines Roboterprogramms Auswirkung fvon Maschinendefekten Auswirkung von Manipulatordefekten Auswirkung von Maschinendefekten Auswirkung von Roboterdefekten Auswuchtung Auszeit Auszeitintervall Auszug Auszug Aus‐Zustand Aus‐Zustand Autochemogramm Autochemogramm Autodiagnostiksystem Autodiagnostiksystem Autofluoroskop autoinduktive Kopplung Autoionisation Autoionisation Autokode Autokorrelation Autokorrelation des optischen Rauschsignals Autokorrelationsfunktion Autokorrelationsfunktion Autokorrelationsfunktion Autokorrelationskoeffizient Autokorrelator Autokorrelogramm Autokovarianz Autoleistungsdichte Autoleistungsspektrum Automat für das Elektro‐Schlacke‐Schweißen Automat für das Elektro‐Schlacke‐Schweißen pluggable exchangeable plug‐in plug‐type removable replacement instruments interchangeable gripper device interchangeable finger set alternate code outlet pressure output action exit losses root‐locus, angle of departure coincident current selection selection of assembly documentation selection criterion selection principle selection rule selector selection circuit selective control gating system selector system method of choice selection ratio interchangeable exchangeable interchangeable gripper Jaws exchangeable control bar changeable collet changeable workpiece collet interchangeable robot gripper interchangeable gripper system interchangeable grip organ changing of control programs emergency movement estimation unit evaluation unit evaluate v evaluation process (for robot images) evaluation time evaluation of sensor information evaluation of robot program machine defect effect manipulator defect effect machine defect effect robot defect effect balancing timeout timeout interval separation separating off condition off state autochemogram autochemograph auto diagnostic system, self test system autodiagnostic system autofluoroscope autoinductive coupling auto‐ionization preionization autocode autocorrelation optical noise autocorrelation autocorrelation function, ACF autocorrelation function self‐correlation function autocorrelation coefficient autocorrelator autocorrelogram autocovariance autopower spectral density autospectrum automatic electroslag welder automatic electroslag welding machine stran 29 od 326 EN ‐DE: slovar avtomatizacije in robotike Automat für die Dekodierung automaton for decoding Automat für die Dekodierung decoding automaton Automat in Modulbauweise modular automaton Automat mit Endspeicher automaton with final memory Automat mit reduzierten Eingaben automaton with reduced inputs Automat ohne Ausgaben automaton without outputs Automat ohne Informationsverluste information lossless automaton Automatenalgebra der Ereignisse automaton algebra of events Automatengeneration generation of automatons Automatennetz automaton network Automatenschweißen automatic [machine] welding Automatensteuerungstechnologien control technologies for automatons Automatenüberwachung supervision of automatons Automatenüberwachung supervision of automatons automatic fault signalling automatic fault signalling Automatik‐Kontrollsystem automatic check system Automatiksystem automatic system Automationsplan automation plan Automatisation automati[zati]on automatisch automatic automatisch self‐acting automatisch abgleichendes Digitalmessgerät automatically balancing digital instrument automatisch betätigte Schutzeinrichtung automatic‐actuated protective equipment automatisch erzeugter Teilebaum automatically produced piece tree, automatically generated pi automatisch geführtes Fahrzeug automatic guided vehicle automatisch gesteuerte Zeicheneinrichtung automatically controlled drawing equipment automatisch gesteuertes Maschinensystem automatic‐controlled machine system automatisch gesteuertes Maschinensystem automatiquement automatic‐controlled machine system automatisch programmierte Werkzeuge automatically programmed tools automatisch programmierte Werkzeuge automatically programmed tools, APT automatisch registrierende elektronische Fotokamera automatically registering electronic photocamera automatische automatic alarm automatische (selbsttätige) Steuerung automatic control automatische Abfrage autopoll[ing] automatische Abläufe bei Handhabungsprozessen automatic operations at manipulation processes automatische Abschaltung automatic disconnection automatische Addition automatic addition automatische Akkumulation automatic accumulation automatische Amplitudensteuerung automatic amplitude control automatische Anforderung für Wiederholung automatic request for repetition automatische Anlassen automatic start[‐up] automatische Anpassung automatic working matching automatische Anzeige automatic indication automatische Arbeitsanpassung automatic working matching automatische Arbeitsanpassung (Anpassung an Arbeitsfunktioautomatic working matching automatische Arbeitshände automatic working hands automatische Aufgabenzuordnung automatic task coordination automatische Ausgabe automatic output (of data) automatische Ausrückung automatic ejection automatic selection unit automatische Auswahleinheit automatic selectivity control, ASC, automatic selection control automatische Auswahlsteuerung automatic selectivity control automatische Auswahlsteuerung automatische Auswahlsteuerung automatic selection control automatic selective automatische Auswahlsteuerung automatische Baugruppenmontage automatic assembly mounting automatische Beantwortung automatic answering automatic adjustment of exposure automatische Belichtungseinstellung automatische Belichtungszeitregelung automatic control of exposure time automatische Berichtigung autocorrection automatische Betriebsart automatic mode of operation automatische Betriebsart automatic operation mode automatische Betriebsweise automode automatische Bildübertragung automatic picture transmission, APT automatische binäre Datenverbindung automatic binary data link automatische binäre Datenverbindung automatic binary data link, ABDL automatische Blendeneinstellung automatic diaphragm setting automatische Blockierung automatic blocking automatische Blockierung automatic interlocking automatische Blockierung automatic lockout automatische Brennschneidmaschine automatic flame‐cutting machine automatische Brennschneidmaschine automatic gas‐cutting machine automatische Bündelung automatic focussing action automatic data recording automatische Datenaufzeichnung automatische Dateneingabe introduction automatic data input automatische Datenübernahme automatic acceptance of the data automatische Datenüberwachung automatic data surveillance stran 30 od 326 EN ‐DE: slovar avtomatizacije in robotike automatische Datenverarbeitung automatische Defektlokalisierung automatische Defektlokalisierung (Fehlerlokalisierung) automatische Division automatische Dosierung automatische Dosierung automatische Eichung automatische Einschaltung der Reserveeinrichtung automatische Einstellung automatische elektronische Datenverarbeitung automatische Empfindichkeitsregelung automatische Entladung automatische Fabrik automatische Fadenbruchbehebung automatische Farbeinstellung automatische Farbeinstellung automatische Fehlerbeseitigung automatische Fehlererkennung automatische Fernmessung der Position automatische Fernmessung der Position automatische Fernsteuerung automatische Frequenzdetektorschaltung automatische Frequenzregelung automatische Frequenzregelung automatische Funktion automatische Generierung automatische Greifersteuerung automatische Greifertechnik automatische Greiferwechseleinrichtung automatische Handhabeeinrichtung automatische Handhabeoperation automatische Helligkeitssteuerung automatische Informationserfassung informations automatische Informationsreduzierung automatische Informationsregistrierung automatische Informationsregistrierung automatische Informationsverarbeitung automatische interne Diagnose automatische interne Diagnose automatische Ionisationskammer automatische Konstante automatische Kontrastregelung automatische Kontrolle automatische Kontrolle automatische Kontrolle automatische Konzentration automatische Korrektur automatische Korrektur automatische Kostenschätzung automatische Kraftwerksteuerung automatische Kurvenabtastung automatische Lastbegrenzung automatische Lichtbogenschweißanlage automatische Lichtbogenschweißanlage automatische Linie automatische Löschung automatische Maschinenauswahl automatische Maschinenoperation automatische Maschinensteuerung automatische Maschinenverarbeitung automatische Meldeanlage automatische Mess‐ und Kontrolleinrichtung automatische Messstation automatische Messwerterfassung automatische Mittelwertbildung automatische Modellerkennung automatische Montage automatische Montage automatische Montage von Schraubverbindungen automatische Multiplikation automatische Musterprogrammierung automatische NC‐Datensicherung automatische Niveauregelung automatische Niveauregelung automatische Nullkontrolle automatische Nullpunkteinstellung automatic data processing automatic defect localization automatic defect localization automatic division automatic proportioning automatic dosage automatic calibration automatic reserve equipment switching automatic regulation, automatic adjusting automatic electronic data processing automatic sensitivity control automatic discharge automatic plant automatic thread breakage removal automatic colour matching automatic colour matching automatic error recovery automatic error detection automatic position telemetering automatic position telemetering, APT automatic remote control automatic discriminator switching automatic frequency control AFC automatic function automatic generation automatic gripper control automatic gripper technique automatic device of gripper change automatic handling device automatic handling operation automatic brightness control, ABC automatic information acquisition automatic information reduction automatic message registering automatic message registering, AMR automatic information processing automatic internal diagnosis automatic internal diagnosis, AID automatic ionization chamber automatic constant automatic contrast control automatic check[ing] automatic test[ing] automatic inspection automatic focussing action automatic balancing automatic compensation automated cost estimating, ACE automatic power plant control automatic curve scanning automatic load limitation automatic arc welding equipment automatic arc welding machine automatic line automatic clearing automatic machine selection automatic machine operation automatic machine control automatic machine processing automatic alarm automatic measuring and checking device automatic measuring station automatic logging automatic mean value determination automatic model recognition automatic assemblage, automatic mounting automatic assembly automatic mounting of screw fastenings automatic multiplication automatic pattern programming automatic numerical control data backup automatic level control automatic level control, ALC automatic zero check automatic zero adjustment stran 31 od 326 EN ‐DE: slovar avtomatizacije in robotike automatische Parolenverarbeitung automatic parole processing automatische Phaseneinstellung automatic phase adjustment automatische Phasenregelung automatic phase control automatische Phasenregelung automatic phase control, APC automatische pneumatische Geräte automatic pneumatic devices automatische pneumatische Geräte pneumatic automation installations automatische Positionierung self‐positioning automatische Prägemaschine automatic embossing machine automatische Prioritätengruppe automatic priority group automatische Prioritätengruppe automatic priority group, APG automatische Programmgenerierung automatic program generation automatische Programmierung automatic programming automatische Programmierung self‐programming automatische Programmkorrektur autopath automatische Programmregelung programme automatic program control automatische Prozesssteuerung automatic process control automatische Prüfeinrichtung automatic test equipment automatische Prüfung automatic check[ing] automatische Prüfung automatic test[ing] automatische Prüfung automatic inspection automatische Prüfzeichengeneration (Prüfzeichenerzeugung) automatic test pattern generation, ATPG automatische Qualitätskontrolle automatic quality control automatische Regeleinrichtung automatic control device automatische Regelung automatic control automatische Regelung automatic regulation automatische Regelung self‐regulation automatic control engineering automatische Regelungstechnik automatische Regelungsvorrichtung automatic control gear automatische Registriervorrichtung data logger automatische Reihenauswahl automatic range selection automatische Reserveeinschaltung automatic standby start[‐up] automatische Richtigkeitsprüfung automatic accuracy check automatische Rotationslinie automatic rotary line automatische Rückfrage automatic request automatische Rückfrage automatic return question automatische Rückführung automatic reset automatische Rückstellung self‐resetting automatische Rückstellung auf Null self nulling automatische Rückübertragungsanforderung automatic retransmission request automatische Rückübertragungsanforderung automatic retransmission request, ARQ automatic call recording, ACR automatische Rufaufzeichnung automatische Rufeinrichtung automatic calling equipment, ACE automatische Scharfabstimmung automatic tuning control automatische Schneideanlage automatic cutting equipment automatische Schnellabschaltung automatic emergency shutdown automatic protection automatische Schutzeinrichtung automatische Servoanlage mit geschlossener Schleife automatic closed‐loop servosystem automatische Spanntechnik automatic clamping technique automatische Spannungsregelung automatic voltage regulation automatische Speicherung der Roboterinformation automatic storage of robot information automatische Speisung automatic feed automatische Sperrung automatic blocking automatische Sperrung automatic interlocking automatische Sperrung automatic lockout automatische Stabilisierung automatic stabilization automatische Stiftmontage automatic pin assembly (mounting) automatische Stillsetzung automatic stopping automatische Stillstandsüberwachung automatic idling control automatische Störsignalisation automatic alarm automatische Störsperre automatic noise gate automatische Synchronisiereinrichtung automatic synchronizer automatische Synchronisierschaltung automatic locking circuit automatische Synchronisierschaltung automatic locking circuit, ALC automatische Synthese automatic synthesis automatic translation automatische Übersetzung machine translation automatische Übersetzung automatic translation device automatische Übersetzungseinrichtung automatic monitoring automatische Überwachungsanlage automatische Umschaltung automating reverse switching automatische Umstellbarkeit automatic shifting automatische Umwelterfassung automatic environment acquisition automatische Verfahrenskreislauf‐ Regelvorrichtung automatic process cycle controller automatische Verriegelung automatic blocking automatische Verriegelung automatic interlocking automatische Verriegelung automatic lockout stran 32 od 326 EN ‐DE: slovar avtomatizacije in robotike automatische Verschlüsselung automatic coding automatische Verstärkungsregelung automatic gain control automatische Verzerrungskorrektur automatic distortion correction automatic branch control automatische Verzweigungssteuerung automatische Verzweigungssteuerung {Zweigstellensteuerungautomatic branch control, ABC automatische Video‐Rauschbegrenzung automatic video noise limiting automatische Wähleinrichtung automatic dialing unit, ADU automatische Wählervermittlung automatic circuit exchange automatische Werkstückhandhabung automatic handling automatische Werkstückhandhabung automatic work piece handling automatische Widerstandsschweißanlage automatic resistance welder automatische Wiederholanforderung automatic repeat request automatische Wiederholanforderung automatic request for repeat, automatic repeat request, ARQ automatische Zeitschachtelung automatic time sharing automatische zentrale Bearbeitung automatic central proccessing automatische Zielerkennung automatic target recognition automatische Zweigstellensteuerung automatic branch control automatischer Abgleich automatic balancing automatischer Abgleich automatic compensation automatischer Antrieb automatic drive automatischer Anzeiger automatic indicator automatic operation automatischer Arbeitsablauf automatischer Aufnahmebunker automatic receiving bunker automatischer Bandaufwickelroboter automatic tape winding robot automatischer Bandgeber automatic tape dispenser, ATD automatischer Bandwickler automatic tape winder, ATW automatischer Bearbeitungsvorgang automatic treatment process automatischer Datenzuordner automatic data translator, ADT automatischer Digitalrechner automatic digital computer, ADC automatischer Einschienenmanipulator automatic monorail manipulator automatic wiring design automatischer Entwurf der Verdrahtung automatischer Entzerrer automatic equalizer automatischer Fügevorgang automatic joining process automatischer Gasanalysator automatically operating gas analyzer automatischer Gleichschalter autostabilizer automatischer Greifer Greifer automatic gripper automatischer Greiferaustausch automatic gripper exchange automatischer Greiferverschluss automatic gripper closure automatischer Kompensator automatic compensator automatic cycle automatischer Kreislauf automatischer Lautstärkeregler m automatic gain controller automatischer Lautstärkeregler m automatic grading automatischer Lautstärkeregler m automatic sorting method automatischer Lautstärkeregler m automatic volume controller automatischer Lochbandabtaster automatic tape reader, ATR automatischer Lochbandleser automatic tape reader, ATR automatischer Manipulator automatic manipulator automatischer Manipulator mit fünf Freiheitsgraden automatic manipulator with five degrees of freedom automatischer Mechanismus automatic mechanism automatischer Mechanismus mit elektromagnetischer Steueruautomatic mechanism with electromagnetic control automatischer Monitor automonitor automatischer Montagevorgang automatic assembly process automatischer Montagevorgang (Montageprozess) automatic assembly process automatischer Netzspannungsregler automatic network voltage regulator automatic zero step automatischer Nullschritt automatischer Phasenvergleichskreis phase automatic phase comparison circuit automatischer Probenwechsler automatic sample changer automatischer Programmablauf automatic program sequence, automatic program flow automatischer Prüfvorgang automatic operation of testing automatischer Regelkreis automatic control loop automatischer Regler automatic controller automatischer Roboter automatic robot automatischer Röntgenspektrograf automatic X‐ray spectrograph automatischer Rückgang automatic reset automatic call automatischer Ruf automatischer Rufverteiler (Anrufverteiler) automatic call distributor, ACD automatischer Stabilisator autostabilizer automatischer Suchkreis automatic search circuit automatic supervision room automatischer Überwachungsraum automatischer Verschluss automatic shutter automatischer Verstärkungsregler automatic gain controller automatischer Verstärkungsregler automatic grading automatischer Verstärkungsregler automatic sorting method automatischer Verstärkungsregler automatic volume controller automatischer Viskositätsregler automatic viscosity controller automatischer Vorschub automatic feed stran 33 od 326 EN ‐DE: slovar avtomatizacije in robotike automatischer Wechsel der Greifeinheiten automatischer Wechsel der Greifeinheiten grippion automatischer Werkstückwechsel automatischer Werkzeugwechsel automatischer Werkzeugwechsel automatischer Werkzeugwechsel automatischer Wiederanlauf und Wiederherstellung automatischer Wiederanlauf und Wiederherstellung automatischer Zähler automatischer Zähler automatischer Ziffernerkenner automatischer Zyklus automatisches Arbeitssystem automatisches Ausprüfungssystem automatisches Auswerfen automatisches Bearbeiten automatisches Betriebs‐ und Planungsprogramm automatisches Datenerfassungssystem automatisches Datensammlungssystem automatisches Datenübertragungssystem automatisches Datenwiederauffinden automatisches Digitalisiersystem automatisches Digitalisierungssystem automatisches Doppeln automatisches Druckentlastungssystem automatisches Duplizieren automatisches Empfängerprogramm automatisches Fehlerkorrektursystem automatisches Flussdiagrammpaket automatisches Generieren von Roboterprogrammen automatisches Greifen (Ergreifen) automatisches Greifersystem automatisches Greiferwechselsystem automatisches Indizieren automatisches Kodierungssystem automatisches Kontrollgerät automatisches Kontrollsystem automatisches Konturendigitalisierungsgerät automatisches Layout‐Design automatisches Lichtbogenschweißen automatisches Luftraumkontrollsystem automatisches Manipulationssystem automatisches Mischen automatisches Polarimeter mit magnetooptischer Drehung automatisches Positioniersystem automatisches Präzisionsspektrofotometer automatisches programmierbares Montagesystem automatisches Programmiersystem für Montage automatisches Prüfsystem automatisches Rechnen automatisches Regelventil automatisches Reihenfolgeverfahren automatisches Roboterfahrzeug automatisches Robotermontagesystem automatisches Schmelzschweißen automatisches Schützentor automatisches Schweißen automatisches Testsystem automatisches Verteilungsuntersystem automatisches Wechselsystem automatisches Wiederauffinden von Informationen automatisches Zählgerät automatisches Zählgerät automatisches Zeitteilungsverfahren automatisches Zielsuchen durch Lichtstrahlen automatisches Zubringen von Werkstücken automatisches Zubringen von Werkstücken automatisieren automatisierte Baugruppenmontage automatisierte Datenverarbeitung automatisierte Einzelmaschine automatisierte Fertigungsplanung automatisierte Fertigungsüberwachung automatisierte Handhabung automatisierte Informationsverarbeitung automatisierte Konstruktionstechnik automatic alternation of grip units automatic alternation of grip units automatic change automatic tool change, automatic tool exchange automatic tool change automatic tool exchange automatic backup and recovery automatic backup and recovery, ABR automatic scaler autoscaler automatic digit recognizer automatic cycle automatic working system automatic checkout system automatic ejection automatic machining (of control disks) automatic operating and scheduling program, AOSP automatic data acquisition system automatic data collecting system automatic data transmission system automatic data retrieval automatic digitizing system automatic digitizing system automatic duplication automatic pressure suppression system automatic duplication automatic receiver program automatic error‐correcting system, A ECS automatic flow‐charting package automatic generation of robot programs automatic gripping automatic gripper system automatic gripper change system automatic indexing (of informations) automatic coding system automonitor automatic check system automatic contour digitizer automatic layout technique automatic arc welding automatic air control system automatic manipulation system automatic collating Faraday rotation automatic polarimeter automatic positioning system automatic precision spectrophotometer APAS (automatic programmable assembly system) APAS (automatic programmable assembly system) automatic testing system automatic computing automatic control valve automatic sequencing procedure automatic robot vehicle automatic robot assembly system automatic fusion welding self‐acting shutter automatic [machine] welding automatic test system, ATS automatic distribution subsystem automatic change system automatic information retrival automatic scaler autoscaler automatic time sharing light‐homing guidance automatic feeding of s automatic feeding of work pieces automatize v automated assembly mounting automated data processing automated single machine automated manufacturing planning automated monitoring of manufacturing automated handling automated information processing automated construction engineering stran 34 od 326 EN ‐DE: slovar avtomatizacije in robotike automatisierte Leitung automatisierte Leitung automatisierte Leitwegverwaltung automatisierte Leitwegverwaltung automatisierte Montage automatisierte Präzisionsgerätetechnik automatisierte Produktion automatisierte Produktionsentwicklung automatisierte selektive Präzisionsmontage automatisierte Serienfertigung automatisierte Steuerung automatisierte Steuerung automatisierte Verarbeitungsmethode automatisierte Werkzeugmaschine automatisierter Arbeitsablauf mittels Industrieroboters automatisierter Arbeitsplatz automatisierter Arbeitsplatz automatisierter Informationsfluss automatisierter ingenieurtechnischer Entwurf automatisierter ingenieurtechnischer Entwurf automatisierter Lernprozess automatisierter Lernprozess automatisierter Logikentwurf automatisierter Manipulator automatisierter Produktionsbereich automatisiertes Datenaustauschsystem automatisiertes Datenaustauschsystem automatisiertes Dateneingabesystem automatisiertes Dateneingabesystem automatisiertes Datensystem automatisiertes Datensystem automatisiertes digitales Ein‐ und Ausgabesystem automatisiertes Element automatisiertes Entgraten automatisiertes Entwurfstechnikprinzip automatisiertes Informationssystem automatisiertes Leitungsinformationssystem automatisiertes Leitungsinformationssystem automatisiertes logisches Diagramm automatisiertes Montagesystem für Teile automatisiertes Schweißverfahren automatisiertes Transport‐ und Lagersystem automatisiertes Transportsystem automatisiertes Transport‐und Lagersystem Automatisierung Automatisierung der Fertigungssteuerung Automatisierung der Lagerung Automatisierung der Technologie Automatisierung der Zeichenarbeiten Automatisierung der Zeichenarbeiten Automatisierung des Überwachungsprozesses Automatisierung diskontinuierlicher Prozesse Automatisierung mittels Industrierobotern Automatisierung von Hilfsoperationen Automatisierungsanlage Automatisierungsaufgabe Automatisierungselemente für Fertigungsstraßen automatisierungsfreundlicher Entwurf automatisierungsfreundlicher Entwurf automatisierungsgerechte Gestaltung automatisierungsgerechte Gestaltung Automatisierungsgrad Automatisierungsgrad Automatisierungsgrad Automatisierungsgrad der Montage Automatisierungsgrad der Montage Automatisierungsmittel Automatisierungsmittel in Messkreisen Automatisierungsobjekt Automatisierungssprache (für lR) Automatisierungsterminus Automatismus Automonitor automorphe Abbildung Automorphismus autonom automated control automated direction automated route management automated route management, ARM automated assembly automated precision device engineering automated production automated production development automated selective precision mounting automatic sequence manufacture automated control automated direction automated processing method automated machine tool automated sequence of operation by industrial robot automated workplace automatized working place automated information flow automated engineering design automated engineering design, AED automated learning process automated teaming process, ALP automated logic design automated manipulator automated workshop automatic data interchange system automatic data interchange system, ADIS automated data entry system automated data entry system, A DES automated data system automated data system, ADS automatic digital input‐output system automated element automated trimming automated design engineering principle automated information system automated management information system automated management information system, AMIS automated logic diagram AUTOPASS (automated parts assembly system) automated welding process automated transport and storage system automated transport system automated transport and storage system automati[zati]on production control automation storage automation automation of technology automation of drawing work drawing work automation automation of supervising process automation of discontinuous processes robot automation automatization of auxiliary operations automation equipment automation task automation elements for production lines design meeting the demands of automation automation‐friendly design design meeting the demands of automation automation‐friendly design degree of automatizationautomatisation (US) degree of automatization automation degree automatisation degree of assembly automatization degree of assembly automation medium automation means in measuring circuits plant (US) ALFA (a language for automation) automation term automatism automonitor automorphism automorphism offline stran 35 od 326 EN ‐DE: slovar avtomatizacije in robotike autonom autonome autonome autonome Speisung autonome Verarbeitungseinheit autonomer linearer Automat autonomes Regelsystem autonomes Robotersystem autonomes selbsttätiges Regelungssystem autonomes System autonomes tragbares Gammaspektrometer autonomes tragbares Gammaspektrometer Autonomie Autopolarisation Autoradiograf Autoradiograf Autoradiograf Autoradiograf Autoradiografie Autoradiografie als Resultat einer Druckreaktion Autoradiografie als Resultat einer Druckreaktion Autoradiografie in der Elektronenmikroskopie autoradiografische Regelung autoradiografisches Verfahren Autoradiogramm Autoradiogramm Autoradiogramm Autoradiogramm autoregressive Folge autoregressive Reihe autoregressives Modell autoregressives Modell mit externen Variablen autonomous offline autonomous self‐contained supply autonomous processor autonomous linear automaton independent control system autonomous robot system non‐interaction control system autonomous system autonomous portable gamma‐ray spectrometer independent portable gamma‐ray spectrometer autonomy autopolarization autoradiogram autoradiograph radioautograph radioautogram autoradiography autopressuregraph autopressuregrapm autoradiography in electron microscopy autoradiographic method autoradiographic method autoradiogram autoradiograph radioautograph radioautogram autoregressive series autoregressive series AR model, auto‐regressive model ARX model, auto‐regressive model with extra (exogenous) variable autoregressives Modell mit gleitender Mittelwertbildung ARMA model autoregressives Modell mit gleitender Mittelwertbildung mit ARMAX model, auto‐regressive moving‐average model with externer Variablen extra (exogenous) variable auto‐regressive moving‐average model with extra autoregressives Modell mit gleitender Mittelwertbildung mit e(exogenous) variable automatic autorisierter Programmanalysebericht authorized program analysis report, APAR autorisiertes Programm authorized program Autospektraldichte autopower spectral density autospektrale Leistungsdichte autopower spectral density Autospektrum autospectrum Autostrahlung autoradiation Autotest‐System autotest‐system Axial‐ Transsonikverdichter axial flow tran[s]sonic compressor axiale Stömung axial flow axiale Verschiebung axial displacement axiale Verteilung axial distribution axial expansion coefficient axialer Ausdehnungskoeffizient axialer Diffusionskoeffizient axial diffusion coefficient Axialgebläse axial flow fan Axialpumpe feines Roboters axial pump of robot Axial‐Radial‐Verdichter mixed‐flow compressor Axialstrahlturbine axial flow turbine Axial‐Transsonikkompressor axial flow tran[s]sonic compressor Axialventilator axial flow fan Axiom axiom Axiom postulate Axiomatik der Theorie der Wahrscheinlichkeiten axiomatics of theory of probabilities axiomatisches System axiomatic system azyklischer Vorgang acyclic process Bachbildung channelling Backen jaw Backenbewegung jaw movement Backenflächen (eines Greifers) surface of jaws (of gripper) Backengeometrie jaw geometry Backenprofil jaw profile Bahnabweichung path deviation Bahnabweichung eines IR‐Arbeitsorgans path deviation of IR working organ Bahnabweichungsregelung path deviation regulation Bahnausgabedaten pi path output data Bahneingabedaten pi path input data path error of IR Bahnfehler eines IR Bahngeschwindigkeitsprofil speed profile of path bahngesteuerte Fertigung path‐controlled production stran 36 od 326 EN ‐DE: slovar avtomatizacije in robotike bahngesteuerter Roboterarm (Industrieroboterarm) Bahninterpolation Bahnkontrolle Bahnkurve zwischen den Bestimmungspunkten Bahnplanung Bahnplanungsrechner (für Roboter) Bahnplanungssystem Bahnposition eines Industrieroboters Bahnprogramm eines IR Bahnsegment Bahnsollwertgenerator Bahnsteuerung Bahnsteuerung Bahnsteuerung Bahnsteuerung eines Industrieroboters (IR) Bahnsteuerung eines Manipulators Bahnstruktur Bahnstützpunkt Bahnvektorbetrag Bahnvektorwert Bahnwiderstand Bahnzustand Bajonettverbindung Band Bandanfang (eines Robotersteuerbandes) Bandanfangsmarke Bandantrieb bandbegrenzt bandbegrenzt Bandbereich Bandbereich Bandbreite Bandbreite des optischen Verstärkers Bandbreite des parametrischen Verstärkers bandbreitebegrenzter Betrieb Bandbreitenregelung Bandbreitenregler Bandbreitensteuerung Bandfilter Bandgeber bandgesteuert bandgesteuert Bandinductosyn eines Greiferarms Bandlaufwerk Bandpass Bandpassverstärker Bandsperre Bandsperre Bandumschalter Bandvorschubeinrichtung Bandwickler Bang‐Bang‐Regelung Bang‐Bang‐Regelung Bang‐Bang‐Regelung Barrierekapazität Barrierekapazität Basis Basis Basis Basis eines Industrieroboters Basis‐Abbildungsunterstützung Basis‐Abbildungsunterstützung Basisadresse Basisadresse Basisalgorithmus Basisalgorithmus Grundbandsignalgabe Basisband Basisband‐Übertragungsfunktion Basisband‐Videosignal Basisbetriebssystem Basisbetriebssystem Basisbewegungszeit basisbezogene Variable Basisbezugssystem (Roboterpositionierung) Basisblockprotokoll Basisdatendarstellung path‐controlled robot arm, track‐controlled industrial robot ar trajectory interpolation trajectory checking path curve between determination points path planning path planning computer (for robots) path planning system path position of [industrial] robot, path position of IR path program of IR path segment interpolator continuous path control, CP control, path control path control manipulator track control path control of [industrial] robot, path control of IR manipulator track control path structure point of support of path path vector value path vector value trajectory resistance, path resistance path state bayonet socket tape beginning of tape, BT beginning of tape marker tape drive bandlimited frequency‐band limited frequency domain frequency range bandwidth optical amplifier bandwidth parametric amplifier bandwidth bandwidth‐limited operation bandwidth control strip‐width controller bandwidth control band‐pass filter tape dispenser tape controlled tape operated bandinductosyn of gripper arm tape drive band‐pass filter band‐pass amplifier band elimination filter band rejection filter band switch tape drive tape winder bang‐bang control two‐stage control two‐step control barrier capacity barrier‐layer capacitance base basis for n‐dimensional state space basis robot base, IR base basic mapping support basic mapping support, BMS base address basic address base algorithm base algorithm baseband signalling, US: base algorithm baseba baseband baseband transfer function baseband video signal basic operating system basic operating system, BOS basic motion time, BMT based variable base reference system (robot positioning) basic block protocol, BBP basic data representation stran 37 od 326 EN ‐DE: slovar avtomatizacije in robotike Basisfunktion Basishardware Basiskoordinate Basiskoordinate feines Robotereffektors Basislösung Basisprogrammzugriffsmethode Basisregister (eines Roboterrechners) Basisschaltung Basissynchronwerkzeuge Basissystem Basisteil (einer Robotermontage) Basisübertragungseinheit Basisübertragungseinheit Basisvariable Basisvektor Basisverarbeitungseinheit Basisverfahren Basiszähleinheit Bauart einer Greifereinheit Baueinheit Baueinheit für Schweißroboter Baueinheitensystem Baueinheitensystem Bauelement Bauelement Bauelement Bauelement in bipolarer Technik Bauelement mit Tri‐State‐Ausgang Bauelement mit Tri‐State‐Ausgang Bauelemente Bauelementeanordnung feiner IR‐Montage Bauelementebeziehung einer IR‐Montage Bauelementedatenbank Bauelementedimensionierung Bauelementeeigenschaften Bauelementeintegration Bauelementekennwerte Bauelementelebensdauer Bauelementemodell Bauelementeprüfeinrichtung Bauelementereihenfolge"einer IR‐Montage Bauelementetechnologie Bauelementetester Bauelementezuverlässigkeit Baugruppe Baugruppe feines Greifers Baugruppenauswahl Baugruppenhandhabung Baugruppenkonstruktion Baugruppenmontage Baugruppenpräzisionsmontage Baugruppenprüfung Baugruppenprüfung Baukasten für Handhabungstechnik Baukastengreifer Baukastengreifer Baukastenkonstruktion Baukastenkonzeption Baukastenlösung Baukastenprinzip Baukastenprinzip Baukastenprinzip Baukastenprinzip Baukastensystem Baukastensystem Baukastensystem baumartige Datenstruktur Baumstruktur Baustein Baustein Baustein Baustein Baustein bloc fonctionnel Baustein bloc fonctionnel Baustein bloc fonctionnel bausteinartig basis function basic hardware base coordinate effector base coordinate, base coordinate of robot effector basis solution basic program access method, BPAM base register, BR (of robot computer) common base circuit basic synchronous tools basic system base part (of robot assembly) basic transmission unit basic transmission unit, BTU base variable basis vector basic processing unit, BPU basic approach basic counter unit, BCU type of gripper unit standard component construction unit for welding robot construction unit system building‐block system component part construction unit structural member bipolar device three‐state device tristate device hardware components arrangement of IR‐assembly components relation of IR‐assembly component data bank dimensioning of components component characteristics component integration component characteristics component life model of component parts component tester components order of IR‐assembly component technology component tester component reliability assembly assembly of gripper sub‐assembly selection, group of parts selection assembly handling construction of subassembly assembly mounting precision mounting of components assembly check[ing] assembly checking] handling technique building block building block gripper building‐block gripper building block construction building block concept assembly unit solution building‐block principle principle of assembly unit modular principle building‐block concept building‐block system unit‐assembly principle (system) construction unit system arborescent data structure tree structure module circuit element switching element network element component part construction unit structural member modular stran 38 od 326 EN ‐DE: slovar avtomatizacije in robotike Bausteine Bausteine für Digitaltechnik Bauteil der Regelung Bauteilaufnahme Bauteilezuführung Bauteilezuführung Bauteilezuführung Bautieldichte Bauweise Bauweise des Programmes bearbeiten (durch Roboter) Bearbeiten von Handhabungsobjekten Bearbeitung mittels Industrieroboters Bearbeitung von Ausnahmebedingungen Bearbeitungsablauf Bearbeitungsautomat Bearbeitungsautomatisierung Bearbeitungsfolge Bearbeitungsmaschine Bearbeitungsperiode Bearbeitungsphase Bearbeitungsschritt Bearbeitungsstufe Bearbeitungssystem Bearbeitungszeit Bearbeitungszentrum Bedarfsdeskription Bedarfshaltepunkt bedeutende Information bedienarmer Fertigungsprozess Bediendaten pl eines Roboterprogramms Bedienelement eines Roboters bedienen Bedienerbefehl bedienerlose Werkstatt Bedienerrufsignal Bedienkomfort (einer Robotersteuerung) Bedienkomfort eines IR Bedienprogramm Bedienprogrammkommando Bedienprozessor Bediensequenz Bedientableau eines IR Bedienung feines Roboters Bedienungsanweisung Bedienungselemente zur Prametereinstellung Bedienungsfehler Bedienungsfehler Bedienungsmaßnahme Bedienungspult Bedienungspult Bedienungsseite feines IR Bedienungssteuerung Bedienungstaste Bedienungsvorschrift bedingt konvergent bedingt vollständiges System bedingte Anweisung bedingte Disjunktion bedingte mathematische Erwartung bedingte Operation bedingte Sprungoperation bedingte Stabilität bedingte Steuerung bedingte Vereilungsfunktion bedingte Wahrscheinlichkeit bedingter Befehl bedingter Befehl bedingter Sprung bedingter Sprung bedingter Sprungbefehl bedingter Sprungbefehl bedingter Stoppbefehl bedingter Übergang bedingter Übergang bedingter Übergang der Steuerung hardware constituting components of numerical control control component element reception alimentation of parts, feeding of parts alimentation of parts feeding of parts component density equipment engineering configuration of the program work to (by robot) treatment of handling objects processing by industrial robot exception handling treatment run‐off treatment automatic machine, machining automaton treatment automation sequence of operation treatment automatic machine, machining automaton processing period machining phase processing step machining step treatment system machining time treatment centre requirement description breakpoint considerable information low‐operation manufacturing process operational data of robot program operator element of robot operate v operator instruction unmanned machine shop operator call signal operational comfort (of robot control) operator comfort of robot service program service program command operator processor operating sequence teach‐in‐tableau robot operator attenuation instruction manual parameter adjustment control operating error faulty operator intervention action control board control panel robot operating side congestion control, CGC control key direction for use conditionally convergent conditional complete system conditional statement conditional disjunction conditional mathematical expectation conditional operation operation of conditional transfer of control conditional stability automatic sequence control conditional distribution function conditional probability conditional instruction conditional order conditional jump conditional transfer conditional jump instruction conditional transfer instruction conditional breakpoint instruction conditional jump conditional transfer conditional transfer of control stran 39 od 326 EN ‐DE: slovar avtomatizacije in robotike bedingter Überleitungsbefehl bedingter Überleitungsbefehl bedingter Zustand Bedingung Bedingung der Endregelung Bedingungen der Realisierbarkeit beeinflussungsfreies Kriterium beenden Befehl Befehl Befehl zur Zyklusbeendigung und Rückstellung auf Null Befehls[verarbeitungs]einheit Befehlsadresse Befehlsadressenänderung Befehlsanlage Befehlsanlage Befehlsanordnung Befehlsaufbau Befehlsaufhebung Befehlsausführung Befehlsausführungszeit Befehlsbereitstellung Befehlsdekodierer Befehlsdekodierer Befehlseinheit Befehlselement Befehlselement Befehlsfeld Befehlsfolge Befehlsfolgeregister Befehlsgerät Befehlshauptleitung Befehlsklassifizierung Befehlskode Befehlskode Befehlsnachricht Befehlsnachricht Befehlsprozessor Befehlsregister Befehlsregister Befehlsreihe eines Teilprogrammausschnitts Befehlssatz Befehlssteuerblock Befehlssteuerung Befehlsstruktur Befehlssystem Befehlssystem Befehlsübertragung Befehlsverteilerkanal Befehlszähler Befehlszähler Befehlszähler befestigen (durch Roboter) Befestigungsglied Befestigungsprinzipien pl Befestigungsschraube Befeuchtungsanlage l'humectation Befeuchtungsausrüstung Befeuchtungssystem Befeuchtungswirkungsgrad Beförderungsfehler befreien befreien befreien befriedigen Beginn der Nachricht Beginn des Testprogramms Beginn des Testprogramms Begleitprozessor begrenzende Bedingung begrenzende Rückkopplung begrenzende Vorwärtswirkung Begrenzer Begrenzer Begrenzer Begrenzer conditional jump instruction conditional transfer instruction conditional state premise final control condition feasibility conditions criterion of non‐interaction terminate v instruction command end cycle control and return to zero instruction processing unit command address, CAD instruction address change command device control centre order structure order structure order cancel instruction execution, command realization command realization time fetch of instruction instruction decoder command decoder command module instruction element order element instruction array instruction sequence sequence‐control register control appliance instruction main line instruction classification instruction code order code control message command message command processor instruction register order register coding section command set command control block, CCB command control order structure instruction system command system order transmission instruction distribution channel control counter control register instruction counter attach to, to apply (by robot) fastening device attachment principles assembly screw moistening plant humidifying machinery humidification system humidification efficiency conveying error unlock v unblock v deblock v satisfy v start of message, SOM check program beginning test program beginning companion processor, coprocessor, auxiliary processor limiting condidion limiting feedback limiting feed forward clipper limiter restrictor delimiter stran 40 od 326 EN ‐DE: slovar avtomatizacije in robotike Begrenzerkennlinie Begrenzerschaltung Begrenzerschaltung Begrenzerstufe Begrenzerstufe Begrenzerstufe Begrenzerstufe begrenzt durch das Detektorrauschen begrenzte Differenz begrenzte Einwirkung begrenzte Größe begrenzte Leistung begrenzte Summe begrenzte Variable begrenzter Ausgang begrenzter Eingang Begrenzung Begrenzung der Folgen Begrenzung des Übergangsverhaltens Begrenzungssymbol Begrenzungssymbol Begrenzungssymbol Begrenzungssymbol Begrenzungsvorrichtung Begrenzungswiderstand Begrenzungszeichen für Parameter Begriffsbildung behandeln behandeln Behandlung binärer Probleme Behandlungsmethode beharrend Beharrungsvermögen Beharrungswert Beharrungszustand Beharrungszustand behebbare Singularität beherrschbare Montagesequenz beherrschbare Robotermontage beherrschbare Roboterregelung Beiwert des Frequenzauflösungsvermögens Beladeeinrichtung Beladungsplan Belagsdickenmessung belanglose Information belastbar Belastbarkeit Belastungsänderung Belastungsbegrenzungswiderstand Belastungsdauer Belastungsdauer des Manipulatorarmes Belastungsdauer von Roboterelementen Belastungsdiagramm Belastungseinfluß Belastungseingriff Belastungseinwirkung Belastungsfaktor Belastungsgrad Belastungskennlinie Belastungskennlinie Belastungskurve Belastungslinie Belastungsmoment Belastungspunkt Belastungsregelung Belastungsregler Belastungsschwankung Belastungsstromkreis Belastungstest Belastungsvektor Belastungsvermögen Belegbearbeitung Belegungsdauer Belegungsrelais Belehrungsalgorithmus Beleuchtungsanlage limiter characteristic limiter circuit white noise limiting circuit clipper limiter restrictor delimiter detector‐noise limited bounded difference limited action limited quantity limited power bounded sum limited variable bounded output bounded input limiting limitation of the consequences performance limitation clipper limiter restrictor delimiter limiting device limiting resistance parameter delimiter concept formation handle v manipulate v treatment of binary problems processing method steady inertia conservative value steady state steady‐state regime removable singularity controllable assembly sequence controllable robot assembly controllable robot regulation frequency resolution constant loading device loading pattern coating thickness measurement dummy information chargeable carrying capacity load change load limiting resistor load duration, duration of load loading duration of manipulator arm loading duration of robot elements loading diagram load action load action load action load factor load factor characteristic under load load characteristic curve load curve loading line moment of load load point load regulation load controller change in load load circuit load test load vector loading capacity document handling holding time busy relay instruction algorithm lighting installation stran 41 od 326 EN ‐DE: slovar avtomatizacije in robotike Beleuchtungspegel Beleuchtungsregulierung beliebig definierte Raumkurve beliebige Folge beliebige Konstante beliebige Parametervariation Belüftungsanlage Belüftungsanlage Benutzerausgangsinformation Benutzerbibliothek Benutzerkode benutzerorientierte Robotertrajektorie Benutzerprogramm Benutzerstation Benutzung der Steuerung Benutzungsdauer Benzindruckmesser beobachtbares System Beobachtbarkeit Beobachtbarkeitsmatrix beobachten Beobachterfehler Beobachtung Beobachtung Beobachtungsfehler Beobachtungsfehlergleichung Beobachtungsmatrix Beobachtungsmodell Beobachtungsnormalform Beobachtungsvektor berechnen berechnen berechnete Gasgeschwindigkeit berechnete Leistung berechnete Roboterbahnsegmente npi berechnete Roboterkinematik berechnete Robotertrajektorie Berechnung Berechnung Berechnung der Gelenkreaktion Berechnung von Integralen Berechnungsalgorithmus Berechnungsinitialisierung Berechnungsinitialisierung Berechnungsmathematik Berechnungsmethode Berechnungsprinzip Berechnungsprinzip Berechnungssystem Bereich Bereich für die zulässigen Abweichungen Bereich höchster Strommessergenauigkeit Bereichsinstellung Bereichsinstellung Bereichssteuerungstask Bereichssteuerzentrale Bereichsumschaltung Bereichsumschaltung Bereitschaftsbetrieb Bereitschaftsbetriebsstrom Bereitschaftssystem Bereitschaftssystem Bereitschaftszustand Bereitschaftszustand Bereitserweiterung Bereitstellung von Werkstücken Bereitstellungsmethode Bergbauroboter Berichtigung Berichtigungsangaben Berichtigungsbefehl Berichtigungsfaktor Bernoullische Gleichung beruhigen Beruhigungszeit Berührungselement illumination level lighting control arbitrary definite space curve arbitrary sequence arbitrary constant random parameter variation air ventilation system fan system user exit information user library user code user‐oriented robot trajectory user program user station use of control period of use gasoline pressure gauge observable system observability observability matrix observe v personal error observer observer based control observer‐error observer‐error state equation observer matrix observer model observable canonical form observer vector calculate v compute v calculated gas velocity calculated power calculated robot path segments calculated robot kinematics calculated robot trajectory calculation computation calculation of joint reaction evaluation of integrals calculation algorithm calculation initialization computation initiation calculus mathematics calculation method calculation principle computing principle computing system range region of admissible deviations accurate current range of a meter band adjustment range adjustment region control task area control centre, ACC range changing range switching standby mode standby current backup system standby system standby condition standby status range extension making available of work‐pieces method of solutions sewing mining robot corrective action correction data adjustment instruction correction factor Bernoulli equation deenergize damping time contact element, contact piece stran 42 od 326 EN ‐DE: slovar avtomatizacije in robotike Berührungselement Berührungselement Berührungselement berührungsfreier Drehzahlmesser berührungsfreies Messverfahren Berührungskontakt berührungslose berührungslose berührungslose berührungslose Dichtemessung berührungslose Dickenmessung berührungslose Zeigerabtastung berührungsloser Sensor Berührungssensor Berührungssensor eines IR Berührungssensorsystem Berührungsspannungsmesser beschichtete Sensorfaser Beschicken eines IR Beschickung Beschickungsaufgabe (eines Roboters) Beschickungseinrichtung Beschickungsfaktor Beschickungskoeffizient Beschickungsmanipulator Beschickungsmanipulator Beschickungsmanipulator Beschickungsprogramm Beschickungsroboter Beschickungsschema Beschickungssystem Beschickungstechnik Beschickungsvorrichtung Beschickungsweise Beschickungszyklus beschleunigen Beschleuniger beschleunigte Prüftechnik beschleunigter Speicheradapter beschleunigter Speicheradapter beschleunigter Speicheradapter Beschleunigung Beschleunigungsabweichung Beschleunigungsanzeiger Beschleunigungsaufnehmer Beschleunigungsaufnehmer Beschleunigungsaufnehmer Beschleunigungsbetrag Beschleunigungselektrode Beschleunigungsfehlabgleichung Beschleunigungsfühler Beschleunigungsfühler Beschleunigungsfühler Beschleunigungskonstante Beschleunigungsmesser Beschleunigungsmessung Beschleunigungsphase eines Roboters Beschleunigungsraum Beschleunigungsregler Beschleunigungsrelais Beschleunigungssensor eines Roboters Beschleunigungsspannung Beschleunigungsstörung Beschleunigungsträgheit Beschleunigungsverzögerung Beschleunigungswandler Beschleunigungswert Beschleunigungszeit (eines Roboters) beschränkt beschränkte Ausgangsgröße f beschränkte Eingangsgröße f beschreibbarer Steuerspeicher beschreibendes Modell Beschreibungsdatei Beschreibungsfunktion Besetztrelais contact member contact element contact piece touchless revolution counter non‐contact measurement technique tangential contact contactless pick‐up non‐contact feeler device non‐contacting sensor non‐contacting density measurement non‐contacting thickness gauging contactless scanning of pointers non‐contacting sensor contact sensor robot contact sensor, IR contact sensor contact sensor system contact voltmeter coated sensor fibre feeding of IR, loading (charging) of IR loading loading task (of robot), feeding task loading device load factor charge coefficient charging manipulator, loading handler charging manipulator loading handler charging program feeding robot, charging (loading) robot loading pattern feed[ing] system loading technique feeding equipment method of charging charging cycle accelerate v accelerator accelerated test technique accelerated storage adapter ASA, accelerated memory adapter, accelerated memory adapte accelerated memory adapter acceleration acceleration misalignment acceleration indicator acceleration gauge acceleration pickup acceleration sensitive element acceleration value accelerating electrode acceleration misalignment acceleration gauge acceleration pickup acceleration sensitive element acceleration constant accelerometer acceleration measurement acceleration phase of robot acceleration space acceleration controller accelerating relay acceleration sensor, accelerating sensor (of robot) accelerating voltage acceleration misalignment acceleration lag acceleration lag acceleration transducer acceleration value acceleration time (of robot) bounded bounded output bounded input writable control store descriptive model description file describing function busy relay stran 43 od 326 EN ‐DE: slovar avtomatizacije in robotike Besetztsignal besonderes System Bessel‐Funktion bestimmungsgemäßer Betrieb Bestimmungsgleichung Bestimmungsmethode Bestkodierung Bestückungskopf Bestückungsroboter Bestzeitprogramm Bestzeitprogramm betätigen Betätigung durch Stellmotor Betätigung einer Schutzeinrichtung Betätigung mit Kraftantrieb Betätigungsfolge Betätigungsgröße Betätigungsimpuls Betätigungsimpuls Betätigungsimpuls Betätigungsorgan Betätigungsorgan Betätigungsorgan Betätigungsorgan Betätigungsorgan Betätigungssignal Betätigungssystem Betätigungsvorrichtung Betätigungszeichen betonen betonen Betrachtungsweise Betragsoptimum Betragsregelfläche betreiben Betrieb in mehreren Arbeitsweisen Betrieb mit Vorbereitung Betrieb oberhalb der Schwelle Betrieb von Anlagen betriebliches Abfahren Betriebsanleitung Betriebsart Betriebsart des Informationsaustausches Betriebsart einer Arithmetik‐Logik‐Einheit Betriebsart eines Nachrichtensystems Betriebsartenänderung Betriebsarteneinstellung Betriebsartenschalter Betriebsartenwahlschalter betriebsbedingte Abschaltung betriebsbedingter Fehler betriebsbedingter Fehler Betriebsbedingungen Betriebsbereitschaft Betriebsbereitschaft betriebsbezogener Schaden Betriebscharakteristik Betriebscharakteristik Betriebsdaten pl Betriebsdaten pl Betriebsdaten pl Betriebsdaten pl eines Robotersteuerungssystems Betriebsdiagnostik Betriebsdruck Betriebsdruck Betriebseinspeisung Betriebseinspeisung Betriebseinstellung Betriebserfahrungen betriebsfähig betriebsfähig Betriebsfähigkeit Betriebsfähigkeit Betriebsfaktor Betriebsfehler Betriebsfehler busy signal particular system Bessel function normal operation defining equation method of determination optimum coding mounting head mounting robot, assemblage robot, industrial robot for mount minimum access routine optimally coded program actuate v power operation protective equipment operation power operation operation sequence actuating quantity actuating pulse control pulse driving pulse actuating appliance actuating unit regulating element effector regulating unit actuating signal actuating system actuating device acknowledge[ment] signal accentuate v emphasize v approach amplitude optimum integral of absolute value of error (IAE) operate v multimode operation delay basis operation above‐threshold operation plant operation operational shutdown operating instruction operation mode communication mode operation mode of arithmetic‐logic unit, ALU‐mode of operatio communication system mode mode change adjusting of mode of operation operating mode switch operating mode switch operational shutdown abuse operation error operating conditions operability operational capability operation's related defect operating characteristic working characteristic operating values, operating data operating values operating data functioning values of robot control system, operating values o operational diagnostics operating pressure working pressure process feed operational feed operating adjustment operating experience operable workable operability operational capability duty factor abuse operation error stran 44 od 326 EN ‐DE: slovar avtomatizacije in robotike Betriebsfernmeldung Betriebsforschung Betriebsfrequenz Betriebsgrenze Betriebsinformationssystem Betriebsinstrument Betriebskennwert Betriebskoeffizient Betriebskondensator Betriebskondensator Betriebskontrolleinrichtung mit Datenabtastung Betriebslast Betriebsleistung Betriebsmanometer Betriebsmesstechnik Betriebsmittelüberwachung Betriebsoptimierung Betriebspunkt Betriebsrechnersystem Betriebsschema Betriebssicherheit eines Industrieroboters Betriebssicherheit service Betriebssicherheit service Betriebsspannung Betriebsspannung Betriebsstellung Betriebsstellung Betriebsstellung Betriebsstörung Betriebsstörung Betriebsstrom Betriebssystem Betriebssystem (für Robotersteuerung) Betriebssystem für alphanumerische Datenendstellen Betriebssystemsoftware (eines Roboterrechners) Betriebstemperaturbereich Betriebstransiente Betriebstüchtigkeit Betriebstüchtigkeit Betriebsüberwachung Betriebsüberwachungsgeräte Betriebsüberwachungsgeräte Betriebsüberwachungsgeräte Betriebsweise Betriebswinkel Betriebswirkungsgrad Betriebswissenschaft Betriebszustand Betriebszustand Betriebszustand Betriebszustand Betriebszustand Betriebszustandsüberwachung Bettführungsbahn Bettführungsbahnen mit gehärteten Stahlleisten Beugungsfinger bevorzugte Roboterorientierung bewegbarer Greiferbacken Bewegen eines Bauteils bewegliche Ladung beweglicher (fahrbarer) Roboter beweglicher Einfügekopf beweglicher Erfassungssensor beweglicher Kopf beweglicher Manipulatorschlitten beweglicher Sensor bewegliches Festkörperglied bewegliches Robotermagazin bewegliches System Beweglichkeit des Manipulators Beweglichkeitsgrad Beweglichkeitsgrad eines IR Bewegung Bewegung eines Transportbandes Bewegungsablauf Bewegungsachse industrial remote signalling industrial research operating frequency operating limit operating information system industrial instrument operating parameter operation factor operating condenser process condenser monitoring machine with scanning rated capacity operating power operating gauge production measuring technique supervision of production facilities operating optimization operating point plant computer system engineering flow sheet operation safety of industrial robot, reliability in service of ind equipment reliability safety of operation operation voltage normal voltage working position operative position operating position operating trouble service failure process stream operating system operation system (for robot control) alphanumeric terminal executive, ANTEX operating system software (of robot computer) operating temperature range operational transient operability operational capability production control process instrumentation monitoring instrumentation monitoring equipment mode operating angle operating efficiency management science operating state operational condition, working condition operational condition operating status working condition operational condition monitoring bed way, bed slide way bed ways equipped with hardened steel gibs diffraction finger preferred robot orientation movable gripper jaw movement of element mobile charge mobile robot mobile insertion head mobile acquisition sensor moving head mobile manipulator sled, mobile manipulator carriage mobile sensor mobile solid[‐state] element mobile magazine of robot moving system manipulator mobility, mobility of manipulator mobility degree degree of mobility of IR, robot mobility degree motion movement of conveying belt sequence of motions movement axis stran 45 od 326 EN ‐DE: slovar avtomatizacije in robotike Bewegungsanfangspunkt Bewegungsbedingung"eines Werkstücks Bewegungsbedingung eines !R Bewegungsbefehl Bewegungsbefehl eines Manipulators Bewegungsbefehl eines Roboters Bewegungsbegrenzung Bewegungsbegrenzung Bewegungsbereich eines Greifers Bewegungseinheit Bewegungseinheit eines Greifers Bewegungsendkontrolle (des Manipulatorarms) Bewegungsendpunkt Bewegungsführung Bewegungsgleichung Bewegungsgleichung Bewegungsgleichung Bewegungsglied Bewegungsgröße eines IR Bewegungskoordinatensystem Bewegungsparameter eines Greifers Bewegungsposition Bewegungsprogramm einer IR‐Software Bewegungsprogrammierung Bewegungspunkt (einer Greiferbahn) Bewegungspunktprogrammierung Bewegungsraum eines Roboters Bewegungsschritt Bewegungsschritt eines Industrieroboters Bewegungssequenz Bewegungssimulation Bewegungsstabilität Bewegungssteuerung Bewegungssteuerung (eines Bewegungsstopp Bewegungsstopp eines Roboters Bewegungsstrategie Bewegungsverhalten Bewegungszyklus Bewegungszyklus eines .IR Bewegungszyklus eines Manipulators Beweismethode Bewertung Bewertung Bewertungsergebnis einer Robotermontage Bewertungsfaktor Bewertungsgröße Bewertungsmethoden Bewertungsmodell Bewertungssteuerung Bewertungstest Bewilligungsebene bezeichnen Bezeichnung der Bewegungsachsen Beziehung Beziehung zwischen Manipulator und Speicher bezogene Genauigkeit bezogene Größe bezogene Größe bezogene Größe bezogener Regelbereich Bezugsangaben Bezugsdämpfung ### Übertragungssystems Bezugsdaten pl Bezugselement Bezugsgerät Bezugsgröße Bezugsgröße Bezugsmenge Bezugspegel Bezugspunkt Bezugsrückkopplung Bezugssignal Bezugsspannung Bezugsspannungsstabilisator Bezugssystem initial point of movement movement condition of condition of movement of IR, robot movement condition movement instruction manipulator movement instruction robot movement instruction movement ifmitation movement limitation region of gripper motion (movement) movement unit, motion unit movement unit of gripper, motion unit of gripper checking of movement finish (of manipulator arm) end point of movement movement guiding equation of motion equation of motion, motion equation motion equation joint, acting element movement quantity of tR, motion quantity of IR movement coordinate system gripper movement parameter movement position movement program of IR~ software, motion program of IR‐so movement programming movement point, point of movement programming of movement points space of movement of robot movement step robot movement step, industrial robot movement step movement sequence simulation of movement movement stability movement control movement control (of manipulator) movement stop robot movement stop movement strategy behaviour of motion welding robot movement cycle movement cycle of IR, robot movement cycle manipulator movement cycle, handler movement cycle method of proof appreciation evaluation valuation result of robot assembly evaluation factor evaluation quantity evaluation methods evaluation model evaluation control rate test compliance level identify v marking of axis relation[ship] memory‐manipulator relation, store‐manipulator relation calibrated accuracy dimensionless coefficient dimensionless value non‐dimensional value relative control range reference data effective transmission equivalent reference data reference element reference instrument reference quantity reference value reference quantity reference level reference point reference feedback reference signal reference voltage reference voltage stabilizer reference system stran 46 od 326 EN ‐DE: slovar avtomatizacije in robotike Bezugstaktgeber Bezugswicklung Biaxspeicherelemente für Programmspeicher bidirektionaler Koppler Biegeverlagerung eines IR biegsame Abdichtung biegsamer Antrieb eines Industrieroboters biegsamer Roboterantrieb bikonischer Taper Bilanzgleichung Bilanzierungsvariable bilateraler Wandler bilaterales Schaltelement bilaterales Servosystem bilaterales Servosystem Bild Bild Verarbeitungsmodul Bildanalyse Bildanalysesoftware Bildaufnahme durch Sensor Bildauswertesystem Bilddsignalamplitude Bildeingabeinterface Bilderfassung Bilderkennung Bildfeldzerlegung Bildfeldzerlegung Bildfeldzerlegung Bildflächensensor Bildgleichrichter Bildimpuls Bildprozessor Bildschirm eines IR Bildschirmeinheit Bildschirmeinheit Bildschirmgerät Bildschirmkonsole bildschirmorientierte Datenstruktur bildschirmorientierte Datenstruktur vision bildschirmorientierter Arbeitsplatz Bildschirmprogramm Bildschirmterminal Bildschirmüberwachung Bildsensor Bildsignal Bildsignalamplitude Bildsignalverarbeitung Bildspeicher Bildspeicherrahmen Bildspeicherung Bildspeicherzugriff Bildsteuerung Bildsystem Bildübertrager Bildübertragung der Stufenfunktion Bildung der Konjunktion Bildverarbeitung Bildverarbeitungsmodul Bildverarbeitungssystem Bildvermessung Bildvermessung Bildvermessung Bildvorbehandlung Bildwandlerchip Bildwandlerröhre Bildwandlersystem Bilinearform Bilineartransformation Binär‐ Dezimal‐Umwandlung binär kodierte Zahl binär kodierte Zahl Binärbild Binärbilderzeugung Binärdarstellung Binär‐Dezimalkonvertierung binäre Aufzeichnung reference clock reference winding bias storage elements for program registers bidirectional coupler bending displacement of IR flexible sealing flexible robot drive, flexible IR drive flexible robot drive, flexible IR drive biconical taper balance equation balancing variable bilateral transducer bilateral switching element bilateral servosystem bilateral servo‐system image image processing module image analysis image analysis software vision pick‐up by sensor picture evaluation system video amplitude image input interface image acquisition image identification balayage scanning exploration image area sensor video detector frame impulse image processor robot display display device display unit screen device display console screen‐oriented data structure screen‐oriented data structure screen‐oriented workplace display program screen terminal screen monitoring image sensor picture signal picture signal amplitude image signal processing image memory, image store frame of image storage image storage image memory access, image store access picture control visibility system image translator step function transformation conjunction operation image processing image processing module image processing system photogrammetry picture measuring image measuring image pretreatment optical image chip image converter tube image transducer system bilinear form bilinear transformation binary‐[to‐]decimal conversion dual‐coded number binary‐coded number binary image production of binary image binary representation binary‐[to‐]decimal conversion binary recording stran 47 od 326 EN ‐DE: slovar avtomatizacije in robotike binäre Information binäre Operation binäre PCM‐Modulation binäre Schreibweise binäre Skalenschaltung binäre Struktur binäre synchrone Kommunikation binäre synchrone Kommunikation binäre synchrone Steuerung binäre synchrone Steuerung binäre Übertragung binäre Zahlendarstellung binäre Ziffer binäre Ziffer Binärelement binärer arithmetischer Rechner binärer Ausgang binärer Automat binärer Befehl binärer Befehl binärer Digitalrechner binärer symmetrischer Kanal binärer Tastsensor binäres Ausgangssignal binäres Informations‐ und Steuersignal binäres Problem binäres Signal binäres Signal binäres Speicherglied binäres Suchen binäres Suchverfahren binäres Symbol Binärgeber Binärgewicht Binärkette Binärkode Binärkomma Binär‐Reflex‐Kode Binärsensor Binärskale binär‐synchrone Übertragung f(von Roboterdaten) Binärsystem Binärwerte Binärziffer Binärziffer Bindefähigkeit Bindungsenergie Bindungsenergie Bindungsenergiedichte Binghamsches Modell Binomialkoeffizient Binomialsatz binomischer Koeffizient Bin‐Picking‐Roboter biochemischer Sensor Biocomputer Biocomputer Biofilmreaktor Bio‐Hand feines IR Biokybernetik Biokybernetik biologische Simulation biologischer Sensor biologisches Informationssignal biologisches System biometrische Identifizierungssysteme Bionik Bionik Bioniksystem bionische Simulation bionisches System Bipolarbaustein bipolarer Festwertspeicher m bipolarer mikroprogrammierter Mikrorechner bipolarer mikroprogrammierter Mikrorechner bipolarer Mikroprozessor binary information binary operation binary pulse‐code modulation binary notation binary scaling circuit binary structure binary synchronous communication binary synchronous communication, BSC binary synchronous control binary synchronous control, BSC binary translation binary notation binary digit bit binary element binary arithmetic computer binary output binary automaton binary command binary signal binary digital computer binary symmatric channel binary touch sensor binary output signal binary information and control signal binary problem binary command binary signal binary storage element binary look‐up binary search method binary symbol binary sensor binary weight binary chain binary code binary point binary reflex‐code binary sensor binary scale binary synchronous transmission (of robot data) binary number system binaries binary digit bit binding property binding energy linking energy cohesive energy density Bingham model binomial coefficient binomial theorem binomial coefficient bin‐picking robot biochemical sensor biological computer biocomputer biofilm reactor bio‐hand of IR, robot bio‐hand biocybernetics bionics biologic simulation biological sensor biological information signal biologic system biometric identification systems biocybernetics bionics bionic system bionic simulation bionic system bipolar device bipolar read‐only memory, bipolar microprogrammed microcomputer bipolar micro‐programmed microcomputer bipolar microprocessor stran 48 od 326 EN ‐DE: slovar avtomatizacije in robotike bipolarer Nur‐Lese‐Speicher bipolarer Transistor (einer Robotersteuerung} bipolares Scheibenelement Bipolarschaltkreis Bipolartechnik Biprozessorsystem Biprozessorsystem bistabile Einrichtung bistabile Kippschaltung bistabile Schaltung bistabiler Multivibrator bistabiles Element bistabiles Impulsrelais bistabiles Lasergerät bistabiles optisches Element Bit Bit Bitaper Bitdichte Bitfolgefrequenz Bitgeschwindigkeit Bitkontrolle Bitmarke Bitmarkenfolge Bitniveau Bits pro Sekunde Bits pro Zoll Bitscheibenrechner Bitstand Bit‐Übertragungsgeschwindigkeit Bitverkehr Blackbox Blackbox‐Analyse black‐box Blackbox‐Methode Blasenspeicherbaustein bleibende Regelabweichung bleibende Regelabweichung bleibende Regelabweichung bleibende Regelabweichung bleibende Regelabweichung bleibende Ungleichförmigkeit bleibendes Hauptsteuerprogramm permanent Blinddiagrammpaneel Blindleistungsmesser Blindleistungsmessung Blindstromverbrauchsmesser Blindstromverbrauchsmesser Blindwiderstand Blinksignal Block Block[ier]generator Block[ier]generator Blockadresse Blockanpassung Blockaustausch Blockaustausch Blockbild Blockbild Blockbild Blockbild‐Compiler Blockdiagramm Blockierbefehl Blockierdetektor Blockierimpuls Blockierimpuls Blockierkondensator Blockierkontakt Blockierschaltung Blockiersignal Blockiersignal Blockierung Blockierung blockierungsfrei blockierungsfreie Anordnung Blockierverstärker Blocklänge BROM, bipolar fixed memory bipolar transistor (of robot control) bipolar slice element bipolar integrated circuit bipolar technique biprocessor system Bi‐processor system bistable device trigger pair circuit bistable circuit bistable multivibrator bistable element bistable pulse relay laser bistable device bistable optical element binary digit bit biconical taper bit density bit rate, BR bit rate, BR bit check bit mark bit mark sequencing, BMS bit level bits per second, BPS bits per inch, BPI bit disk computer bit level bit rate bit traffic black box black‐box method black‐box method bubble [memory] chip droop offset offset steady‐state deviation steady‐state error sustained deviation permanent droop permanent main control program mimic diagram panel varmeter reactive power measurement reactive‐energy meter var‐hour meter reactance flashing signal block blocking generator blocking oscillator block address block adaptation block changing block changing, BCH block diagram schematic diagram functional block diagram block diagram compiler block diagram blocking order lock‐in detector blocking impulse disabling pulse blocking capacitor blocking contact clamping circuit inhibiting signal disabling signal blocking interlock[ing] nonblocking nonblocking configuration lock‐in amplifier block size stran 49 od 326 EN ‐DE: slovar avtomatizacije in robotike Blockname blockorientierte Simulation blockorientierte Struktur blockorientierter Rechner blockorientierter wahlfreier Zugriff blockorientierter wahlfreier Zugriff Blockprotokoll Blockprüffolge Blockschaltbild Blockschaltbild Blockschaltbild Blockschalter Blockschema Blockschema Blockschema Blocksignal Blockstromkreis Blockstromkreis blockweise Verarbeitung Blockzeichnung f Blockzeichnung f Blockzeichnung f Bode‐Diagramm BODE‐Diagramm BODE‐Diagramm Bode‐Methode bohren (durch Roboter) bohren (durch Roboter) Bohrroboter für gedruckte Schaltungen Bolometer bolometrisches Instrument Boltzmann‐Konstante Boltzmannsches Superpositionsprinzip Bolzenfügesystem Bondgeschwindigkeit thermocompression Boolesche Algebra Boolesche Algebra Boolesche Algebra Boolesche Darstellung Boolesche Funktion Boolesche Logik Boolesche Logik Boolesche Rechnungsart Boolesche Variable Boolescher AL‐Ausdruck Boolescher Prozessor Boolescher Wert Bordrechner Box‐Jenkins‐Modell Box‐Jenkins‐Modell Brandbekämpfungsroboter brauchbarer Bereich Braunsches Elektrometer Breaksignal Breaksignal Breitbandfilter Breitbandfilter breitbandiges Fernmeldesystem breitbandiges Infrarotsystem Breitbandimpulsverstärker Breitbandmodulation Breitbandoszillograf Breitbandregler Breitbandtemperaturregler Breitbandverstärker Breitbereichregler Breiteneinstellung Breitwinkelkoordinator Bremsdynamometer Bremsdynamometer Bremselement Bremsventil Brennschneidautomat Brennschneidautomat Brettschaltung BROM block name block‐oriented simulation block‐oriented structure block‐oriented computer, BOC block‐oriented random access block‐oriented random access, BORAM block protocol block check sequence block diagram schematic diagram functional block diagram gating switch block diagram schematic diagram functional block diagram blocking signal blocking circuit interlock circuit batch processing block diagram schematic diagram functional block diagram Bode diagram Bode plot frequency response graph Bode method bore to drill to (by robot) drill robot for printed circuits bolometric instrument bolometric instrument Boltzmann constant Boltzmann's superposition principle joint system of bolt bonding speed Boolean logic algebra of logic Boolean algebra Boolean representation Boolean function Boolean logic crisp logic Boolean calculation Boolean variable Boolean AL expression Boolean processor Boolean value board computer BJ‐model Box‐Jenkins model fire‐fighting robot usable range Braun electrometer interrupt[ing] signal break signal all‐pass filter all‐pass element wideband communication system wide‐passband infrared system wideband pulse amplifier broadband modulation wideband oscillograph wideband controller wide range temperature controller broadband amplifier wideband controller width adjustment wide‐angle coordinator absorption dynamometer brake dynamometer braking element brake valve automatic flame‐cutting machine automatic gas‐cutting machine breadbord circuit BROM, bipolar fixed memory stran 50 od 326 EN ‐DE: slovar avtomatizacije in robotike Brückendetektor Brückengleichgewicht Brückenkreis mit Nullanzeige Brückenmessungen Brückenmethode Brückenschaltung Brückenschaltung Brückenstruktur Brummspannung Brummspannungsdifferenz Brummspannungsverhältnis Buchsenfeld Buchstabe Buechesches Modell Burgers‐Frenkelsches Modell Busaufruf Busfamilie Busfreigabe Buskommunikationskarte Buslogik Buslogik zur Behandlung vektorisierter Unterbrechungen Busoperation Busorganisation (eines Roboterrechners) busorganisierte Struktur Busprioritätssteuerung Busprotokoll Busschienensystem Busschnittstelle Bussteuerschaltkreis Bus‐steuerschaltkreis Bussteuerschaltung Busstruktur busstrukturiertes System Bussynchronisationstakt Bussystem Bustakt Bustakt Busverbindung Busverkehr Busvermittlungssignal Buszuweisung Byte Bytebetrieb Bytegeschwindigkeit Bytegrößensteuerung byteorientierter Rechner Byterechner Byte‐Seriendaten pl bytes Bytespezifizierung Bytestrom Bytestromprotokoll byteweiser Betrieb Cachespeicher‐Steuerregister CAD CAD manufacturing s 2870 CAD manufacturing s 2870 CAD manufacturing s 2870 CAD‐Bibliothek CAD‐Technik ordinateur Carnot‐Wirkungsgrad Cauchy‐Folge Cauchysche Lineargleichung Cauchy‐Schwarzsche Ungleichung Cayley‐Hamiltonsches Theorem CCD‐Bauelement CCD‐Kamera CCD‐Sensor CCD‐Sensor CCD‐Sensor Chapman‐Kolmogoroffsche Gleichung Charakterisierung von logischen Schaltungen Charakteristik Charakteristik Charakteristikenmethode charakteristische Angaben des Rechners charakteristische Funktion bridge detector bridge equilibrium null‐type bridge circuit bridge measurements bridge method bridge circuit bridge connection bridge structure ripple voltage ripple potential difference percent ripple voltage jack panel alphabetic character Bueche model Burgers‐Frenkel model bus enable, BUSEN bus family bus enable, BUSEN communication card for bus bus logic bus vectored interrupt logic bus operation bus organization (of robot computer) bus‐organized structure bus priority control bus protocol bus bar system bus interface bus control circuit bus control circuit bus control circuit bus structure bus‐structured system bus clock bus system bus clock bus dock bus connection bus traffic bus exchange signal bus allocation byte byte mode byte rate byte size control byte‐oriented computer byte‐oriented computer byte serial data byte specification byte stream byte stream protocol byte mode cache control register computer‐aided drafting and design, CAD, computer‐aided des computer‐aided design CAD computeraided conception computer‐aided design library computerized design technique Carnot efficiency Cauchy sequence Cauchy's linear equation Cauchy‐Schwarz inequality Cayley‐Hamilton theorem CCD‐component CCD camera charge‐coupled device sensor, CCD‐sensor charge‐coupled device sensor CCD‐sensor Chapman‐Kolmogoroff equation characterization of logic circuits characteristic characteristic curve characteristic method characteristic data of computers characteristic function stran 51 od 326 EN ‐DE: slovar avtomatizacije in robotike Charakteristische Funktion einer Menge Charakteristische Gleichung charakteristische Gleichung charakteristische Limitfunktion charakteristische Roboterflexibilität charakteristische Servomechanismuskonstanten charakteristische Zeit charakteristischer Abstand charakteristisches Gleichungssystem charakteristisches Polynom charakteristisches Polynom chargenweise Chargierung chemische Verfahrenstechnik chemisch‐technologisches System chemisch‐technologisches System Chip eines SRAM‐Speichers Chipauswahlsignal Chipklebeautomat Chipkleben durch Roboter chromatografisches Analysiergerät Chrominanz‐Austastkreis Clausius‐Rankine‐Prozess Clipper Clipper Clipper Clipper CNC für IR CNC‐Komponente eines IR Coanda‐Effekt Compiler Compiler Compiler einer Robotersoftware Compiler‐Beschreibungssprache Compiler‐Programmübersetzung Compiler‐Simulation Compiler‐Zwischenkode Compoundierung von Elektromaschinen Computer Computer Computer Computer Computer für Qualitätskontrolle Computer für Reaktortechnik Computeranimation Computerarbeitsmodell Computerbauelemente computergesteuertes Anheben von Stoffballen computergestützte Diagnostik computergestützte Fertigung production computergestützte Herstellung computergestützte Steuerdatenerzeugung computergestützte Untersuchung Computergrafik Computergrafik Computergrafikanwendung computergrafisches Arbeitsmodell Computerindustrie Computerterminal computerunterstützte Verfahrenserkennung ordinateur computerunterstützter Entwurf computerunterstützter Entwurf computerunterstützter Entwurf computerunterstütztes Ingenieurwesen Copy‐Prüfung Coulombsche Reibung Coulombsche Reibung CP‐Robotersteuerung CP‐Steuerung Cramersche Regel Cross‐Assemblierung Cross‐Entwicklungssystem Cross‐Simulation‐Testsystem Cross‐Simulator CRST D > 1 characteristic function characteristic equation eigenvalue equation limiting characteristic function characteristic robot flexibility servomechanism characteristic constants characteristic time characteristic spacing characteristic equation system characteristic polynom characteristic polynomial batchwise batching chemical process engineering chemical‐technological system chemical process system SRAM‐chip, chip of static random access memory chip select signal chip adhering automaton adhering of chips by robot chromatographic analyzer burst gating circuit Clausius‐Rankine process clipper limiter restrictor delimiter computerized numerical control of IR CNC‐component of IR Coanda effect compiled program compiler compiler of robot software compiler description language, CDL compiler program translation compiling simulation compiler intermediate code electric machine compounding computer computing machine calculating machine calculator computer for quality control computer for reactor engineering computer animation computer operation model computer hardware computer‐controlled lifting of cloth bales computer‐assisted diagnostics computer‐aided manufacturing computer‐aided production computer‐aided control data generation computer‐aided investigation computer graphic computer graphics computer graphics application computer‐graphical operation model computer industry computer terminal computer‐aided process identification computer‐aided design CAD computeraided conception computer‐aided engineering copy check Coulomb friction [force] dry friction continuous path robot control continuous path control, CP control, path control Cramer's rule cross‐assembly (by assembler) cross‐development system cross‐simulation testing] system, CRST cross simulator cross‐simulation testing] system, CRST aperiodic damping stran 52 od 326 EN ‐DE: slovar avtomatizacije in robotike D > 1 overdamped Daisy‐Chain‐Interruptbedienung daisy‐chain interrupt servicing daisy‐chain priority interrupt logic Daisy‐Chain‐Interruptprioritätslogik Daisy‐Chain‐Interruptstruktur daisy‐chain interrupt structure Daisy‐Chain‐Struktur daisy‐chain structure DAM‐Baustein DAM element Dampfabwurfregler main steam maximum pressure controller Dampfapparat steam apparatus dämpfende Spitzenfrequenz attenuation peak frequency Dämpfer damper Dämpfer damping device Dämpfer antivibrator Dämpfer der Flusspulsierung oscillations pulsatoires flow‐pulsation damping system Dämpfer eines Robotergetriebes robot antivibrator Dampfregler steam regulator attenuation Dämpfung damping Dämpfung Dämpfung damping action Dämpfung durch zufallsverteilte Krümmungen random bend loss Dämpfungsabnahme damping decrement Dämpfungsausgleicher attenuation compensator dämpfungsbegrenzter Betrieb attenuation‐limited operation Dämpfungsbereich attenuation region Dämpfungsbetrieb attenuation regime attenuation characteristic Dämpfungscharakteristik Dämpfungsdekrement damping decrement Dämpfungseinstellung damping adjustment Dämpfungselement damping element Dämpfungsentzerrer attenuation compensator Dämpfungsfaktor attenuation factor damping factor Dämpfungsfaktor Dämpfungsfaktor damping coefficient Dämpfungsglied damper Dämpfungsglied damping device Dämpfungsglied antivibrator Dämpfungsgrad attenuation degree Dämpfungsgrad degree of attenuation damping coefficient Dämpfungskoeffizient damping constant Dämpfungskonstante Dämpfungskonstante decay constant Dämpfungskreis damping circuit Dämpfungsmagnet damping magnet Dämpfungsmedium attenuating medium Dämpfungsmesser decremeter Dämpfungsmessung attenuation measurement Dämpfungsmoment damping couple Dämpfungsmoment damping moment Dämpfungsmoment damping torque Dämpfungsnetzwerk attenuator Dämpfungsspektrum spectral attenuation damping ratio Dämpfungsverhältnis Dämpfungsvorrichtung damper Dämpfungsvorrichtung damping device Dämpfungsvorrichtung antivibrator attenuation value Dämpfungswert Dämpfungswiderstand damping resistance damping time Dämpfungszeit Dämpfwirkung damping action DANN‐Teil conclusion consequent DANN‐Teil einer Regel rule‐consequent part DANN‐Teil einer Regel Darstellung einer Erscheinung event representation presentation device Darstellungseinrichtung Darstellungsfehler display error darstellungsorientierte (zeichnungsorientierte) Beschreibungrepresentation oriented description darstellungsorientierte Erfassung representation oriented acquisition Datei file Datei für Technologiebeschreibung technology description file Datei für Prüf Operationen checking operation file Datei zur Beschreibung von Montageoperationen assembly operation file Dateibeschreibungsattribut file description attribute Dateiformat file format Dateischutzfunktion file protection function Dateisteuerung file control Dateiverwaltungssystem file management system Daten der Tragekapazität supporting capacity data stran 53 od 326 EN ‐DE: slovar avtomatizacije in robotike Daten einer Manipulatorsteuerung Daten eines Industrieroboters Daten für Montagegeschwindigkeit Daten pi des Robotergewichts Daten pl Daten pl einer Manipulatorsteuerung Daten pl eines Handhabeprozesses Daten pl für Fertigungszeiten Datenabnehmer Datenabnehmer Datenadresse Datenannahme Datenanzeiger Datenart Datenausgabe Datenausgaberate Datenausgangsleitung Datenaustausch Datenbank für Robotik Datenbankabfrage Datenbank‐Dateiverwaltung Datenbanksystem Datenbasis Datenbereitschaftssignal Datenbereitstellzeit Datenbitumsetzer Datenblock Datenbus Datenbusanforderung Datenbyte Datenbyte Datenbytelesen Datenbyteschreiben Datendarstellung Datendarstellungstafel Dateneinführung Dateneingabe Dateneingabe in Analogrechner Dateneingabe in einen Ziffernrechenautomaten Dateneingabetechnik Dateneinheit konstanter Länge Datenempfänger Datenempfänger Datenendstelle Datenendstellensystem Datenerfassung Datenerfassung Datenerfassung Datenerfassung am Entstehungsort Datenerfassungsanlage Datenerfassungseinheit Datenerfassungsmodul Datenerfassungssystem Datenfernübertragung Datenfernverarbeitung Datenfernverarbeitungssteuereinheit Datenfernverarbeitungs‐Zugriffsmethode distance datengesteuert Datengültigkeitssignal Datenhandhabungssprache Datenkanal Datenkanal communication Datenkanalzusatzeinrichtung Datenkategorie Datenkodier[ungs]system Datenkodierung Datenkommunikationsendgerät Datenleitungssteuerung Datenlesemaske Datenleser Datenlesezeiger Datenmanagement Datenmanipulation Datenmarkierimpuls Datenmodem Datenmultiplexeinrichtung data of manipulator control robot parameters, robot data, data of industrial robot speed data, data of assembly speed robot weight data data data of manipulator control handling process data manufacturing time data acceptor of data acceptor of data, AD data address data acceptance data recorder data type data output data output rate bus‐out data exchange data bank for robotics data bank inquiry data bank file management data bank system data basis data ready signal data setup time data bit converter data block data bus data bus request, DBR byte of data data byte reading of data byte data byte writing data presentation data display panel insertion of data data input data input into analog computer data input into digital computer data input technique constant‐length data unit acceptor of data acceptor of data, AD data terminal data terminal system data acquisition data logging data collection local data collection data logging machine data‐acquisition unit data acquisition module data‐acquisition system data remote transfer data remote processing telecommunication control unit basic teleprocessing access method data‐directed data‐valid signal data manipulation language, DML data channel information channel data channel attachment data category data coding system data encoding data communication terminal data link control data reading mask, data read mask data reader data reading pointer, data pointer data management data manipulation data strobe data modem data multiplex device stran 54 od 326 EN ‐DE: slovar avtomatizacije in robotike Datenmultiplexierung data multiplexing data net control Datennetzsteuerung Datenpaketsystem data packet system Datenpaketvermittlungssystem data packet switching system Datenprüfanzeiger data check indicator Datenprüfprogramm data checking program Datenprüfung data checking Datenreduktion data reduction Datenregenerierungsperiode refresh period Datenregenerierungszyklus refresh cycle Datenregistriergerät data recorder Datensatzglied data member Datenschutz data protection Daten‐Sender/Empfänger data transceiver Datensicherung data backup Datensichtstation video data terminal Datenspeicher data logger Datenspeicher data memory Datenspeicherungsvorrichtung data storage device Datensteuerblock data control block Datenstrobe data strobe Datenstruktur data structure Datenstrukturauswahl data structure selection Datensystem für Ausbildungszwecke educational data system Datenterminal data terminal Datenträgerdiskette information carrier disk, data carrier disk Datentyp data type Datentyp einer IR‐Sprache data type of IR language Datentyptransformation data type transformation Datentypumwandlung data type transformation Datenübermittler data transmitter Datenübermittlungseinrichtung data communication equipment data communication control Datenübermittlungssteuerung Datenübernahme data acceptance Datenübernahmezustand accept data state Datenübernahmezustand accept data state, ACDS Datenübertragung mit konstanter Übertragungsgeschwindigkconstant‐data rate system Datenübertragungsoperation data transfer operation Datenübertragungsprotokoll data communication protocol Datenübertragungssystem data link system Datenübertragungssystem data transmission system data transmission technique Datenübertragungstechnik Datenübertragungsverbindung data transmission link Datenübertragungsverfahren data transmission technique Datenumsetzer data converter Datenumsetzer data translator Datenunterdrückung suppression of data Datenverarbeitung data processing Datenverarbeitungsgeschwindigkeit data processing rate Datenverarbeitungsmaschine data processing machine Datenverarbeitungssystem data processing system Datenverarbeitungstheorie data processing theory Datenverarbeitungszentrum data processing centre Datenverarbeitungszentrum computing centre Datenverarbeitungszentrum für Roboterprogramme data processing centre of robot programs Datenverbindungssteuerung data link control Datenvereinbarung data convention Datenverkehrseinrichtung data communication equipment Datenverkehrssteuerung data communication control Datenverkehrssteuerzeichen data link espace character, DLE Datenverkehrsterminal data communication terminal overrun (of data) Datenverlust Datenverminderung data reduction Datenvermittlung data switching Datenverwaltung data management Datenwandler data converter Datenwandler data translator Datenwegpuffer data bus buffer Datenwort data structure data access Datenzugriff Dauerabweichungskoeffizient offset coefficient Daueraktionssystem continuous action system Daueranforderung continuous request Daueraufsicht f continuous monitoring continuous supervision Daueraufsicht f Dauerbelastung permanent load stran 55 od 326 EN ‐DE: slovar avtomatizacije in robotike Dauerbetrieb Dauerbetrieb Dauerbetrieb Dauerbetrieb mit periodisch veränderlicher Belastung Dauerbetriebsservogerät Dauermagnet dauernde Ungleichförmigkeit Dauernennstrom Dauerschwingungen Dauerstricherreger Dauerstricherregungsquelle Dauerstrichlaser Dauertest Dauertest Dauerwirkung Dauerzustand Dauerzustand DCS‐System Dead‐Beat Dead‐Beat‐Regelung Dead‐Beat‐Sprungantwort Deckenmanipulator Defektlokalisierung Defektoskopie Defektstruktur definierte Achslage definierte Bewegung definierte Bewegungsgröße eines IR definierte Einzelbewegung (eines Roboters) definierte Greiferstellung definierte Ist‐Position feines IR definierte Koordinatenlage definierte Koordinatenorientierung definierte Montageaufgabe definierte Roboterbeschleunigung definierte Roboterbewegung definierte Roboterführung definierte Robotergeschwindigkeit definierte Roboterorientierung definierte Roboterschnittstelle definierte Robotertrajektorie definierte Schnittstelle definierte Teilfunktion eines Roboters definierter Arbeitspunkt definierter Datentyp definierter Montagepunkt definierter Roboterarbeitspunkt definiertes Effektorverhalten definiertes Interface eines Roboters definiertes Roboterverhalten definiter Automat Definition feiner Roboterraumkurve Definitionsbereich Defokussierung Deformationspotential Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Defuzzifizierungsverfahren Dehnbarkeitsmesser Dehnmessstreifen Dehnung (Modifikator) Dehnung (Modifikator) Dehnungsmesser Dehydrierungsanlage permanent action continuous action continuous operation periodic duty continuous‐action servomechanism permanent magnet permanent droop continuous rated current continuous oscillations continuous exciting source continuous exciting source continuous laser long‐run test long‐time test permanent action steady state steady‐state regime diagnostic communication system of IR deadbeat deadbeat control deadbeat step response covering manipulator defect localization defectoscopy defects structure defined axis position defined movement defined motion quantity of IR defined single movement, defined individual movement (of ro defined gripper position defined actual position of IR defined coordinate position defined coordinate orientation defined assembly task defined robot acceleration defined robot movement defined robot guide defined robot speed defined robot orientation defined interface of robot defined trajectory of robot defined interface defined partial function of robot defined working point definite data type definite assembly point defined robot working point defined effector behaviour defined interface of robot defined robot performance definite automaton definition of space curve, definition of robot space curve domain of definition defocusing deformation potential center of gravity defuzzification centroid defuzzification method COG defuzzification defuzzification defuzzification method defuzzification, defuzzification method middle of maxima defuzzification Center of area (COA) defuzzification center of gravity (COG), defuzzification center of largest area defuzzification center of sums (COS) defuzzification first of maxima (FOM) defuzzification last of maxima (LOM) defuzzification max‐height defuzzification weighted average defuzzification ductilimeter resistance strain gauge dilatation dilation ductilimeter dehydrogenation plant stran 56 od 326 EN ‐DE: slovar avtomatizacije in robotike Dehydrierungsprozess D‐Einfluß‐Koeffizient D‐Einfluß‐Koeffizient Dekadenblock Dekadenschalter Dekadenwiderstand Dekadenwiderstand Dekadenzähler dekadische Konduktanz dekadischer Frequenzteiler dekadischer Kondensatorensatz Dekodieranlage Dekodieranlage dekodieren Dekodierer Dekodierer Dekodierer mit Verzögerungsleitung Dekodierschaltung Dekodierung Dekodierungsautomat Dekodierungsautomat Dekomposition Dekompositionsmethode Dekompositionsverfahren Dekrement Dekremeter D‐Element D‐Element Deltafunktion Deltafunktion Deltarauschen Demodulator demodulieren Demonstrationsmodell Demultiplexer den vorherigen Zustand wiederherstellen Densitometrie Depolarisation Depolarisationsgrad der dir Laserlinienbreite bestimmt derzeitige Systeme Destillationsanlage destruktives Lesen destruktives Lesen detaillierter Arbeitsablaufplan detaillierter Arbeitsablaufplan Detektion Detektionsgrenze Detektionsschwelle Detektor Detektor Detektor Detektor Detektor mit hohem Auflösungsvermögen Detektor mit hohem Auflösungsvermögen Detektor mit hohem Auflösungsvermögen Detektor mit hoher Empfindlichkeit Detektor mit hoher Empfindlichkeit Detektor mit niedrigem Auflösungsvermögen Detektoranalysator Detektorbaugruppe Detektorbereich Detektorblock Detektorelement Detektorelement Detektorelement Detektorelement determinierte Maschine determinierte Maschine determinierter Bewegungsablauf determinierter Prozess determinierter Roboterablauf determiniertes System deterministisch deterministischer Prozess deterministisches System dehydrogenation process derivative action coefficient derivative action factor decade block decade switch decade resistance box decimal resistance decade scaler decade conductance box decade frequency divider decade capacitance box decoder decoding machine decode v decoder decoding machine delay‐line decoder decoding circuit decoding automaton for decoding decoding automaton decomposition method of decomposition decomposition process decrement decremeter D‐element derivative‐element delta function unit impulse function delta noise demodulator demodulate v demonstration model demultiplexer undo v densitometry depolarization degree of depolarization laser‐linewidth determining mechanism current systems multiphase contactor destructive reading destructive read‐out detailed planning detailled planning inphase amplitude detection detection limit detection limit detector element sensing element sensor detector high‐resolution detector high‐detectivity detector high‐sensitivity detector high‐detectivity detector high‐sensitivity detector low‐resolution detector detector analyzer detection subassembly detection range detection subassembly detector element sensing element sensor detector determinated machine disciplined machine determinated sequence of motions deterministic process determinated sequence of robot deterministic system deterministic deterministic process deterministic system stran 57 od 326 EN ‐DE: slovar avtomatizacije in robotike dezentrale Abfrageeinheit dezentrale Datenbank dezentraler Greiferantrieb dezentraler Greiferantrieb dezentrales Prozessleitsystem dezentrales Prozessleitsystem dezentralisierte Informationserfassung dezentralisierte Informationsverarbeitung dezentralisierte Prozesssteuerung dezentralisierte Steuerung Dezibel (dB) Dezibelmessgerät Dezibelmessgerät Dezimaladdierkreis dezimal‐binärer Kode Dezimal‐Binär‐Konvertierung Dezimal‐Dual‐Umwandler Dezimal‐Dual‐Umwandlung dezimale Schreibweise dezimale Zahlendarstellung Dezimalpunkt‐Programmierung Dezimalverarbeitung Dezimalwert Dezimeterwellengerät Diagnose Diagnose Diagnose Diagnosebus Diagnosedaten pl Diagnosedaten pl Diagnoseeinrichtung Diagnosehilfen für Roboter Diagnoseinformation diagnostic Diagnoseinformation diagnostic Diagnosemaschine Diagnosemitteilung Diagnosenachricht Diagnoseprogramm Diagnoseprogramm Diagnosesignal Diagnosestrategie Diagnosesystem eines IR Diagnosetest Diagnosetest Diagnosetestsystem Diagnoseverfahren Diagnoseverfahren für Suchfehler recherche Diagonalisierung von Matrizen Diagonalmatrix Diagonalverdichter Diagramm mit gepunkteten Werten Dialogbetrieb Dialogbetrieb Dialogbetrieb Dialogbetrieb Dialogcompiler Dialog‐Dateneingabe Dialogeigenschaft dialoges System eines Roboters Dialogfähigkeit Dialogmodus Dialogmodus Dialogmodus Dialogprogrammierung eines Roboters Dialogprogrammierung für Industrieroboter Dialogroboter Dialogsprache Dialogsteuerung Dialogterminal Dialogverarbeitung Dialogverkehr Diaphanometer Diastimeter Dichteänderung Dichteanzeiger Dichtegradient decentralized inquiry unit decentralized data bank decentral drive of gripper decentralized drive of gripper decentral process guide system decentralized process guide system decentralized information acquisition decentralized information processing decentralized process control decentralized control decibel decibelmeter noise test set decimal add circuit bidecimal code decimal‐to‐binary conversion decimal‐to‐binary converter decimal‐to‐binary conversion decimal notation decimal notation Decimal point programming decimal processing decimal value microwave device diagnostic diagnosis software diagnostic diagnostic bus diagnostic data diagnostic information diagnostic device diagnostic aids of robot diagnostic data diagnostic information diagnostic machine diagnostic message diagnostic message diagnostic program diagnostic routine diagnostic signal diagnostic strategy diagnostic communication system of IR diagnostic checking diagnostic test diagnostic test system diagnostic procedure seek error diagnostic procedure diagonalization of matrices diagonal matrix mixed‐flow compressor point‐to‐point mapping graph conversational mode, dialogue mode conversational mode dialogue mode session mode conversational compiler, dialogue compiler conversational data entry interactive feature dialogue system of robot dialogue capability conversational mode dialogue mode session mode dialogue programming of robot conversational programming of industrial robot, dialogue prog conversational robot, dialogue robot conversational language, dialogue language dialogue control interactive terminal interactive processing conversational communication diaphanometer diastimeter density change density indicator density gradient stran 58 od 326 EN ‐DE: slovar avtomatizacije in robotike Dichtekurve Dichteregelung Dichteregler Dichteschwankung Dichteverteilung dielektrische Beanspruchung dielektrische Belastung dielektrische Erwärmung im Hohlraumresonator dielektrische Erwärmung von Thermoplasten dielektrische Heizung dielektrische Verluste dielektrischer Gradient dielektrischer Heizungsgenerator dielektrisches Interferenzfilter dielektrisches Trocknen Dielektrizitätsverlustmessung Dienstprogramm Differential differential wirkende Regelung Differentialabsorptionsmethode Differentialabsorptionsverfahren Differentialanalysator Differentialanordnung Differentialausdruck Differentialbrücke Differential‐Differenzgleichung Differentialdruckschalter differentiale Kaskadenregelung differentiale Temperaturregelung differentiale Temperatursteuerung Differentialelement Differentialempfänger differentiales Folgeregelungssystem differentiales Synchro Differentialfernmesssender Differentialform Differentialgeber Differentialgleichung Differentialgleichung 1. Ordnung Differentialgleichung II. Ordnung Differentialgleichung mit nacheilendem Argument Differentialhebel Differentialimpuls Differentialimpuls Differentialimpuls Differentialkalorimeter Differentialkapazität Differentialkoeffizient Differentialkurve differential‐logarithmische PCM‐Modulation Differentialmessmethode Differentialmethode Differentialmodulation Differentialquotient Differentialrelais Differentialrelais Differentialringmanometer Differentialschaltung Differentialschutz Differentialstromkreis Differentialsynchroempfänger Differentialsynchrosender Differentialsynchroübertrager Differentialthermoanalyse Differentialthermogravimetrie Differentialthermometer Differentialverstärker Differentiationsbeiwert Differentiationsbeiwert Differentiationssymbol Differentiator Differentiator Differentiator Differentiatorzeitkonstante differentielle Gewinnregelung differentielle Gewinnsteuerung density curve density control density controller fluctuation of density density distribution dielectric stress dielectric stress dielectric heating in cavity resonator dielectric heating of thermoplastic materials dielectric heating dielectric losses dielectric gradient dielectric heating generator dielectric interference filter dielectric drying dielectric leakage measurement utility program differential gear rate action differential absorption method differential absorption method differential analyzer differntial configuration differential expression differential bridge differential‐difference equation differential pressure switch differential concatenation control differential temperature control differential temperature control differential element differential receiver differential servo differential selsyn differential telemeter transmitter differential form differential pick‐up differential equation first order differential equation second order differential equation differential equation with retarded argument differential lever difference pulse difference signal differential pulse differential calorimeter differential capacitance differential coefficient differential curve differential‐logarithmic pulse code modulation differential measurement differential method differential modulation derivative differential relay balanced relay ring‐balance differential manometer differential connexion differential protection differential circuit differential synchroreceiver differential synchrotransmitter differential selsyn differential thermal analysis differential thermogravimetry differential thermometer differential amplifier derivative action coefficient derivative action factor differentiation symbol derivative element differentiating element differentiator differentiator time constant differential gain control differential gain control stran 59 od 326 EN ‐DE: slovar avtomatizacije in robotike differentielle Spektralempfindlichkeit differentieller Regler differentieller Regler differentieller Regler differentieller Widerstand differentieller Wirkungsquerschnitt differentiellkohärentes Übertragungssystem Differenz zwischen Aufgabenwert und Sollwert Differenzdruckmanometer Differenzdruckwächter Differenzdruckwächter Differenzengleichung Differenzenrechnung Differenzier differenzierbare Struktur Differenzierbeiwert Differenzierelement 1. Ordnung differenzierende Schaltung differenzierendes Glied differenzierendes Glied differenzierendes Glied differenzierendes Netzwerk differenzierendes Netzwerk differenzierendes Netzwerksteuerungssystem differenzierendes Verhalten differenzierendes Verhalten differenzierendes Verhalten Differenzierglied Differenzierglied Differenzierglied Differenzierglied Differenzierzeitkonstante Differenzimpuls Differenzimpuls Differenzimpuls Differenzsignal Differenzsignal Differenzsignal Differenzstrom diffuses Strahlungsspektrum Diffusionsapparat Diffusionsmodell Diffusionsprozess digital dargestellte Funkenkammer digital gesteuertes Element Digital‐Analog‐ Konverter Digital‐Analog‐Umsetzer Digital‐Analog‐Wandler Digital‐Analog‐Wandler Digitalaufzeichnung Digitalausgabe Digitalausgang Digitaldaten pl von Messwerten Digitaldifferentiator digitale automatische Maschine digitale Bildverarbeitung digitale Darstellung digitale Darstellung digitale Datenverarbeitung digitale Greifersteuerung digitale Kodierung von Begriffen digitale Lagemessung digitale Lageregelung digitale Lagesteuerung digitale Längenmessung digitale Laserstrahlablenkungseinrichtung digitale Mehrgrößenregelung digitale optische Signalverarbeitung digitale Rechenanlage digitale Regelung digitale Simulation digitale Steuerung digitale Steuerung digitale Steuerung digitale Verarbeitungseinheit digitale wissenschaftliche Rechenanlage differential spectral sensitivity rate action controller differential controller D‐controller differential resistance differential cross‐section differentially coherent transmission system difference between desired value and set value differential pressure gauge differential pressure indicator pressure difference indicator difference equation calculus of differences derivative differentiable structure derivative constant first‐order lead element differentiating circuit derivative element differentiating element differentiator differential circuit differentiating network differentiating network control system derivative action differentiating action rate action derivative element differential element differentiating element differentiator derivative time constant difference pulse difference signal differential pulse difference pulse difference signal differential pulse differential current diffuse radiation spectrum diffuser diffusion model diffusion process digitized spark chamber digitally controlled element digital‐analog converter digital‐analog converter digital‐to‐analog‐converter digital‐analog converter digital recording digital output digital output numerical characteristics of measurement results digital [integrating] differential analyzer digital automatic machine digital image processing digital display digital representation digital data processing digital gripper control digital coding of conceptions digital position measurement digital position control digital position control digital length measurement digital laser beam deflector multiloop digital control digital optical processing digital computer digital control digital simulation digital control numerical control discrete control digital processing unit digital scientific computing system stran 60 od 326 EN ‐DE: slovar avtomatizacije in robotike Digitaleinheit digitaler Analysator von Übergangserscheinungen digitaler Automat digitaler Differentialanalysator digitaler Eingang digitaler Integrator digitaler IR‐Ausgabekanal digitaler Kode digitaler Kraftsensor digitaler Prozessor digitaler Rechenautomat digitaler Regelungsalgorithmus digitaler Regler digitaler Steuerrechner digitaler Verstellservomechanismus digitales digitales Ausgangssignal digitales Fernmessverfahren digitales Filter digitales Integralvoltmeter digitales Kommunikationssystem digitales logisches System digitales Positionierungssystem digitales Relaisfolgesystem digitales Signal digitales Steuerungssystem digitales System für die Produktion digitales Winkelmesssystem Digitalfehler Digitalfilter Digitalgeber Digitalgeber digitalgesteuerter Schreiber Digitalgröße Digitalhauptleitung digital‐inkrementale Wegmessung Digitalisierer Digitalisierer Digitalisierroboter Digitalisiersystem digitalisierte Struktur digitalisierte Thermoelementkompensation digitalisierte Zeichnung digitalisiertes Bild digitalisiertes Roboterbild digitalisiertes Werkstück digitalisiertes Werkstück Digitalisierung Digitalisierung Digitalisierung grafischer Vorlagen Digitalmessgerät Digital‐Mittelwertsbildner Digitalohmmeter mit Grenzwertkontrolle limites Digitalphasenmesser Digitalrechner Digitalrechnerkonstruktion in Mikromodulbauweise Digitalsensor Digitalsignalverteiler Digitalsimulator Digitalspeicher Digitalsteuerungstyp Digitalsteuerungstyp Digitaltechnik Digitaltechnik Digitalteil Digitalteil eines Hybridrechners Digitalübertragung Digitalumsetzer Digitalverbindung Digitalwandler digital Dimension dimensionale Toleranzen Dimensionierung feines Greiforgans Dimensionierung roboterbestückter Fertigungszellen Dimensionsanalyse dimensionslos digital unit digital transient analyzer digital automaton digital [integrating] differential analyzer digital entry digital integrator digital IR output channel digital code digital force sensor digital processor automatic digital computer, ADC digital regulation algorithm digital controller digital control computer digital position servo digital transient analyzer digital output digital telemetering digital filter integrating digital voltmeter digital communication system digital logic system digital positionning system digital relay servosystem digital signal digital control system digital system for production digital angle measuring system digital error digital filter digitizer digitized device digital recorder digital quantity digital main line digital‐incremental odometry digitizer digitized device digitizing robot digitizing system digitized structure (of information) digitized thermocouple compensation digitized drawing digitized image digitalized robot image digitalized digitalized work piece digitizing digitalization digitalizing of graphical sheets digital measuring device digital averager digital ohmmeter with limit value checking digital phase meter digital computer micromodule digital computer construction digital sensor digital distribution frame digital simulator digital store type of digital control type of digital control numerical techniques digital technique digital part digital part of hybrid computer digital transmission digital converter digital connection digital converter dimension dimensional tolerances dimensioning of grip organ dimensioning of robot equipped manufacturing units dimensional analysis non‐dimensional stran 61 od 326 EN ‐DE: slovar avtomatizacije in robotike dimensionslose Größe dimensionslose Größe dimensionslose Größe dimensionslose Kennlinie dimensionslose Kurve dimensionslose Variable dimensionslose Variable dimensionslose Variable dimensionsloser Koeffizient dimensionsloser Koeffizient dimensionsloser Koeffizient dimensionsloser Parameter Dimensionsstabilität Dimensionssteuerung dinamischer Dämpfer dinamischer Stoßdämpfer Diodenbereich Diodenbereichskamera Diodenfunktionsgenerator Diodengleichrichtung Diodenschaltung Diodenstrombegrenzer Diodenvervielfacher Diodenzähler Dirac‐Funktion Diracsche Funktion Directbeziehungsfernmesser directer Kode direkt anzeigendes Dosimeter direkt betätigter Schreiber direkt betätigtes Registrierinstrument direkt betätigtes Ventil direkt gesteuertes Regelventil direkt gesteuertes Regelventil direkt wirkender Regler direkt wirkender Regler direkt wirkendes System Direktausführung direkte Abbildung mit Laserstrahlen direkte Datenverarbeitung direkte digitale Regelung direkte digitale Robotersteuerung direkte Eingabe direkte Frequenzmodulation direkte Kaskadenregelung direkte Kraftbestimmung direkte Manipulatorsteuerung direkte Methode von Ljapunow direkte Methode von Lyapunow direkte Momentenbestimmung direkte NC‐Steuerung direkte numerische Steuerung direkte Signalsteuerung signalisation direkte Simulation direkte Steuerung direkte Steuerung von Werkzeugen direkte Steuerungsüberwachung direkte Steuerungsüberwachung direkte Steuerungsüberwachung direkte visuelle Überwachung direkter Antrieb direkter Datenaustausch direkter Datenkanal direkter Datenverkehr direkter digitaler Mehrkanalregler direkter digitaler Regler direkter Eingang direkter Greifer direkter Informationsaustausch direkter Kode direkter Körperkontakt (Kontakt) direkter Zugriff direkter Zugriff Direktkühlsystem Direktkurzschlußabschaltung Direktleitung dimensionless coefficient dimensionless value non‐dimensional value non‐dimensional response curve non‐dimensional curve dimensionless variable reduced variable non‐dimensional variable dimensionless coefficient dimensionless value non‐dimensional value non‐dimensional parameter dimensional stability dimension control dynamic damper dynamic damper diode area diode area camera diode function generator diode detection diode circuit diode current limiter diode multiplier diode counter Dirac delta‐function Dirac delta‐function direct relation telemeter bidecimal code direct reading dosimeter direct acting recording instrument direct acting recording instrument directly operated valve direct controlled regulation valve direct‐controlled regulation valve direct acting controller direct operating controller direct control system direct execution laser direct imaging direct data processing direct digital control direct digital robot control direct input direct frequency modulation direct concatenation control direct force destination direct manipulator control direct method of Liapunov direct method of Lyapunov direct moment destination direct numerical control direct numerical control direct signal control direct simulation direct control direct control of tools direct control supervision, direct control checking direct control supervision direct control checking direct visual supervision direct drive direct data change direct data channel direct data traffic direct digital controller direct digital controller direct input direct gripper direct information exchange direct code direct body contact immediate access instantaneous access direct cooling system direct short‐circuit interruption direct line stran 62 od 326 EN ‐DE: slovar avtomatizacije in robotike Direktregler Direktregler Direktregler Direktserienauslöser Direktzugriffsmethode Disassembler Disassembler‐Analyse Disjunktion disjunktive Normalform Diskette Diskettenlaufwerk Diskettenleser Diskettenspeicher Diskettenspeichersteuerung diskontinuierlich arbeitender Reaktor diskontinuierlich wirkender Regler diskontinuierliche Produktion diskontinuierliche Regelung diskontinuierliche Regelung diskontinuierliche Wirkung diskontinuierlicher Servomechanismus diskontinuierliches Signal diskontinuierliches Signal diskontinuierliches System diskontinuierliches System diskontinuierliches System diskrete Darstellung diskrete Einwirkung diskrete Einwirkung diskrete Größe diskrete Impulse diskrete Laplace‐Transformation diskrete Logik diskrete Optimierung diskrete Schaltung diskrete Selbstschwingungen diskrete Steuerung diskrete Steuerung diskrete Steuerung diskrete und stetiges System diskreter Automat diskreter Bahnzustand diskreter Prozess diskreter stochastischer Mehrstufenentscheidungsprozess diskreter Zeitpunkt einer Armbewegung diskretes Bauelement diskretes Filter diskretes Maximumprinzip diskretes Optimisierungssystem diskretes System diskreteVerteilung Diskretisierung eines stetigen System Diskriminatorglied Dispatcherpult Dispatchersystem Dispatchersystem Dispersion Dispersion der Zufallsgröße Dispersion der Zufallsgröße Dispersionsindex Dispersionskoeffizient Dispersionsmessung mit Refraktometer Dispersionsnullstelle Displaysteuerlogik Dissipation Dissipationseinwirkung dissipative Funktion Distanzmesser Distanzschutz Distanzschutz mit stetiger Auslösekennlinie Distanzschutz mit Stufenkennlinie Distanzsensor distributive Zufallszahl Distributivroboter divergent Divergenzschwingungen directly operated valve direct acting controller direct operating controller direct series trip direct access method disassembler disassembler analysis disjunction disjunctive normal form diskette floppy‐disk drive diskette reader floppy disk floppy‐disk control batch reactor discontinuous‐action controller discontinuous production discontinuous control intermittent control discontinuous action discontinuous‐action servomechanism discontinuous signal intermittent signal batch system intermittent system discontinuous system discrete representation discrete input intermittent input discrete quantity discrete pulses z‐transform discrete logic discrete programming discrete circuit interrupted autooscillations digital control numerical control discrete control discrete‐continuous system discrete automaton discrete path state discrete process discrete stochastic multistage decision process discrete instant (moment) arm movement discrete component discrete filter discrete maximum principle discrete optimizing system discret‐time system discrete distribution discretization of continuous‐time system discriminating element dispatching desk dispatching system supervisory control system variance random value variance variance of random value dispersion index dispersion coefficient measuring of the dispersion by refractometer zero dispersion display control logic dissipation dissipation effect dissipation function diastimeter distance protection continuous curve distance‐time protection stepped curve distance‐time protection distance sensor distributed random number distributive robot divergent divergent oscillations stran 63 od 326 EN ‐DE: slovar avtomatizacije in robotike Divergenzwinkel divergieren Dividierkreis Dividierkreis Divisionsalgorithmus Divisionsalgorithmus Divisionsschaltung Divisionsschaltung DMA‐Schaltkreis DNC Dokumentation feines Roboterprogramms doppelarmiger Roboter Doppelarmmanipulator Doppelbetätigung Doppelgreifeinheit Doppelgreifer Doppelheterostrukturlaser mit schmaler Streifengeometrie Doppelimpulsgenerator Doppelimpulsmodulation Doppelleitung Doppelleitungswiderstand Doppelleitungszerlegung f Doppelmessgerät Doppelprogrammierung eines Roboters Doppelrechnersystem Doppelschalttafel Doppelschleifenservomechanismus Doppelschleifenservomechanismus Doppelsteuerung doppelt verstärkende Schaltung doppelt verstärkende Schaltung doppeltperiodischer Vorgang Doppelwirkungsweise DOS DOS Dosierer Dosierer Dosiermessgerät Dosiermessgerät Dosierpumpe Dosierung drahtgebundene Fernmesstechnik drahtgeführter Wagen < drahtlose Steuerung Drahtpotentiometer Drahtvorschubsystem drastische Summe drastisches Produkt D‐Regler D‐Regler D‐Regler D‐Regler Drehbewegung (eines Greifers) Drehbewegung einer Greiferhand Drehbewegung r*um die x‐Achse Drehbewegung um die u‐Achse Drehbewegung um die v‐Achse Drehbewegung um die w‐Achse Drehbewegung um die y‐Achse Drehbewegung um die z‐Achse Drehbewegungsgeschwindigkeit eines Roboters Drehdrossel Drehdrossel Dreheinheit Dreheinheitenantrieb Dreheisenspannungsregler Drehfeldleistungsmesser Drehfeldrichtungsanzeiger Drehfrequenz H Drehgelenk Drehgelenk einer Zangengreifeinheit Drehgelenk eines Greifers Drehgelenk eines Zangengreifers Drehgelenkroboter Drehgelenkstruktur Drehimpuls angular divergence diverge v dividing circuit division circuit algorithm for division division algorithm dividing circuit division circuit switching circuit for direct memory access, DMA switching cir direct numerical control documentation of robot program double‐arm robot, two‐arm robot double arm manipulator dual operation double grip unit double‐gripper narrow‐stripe‐geometry double heterostructure laser double pulse generator double pulse modulation loop[ed] circuit loop resistance loop resolution dual measuring instrument double programming of robot double computer system dual switch board double‐loop servomechanism two‐loop servomechanism dual[‐mode] control double amplification circuit reflex circuit biperiodical regime dual operation disk operating system DOS batch meter dosimeter batch meter dosimeter metering pump batching wire link telemetry wire‐guided vehicle radio control wire‐wound potentiometer wire feed system drastic sum drastic product derivative controller rate action controller differential controller D‐controller rotation motion (movement) (of gripper) gripper hand rotation x‐rotary motion u‐rotary motion v‐rotary motion w‐rotary motion y‐rotary motion z‐rotary motion rotation speed of robot adjustable inductor variometer rotation unit rotation unit drive moving‐iron voltage regulator induction wattmeter phase‐sequence indicator gyro‐frequency swivel joint rotation joint of pincer rotation joint of gripper swivel joint of a pincer gripper swivel joint robot swivel joint structure rotary impulse stran 64 od 326 EN ‐DE: slovar avtomatizacije in robotike Drehlage Drehlageabweichung Drehlageerkennung von Objekten Drehlagenermittlung Drehmechanismuskonstruktion eines Roboters Drehmelder Drehmelder Drehmelder mit zwei Geschwindigkeiten Drehmelderfernübertragung Drehmeldersteuerung Drehmoment Drehmomentantrieb Drehmomentsensor Drehmomentverstärker Drehrichtung Drehschalter Drehteller Drehteller (für Eingabe von Werkstücken) Drehtisch Drehumformer Drehumwandler Drehung der Zangengreifeinheit Drehung eines Greiforgans Drehung eines Robotergreifers Drehvorrichtung Drehwinkel Drehwinkel eines Greiferarms Drehwinkelantrieb Drehwinkelmotor Drehzahlmesser Drehzahlregelung Drei‐Achsen‐Roboter dreiarmiger Manipulator Dreibackengreifer dreidimensionale geometrische Datenbasis dreidimensionale Motorführung dreidimensionale Roboterbahn dreidimensionale Wärmeströmung dreidimensionale werkstückorientierte Sprache dreidimensionaler optischer Sensor dreidimensionaler Phasenraum dreidimensionaler Vektor dreidimensionales Objekt dreieckförmige Zugehörigkeitsfunktion Dreiecksnorm Dreiecks‐Norm Dreiecks‐Norm Dreiersteuerung Dreiexzesskode Dreiexzessverschlüsselung f Dreifinger (Roboter) Dreifingergreifeinheit Dreifingerhand Dreikoordinaten‐Montageroboter Dreipegelsystem Dreiphasenspeisung Dreiphasensystem Dreipunktaufhängung Dreipunkt‐Element Dreipunkt‐Element Dreipunktgreifer Dreipunktregelung Dreipunktregelung Dreipunktregelung Dreipunktregelung Dreipunkt‐Regelung Dreipunktregler Dreipunkt‐Regler Dreipunkt‐Regler Dreipunktverhalten mit Nullwert Dreistufensteuerung dreistufiges Management‐Informationssystem Dreiwegsteuerung dreiwertige Funktionen Drektverarbeitung rotating position rotary position deviation rotating position identification, identification of rotating posit search of rotating position rotating mechanism construction of robot selsyn synchro dual speed synchro system remote selsyn transmission selsyn control moment of motion torque motor torque sensor torque amplifier circulation direction rotary switch rotary table (for feeding of work pieces) rotary table (for feeding of s) rotating table rotating converter induction voltage regulator pincer rotation, rotation of pincer unit grip organ rotation ‐ robot gripper rotation turntable device angle of rotation gripper rotation angle drive of rotation angle rotation angle motor revolution indicator control of rotation velocity three‐axes robot three‐armed manipulator three‐jaw gripper three‐dimensional geometric data basis three‐dimensional motor control three‐dimensional robot path three‐dimensional heat flow three‐dimensional ‐oriented language three‐dimensional optical sensor 3‐dimensional phase space three‐dimensional vector three‐dimensional object triangular membership function t‐norm triangular norm, r‐norm triangular norm triple device control excess‐three‐code excess‐three‐code trifinger three‐finger grip unit three‐finger hand, three‐fingered hand three‐coordinate assembly robot three‐level system three‐phase supply three‐phase system three‐point suspension relay with dead zone three‐step action element three‐point gripper three‐point action, three‐step action three‐point action three‐position control three‐step action three‐step control dead zone (relay, on‐off‐controller, amplifier), dead band (backlash nonlinearity three‐position controller three‐step controller positive‐negative three‐level action three‐step control three‐stage management information system three‐mode control three‐valued functions direct processing stran 65 od 326 EN ‐DE: slovar avtomatizacije in robotike Drift Driftausfall Driftfaktor Driftfehler driftkompensierter Verstärker Driftkorrektur Driftmesser dritte Manipulatorgeneration dritte Robotergeneration (IR‐Generation) drosselnde Wirkung Drosselprozess Drosselregelung Drosselspule Drosselspule Drosselungskennwert Drosselungskennwert Drosselventil Drosselverstärker Drosselwirkung Druckabfall Druckabfall Druckaufbau Druckausgleich pression Druckausgleich pression Druckausgleichmethode Druckbeanspruchung Druckbeaufschlagung Druckbelüftung Druckdifferenzanzeiger Druckdifferenzanzeiger Druckdifferenzgeber Druckdifferenzgeber Druckdifferenzgeber Druckdifferenzmessung Druckdifferenzregelung Druckdifferenzschreiber Druckeinstellung Druckentlastungstechnik Druckentnahme Drucker Druckersteuerlogik druckfester Feuchtefühler compression Druckfestigkeit Druckfiltration Druckfühler Druckfühler Druckfühler auf Halbleiterbasis Druckgasfeuchtigkeitsmesser druckgeschweißte Verbindung druckgesteuert Druckgießmanipulator Druckgradient Druckkette Druckknopfsteuerungsstation druckkompensierter Durchflussmesser Druckkontakt Druckkontakt Druckkontakt Druckliste Druckluft Druckluftantrieb druckluftgesteuert Druckluftkühlung Druckluftmotor Druckluftmotor Druckluftspeicher Druckluftversorgung"des Greifers Druckluftverzögerungsrelais Druckpuffer Druckreduzierung Druckregler Druckregler Druckregler Druckroboter Druckrückführung Druckschalter pression drift progressive failure drift factor drift error drift‐corrected amplifier drift correction driftmeter third manipulator generation third robot generation throttling action throttling process throttling control impedance coil inductor choking factor throttling index restrictor valve choke‐coupled amplifier throttling action pressure drop drop in pressure pressure buildup pressure balancing pressure equalization pressure balance method compressive stress pressurization pressurization differential pressure indicator pressure difference indicator differential pressure transducer pressure difference transmitter differential pressure transmitter differential pressure measurement differential pressure control differential pressure recorder pressure adjustment pressure relief technology pressure connection printer printer control logic humidity feeler resistant to compression compressive strength pressure filtration pressure sensitive element pressure sensor semiconductor pressure sensing device humidity meter of the gas under pressure pressure welded junction pressure controlled pressure cast[ing] manipulator, pressure moulding handler pressure gradient print chain push‐button station pressure‐compensated flowmeter butt contact, pressure contact butt contact pressure contact print list compressed air air actuator air‐operated forced ventilation cooling air pneumatic motor air pneumatic motor air accumulator compressed‐air provision of gripper pneumatic time delay relay print buffer pressure reduction pressure regulator pressure adapter pressure balance press robot pressure feedback pressure[‐actuated] switch stran 66 od 326 EN ‐DE: slovar avtomatizacije in robotike Drucksensor pressure sensor Drucksensor pressure sensitive element Drucksteuerung print control Drucktastenimpuls push‐button pulse printing technique Drucktechnik Druckteiler‐Schaltung pressure‐dividing diagram drop in pressure Druckverlust pressure drop rate Druckverlustwert Druckverteilung pressure distribution Druckwächter pressure reduction 500 pressure guard print unit Druckwerk Druckwiederaufnahmekode print restore code, PR code DT1‐Element D‐element with first order lag DT1‐Element derivative element with first order lag dual kodierte Zahl dual‐coded number dual kodierte Zahl binary‐coded number duale Steuerung dual[‐mode] control dualer Zustandsraum dual state space duales Spektralverfahren dual spectral method duality Dualität Dualitätstheorem dual theorem (operations research) Dualitätstheorie duality theory Dualkanal‐Mikroprogramm dual channel microprogram Dualkomponente dual component dual[‐mode] control Dualsteuerung Dualsystem binary number system Duhamelsches Integral Duhamel integral Dunkelstrom dark current Dünnschicht‐Halbleiterlaser semiconductor film laser Duplex‐Addiermaschine duplex adding machine Duplexbetriebsweise duplex mode Duplexkanal duplex channel Duplexleitung duplex circuit durch Laserstrahlen verursachter Fehler laser‐induced defect durch Rechnergeschwindigkeit begrenztes System machine‐limited system durch Roboter manipuliertes Objekt robot manipulated object by durch Roboter montierte Lichtmaschine robot‐assembled dynamo durch Roboter montierte Maschine robot‐assembled machine durch Roboter montierte Scheibe robot‐assembled disk durch Roboter montierte Verschraubung robot‐assembled screw cap durch Roboter montierte Welle robot‐assembled shaft robot‐assembled refrigerator durch Roboter montierter Kühlschrank durch Roboter montierter Motor robot‐assembled motor durch Roboter montierter Staubsauger robot‐assembled vacuum cleaner durch Roboter montiertes Fahrzeug robot‐assembled vehicle durch Roboter montiertes Gehäuse robot‐assembled housing durch Roboter montiertes Kugellager robot‐assembled ball bearing durch Verzögerungsleitung geformter Impuls delay‐line‐shaped pulse piercing voltage Durchbruchspannung Durchdringung penetration Durchdringung penetrating Durchdringungsvermögen penetrating power Durchdringungsvermögen penetration power Durchflussdichte flow density Durchflusselement flow element Durchflussgröße flow value Durchflusskalorimetrie flow calorimetry flow capacity Durchflusskapazität Durchflussmengenanzeiger flow indicator Durchflussmengenmesser flow controller Durchflussmengenmesser mass flowmeter Durchflussmengenmesser für flüssige Metalle flow meter for liquid metals Durchflussmengenmesser mit pneumatischem Geber flow meter with pneumatic transmitter flow measuring instrument Durchflussmengenmessgerät Durchflussmengenregelung flow [rate] control Durchflussmengenregelung basic rate system Durchflussmesser flow gauge Durchflussmesser für offene Gerinne open‐channel flowmeter fast response flowmeter Durchflussmesser mit kurzer Ansprechzeit flow gauge Durchflussmessgerät Durchflussproportionalzähler flow‐pulsation damping systemflow proportional counter Durchflussregler flow regulator flow ratio control Durchflussverhältnisregelung Durchflussverhältnisregler ratio flow controller Durchflusswächter flow guard flow value Durchflusswert stran 67 od 326 EN ‐DE: slovar avtomatizacije in robotike Durchflusszahl Durchführungsumformer Durchführungszone Durchgangs Durchgangsfaktor Durchgangskapazität Durchgangsmatrix Durchgangsprüfer Durchgangstransformator Durchgangsvektor Durchhangseinstellung Durchlassband Durchlasserholungszeit Durchlasskennlinie Durchlasswiderstand Durchlauf Durchlaufzeit Durchmesser einer Greifvorrichtung durchmischen durchmischen durchmischen Durchsatz Durchsatzprofil Durchschlag Durchschlag Durchschlagsspannung Durchschlagsspannung durchschnittliche Operationszeit durchschnittliche Satzverarbeitungszeit durchschnittliche spezifische Leistung durchschnittliche spezifische Leistung durchschnittliche spezifische Leistung ???? durchschnittliche spezifische Leistung ???? durchschnittliche spezifische Leistung ???? Durchschnittsoperation bei Mengen Durchschnittsoperation bei Mengen (UND‐Operation) Durchsichtigkeit Durchströmungsgeber Durchtrittskreisfrequenz D‐Verhalten D‐Verhalten Dynamic der Automatenoperation Dynamik des linearen Servosystems Dynamik eines Kleinroboters Dynamik vermaschter Dampfsysteme Dynamik verzweigter Regelkreise Dynamik von Reaktoren Dynamikbereich dynamisch dynamische dynamische Abweichung mechanischer Baugruppen dynamische Abweichung mechanischer Baugruppen dynamische Abweichung von Simultanbewegungen dynamische Analyse dynamische Arbeitskurve dynamische Berechnung dynamische Daten pi dynamische Daten pl dynamische Definition dynamische Eigenschaft dynamische Eigenschaft eines Manipulators dynamische Einheit dynamische Empfindlichkeit dynamische Genauigkeit dynamische Genauigkeit dynamische Genauigkeit eines Roboters dynamische Generatorkennlinie dynamische Kennlinien von automatischen Messgliedern dynamische Kompensation dynamische Kompensation dynamische Magnetspeichertechnik dynamique dynamische Manipulatoreigenschaft dynamische Massenspektrometer dynamische Operation dynamische Optimierung dynamische parallele Programmstruktur programme flow coefficient bushing transformer performance zone feed through feed through factor transfer capacitance feed through matrix continuity tester bushing transformer feed through vector sag adjustment passing band forward recovery time transmission characteristic forward resistance throughput turnaround time diameter of grip device blend v mix v mingle v throughput flow rate profile breakdown puncture slugging disruptive voltage breakdown voltage average operation time average record processing time, ARPT average intensity angle‐integrated intensity average fuel rating mean fuel rating average specific power intersection operation intersection operation transparency flow‐through transmitter crossover angular frequency derivative action rate action dynamics of the operation of the automaton linear servosystem dynamics miniature robot dynamics dynamics of interconnected steam systems dynamics of ramified control circuits reactor dynamics dynamic range dynamic dynamic compensation dynamic deviation of mechanical subassemblies dynamic deviation of mechanical sub‐assemblies dynamic deviation of simultaneous movement dynamic analysis dynamic characteristic dynamic calculation dynamic data dynamic data dynamic definition dynamic manipulator property dynamic manipulator property dynamic unit dynamic sensitivity dynamic accuracy dynamic precision dynamic accuracy of robot dynamic generator characteristic dynamic responses of automatic measurement means dynamic compensation sweep balance dynamic magnetic storage technique dynamic manipulator property dynamic mass‐spectrometer dynamic operation dynamic optimization dynamic parallel program structure stran 68 od 326 EN ‐DE: slovar avtomatizacije in robotike dynamische Probe dynamische Probe des Manipulationssystems) dynamische Problemprüfung dynamische Programmierung dynamische Programmstruktur dynamische Randbedingung dynamische Reibung dynamische Roboterbeanspruchung dynamische Robotereigenschaft dynamische Schaltung dynamische Simulation dynamische Verknüpfung dynamische Verknüpfung dynamische Verschiebung dynamische Verzögerung dynamische Wiedergabegenauigkeit dynamische Zuordnung dynamischer Ausgleich dynamischer Bereich dynamischer Betrieb dynamischer Einmodenlaser dynamischer Fehler dynamischer Gleichgewichtszustand dynamischer Gleichgewichtszustand dynamischer Kräfteausgleich an Robotern dynamischer Regelfaktor dynamischer Regelfaktor dynamischer Speicher dynamischer Speicher dynamischer Speicher mit wahlfreiem Zugriff dynamischer Speicherauszug dynamischer Wellenmesser dynamischer Widerstand dynamischer Zustand dynamisches Betriebsverhalten dynamisches Element dynamisches Gerät dynamisches Gleichgewicht dynamisches Gleichgewicht dynamisches Regelsystem dynamisches Roboterverhalten dynamisches Steuersystem dynamisches System dynamisches Unterprogramm dynamisches Verhalten Dynamoregler ebene Bewegung r ebene grafische Struktur Echo durch Gerätefehler Echoanzeiger Echoimpulse Echolot Echoprüfung Echoprüfung Echosignal Echozeichen echte Totzeit echte Totzeit Echtzeitanforderung Echtzeitanwendung Echtzeitausgabe Echtzeitbasis Echtzeitbetrieb (eines Roboters) Echtzeitbetriebssystem Echtzeitbilderfassung Echtzeitdaten pl Echtzeitdatenausgang Echtzeitdateneingang Echtzeitdatenverabeitung Echtzeit‐Datenverarbeitung Echtzeiteingabe Echtzeiteinsatz Echtzeitmodellierung Echtzeitsimulator Echtzeitsteuerprogramm Echtzeittelemetrie dynamic test (of manipulation system) dynamic test (of manipulation system) dynamic problem checking dynamic programming dynamic program structure dynamic boundary condition dynamic friction dynamic robot load dynamic robot property dynamic circuit dynamic simulation dynamic link[ing] dynamic binding dynamic relocation dynamic lag dynamic fidelity dynamic allocation sweep balance dynamic range dynamic regime dynamic single‐mode laser dynamic error dynamic balance dynamic equilibrium dynamic force compensation on robots deviation ratio offset ratio dynamic storage dynamic memory DRAM, dynamic random access memory dynamic dump dynamic wavemeter dynamic resistance dynamic state dynamic operational behaviour dynamic element dynamic device dynamic balance dynamic equilibrium dynamic control system dynamic robot performance dynamic control system dynamic system dynamic subroutine dynamic behaviour dynamo‐governor flat movement plane graphic structure parasitic echo blip echo pulse echo altimeter echo checking echo testing echo signal blip pure time delay real dead time real‐time demand real‐time application real‐time output real‐time base real‐time operation (of robot) real‐time operating system real‐time image acquisition real‐time data real‐time output real‐time input real‐time data processing real‐time data processing real‐time input real‐time application analog computer simulation real‐time simulator real‐time control program real‐time telemetry stran 69 od 326 EN ‐DE: slovar avtomatizacije in robotike Echtzeitverarbeitung Echtzeitverarbeitungssystem Eck Eckfrequenz Eckfrequenz Eckfrequenz Eckkreisfrequenz EDV‐System EDV‐System effektiv effektive Arbeitszeit effektive Leistung effektive Spanne effektiver Messbereich effektiver Widerstand Effektivfläche Effektivwert Effektivwert Effektor Effektor Effektor Effektor Effektor Effektor eines Industrieroboters Effektoradaption Effektoranwendungsgebiet Effektoranwendungsgebiet Effektoranwendungsgebiet Effektoraustausch Effektorbahn Effektorbasiskoordinate Effektorbewegung Effektorbewegungsführung Effektorbezugssystem Effektoreinwirkung auf die Roboterumwelt Effektorenbewegung Effektorfeinpositionierung Effektor‐Feinpositionierung effektorfester Referenzpunkt Effektorfunktion Effektorgeometrie Effektorkoordinaten Effektorkraftmessung Effektormagazin Effektororientierung in Effektororientierungsdaten pl Effektororientierungsdaten pt Effektorort Effektorort in Basiskoordinaten Effektorort in Weltkoordinaten Effektorposition Effektorraumkurve Effektorrechner Effektorregelung Effektorroboterorientierung Effektorstellenergie Effektortrajektorie Effektorverhalten Effektorzustand effizienter Roboteralgorithmus effizientes Programmiersystem Effizienztheorem eichen Eichen eichen Eichfrequenz Eichgenauigkeit eines Steuerungssystems Eichgerät Eichimpuls Eichkreis Eichkurve Eichmessteilung Eichpotentiometer Eichsignal Eichskale Eichspannungsteiler real‐time processing real‐time system corner break point corner frequency corner frequency, break point corner angular frequency electronic data processing system EDP system effective actual hours actual capacity actual range effective range of measurement effective resistance effective area effective value virtual value effector actuating appliance actuating unit regulating element regulating unit robot effector, effector of Industrial robot effector adaptation effector field of use, effector field of application effector field of use effector field of application effector exchange effector path effector base coordinate, base coordinate of robot effector effector movement effector movement guiding effector reference system effector action of robot environment movement of effectors fine positioning of effector fine positioning of effector effector‐fixed reference point effector function effector geometry effector coordinates effector force measurement effector magazine effector orientation in world effector orientation data effector orientation data effector place effector place in base coordinates effector place in world coordinates effector position space curve of effector effector computer effector regulation effector orientation of robot effector adjusting energy effector trajectory effector behaviour effector state efficient robot algorithm efficient programming system efficiency theorem gauge v calibration calibrate v calibration frequency calibration accuracy of control system calibration instrument calibration pulse calibration circuit calibration curve calibration scale calibrating potentiometer calibrating signal calibration scale calibrating potentiometer stran 70 od 326 EN ‐DE: slovar avtomatizacije in robotike Eichstrom Eichstrom Eichtemperatur Eichtransformation Eichung Eichung des Regelstabes Eichung von Messgeräten Eichungsgenauigkeit Eichwiderstand Eigenabklingen Eigenabklingen Eigenadmittanz Eigenbedarfsgenerator eigene Modulation Eigenenergie Eigenfrequenz Eigenfrequenz eines Roboters Eigenfrequenzkennlinie Eigenfunktion Eigenkinetik Eigenkreisfrequenz Eigenlösung eigenmächtige Funktion Eigenrauschen eigenrelative Adresse Eigenscheinleitwert Eigenschwingung Eigenschwingung Eigenschwingung Eigenschwingung Eigenschwingung Eigenschwingungen in Servosystemen Eigenstabilisierung Eigenstabilität eigentlich monoton Eigenvektor Eigenwert Eigenwertaufgabe Eigenwertgleichung Eigenwertproblem Eigenwertproblem Eigenzustand Eignung Ein‐ und Ausgangssteuerung Einachsenlasergyroskop Einachsenlasergyroskop einachsige Bahnbewegung ein‐aus Ein‐Aus‐Regler Ein‐Aus‐Regler Ein‐Aus‐Regler Ein‐Aus‐Regler Ein‐Aus‐Schalter Ein‐Aus‐Schaltung Ein‐Aus‐Servomechanismus Ein‐Aus‐Steuerung Ein‐Aus‐Tastung einbauen einbauen Einchiprechner eindeutig eindeutig bestimmt eindeutige Funktion eindeutige Funktion eindeutige Koordinatenzuordnung Eindeutigkeit einer Lösung Eindeutigkeitssatz eindimensional eindimensionale Abtastung dimension unique eindimensionale Bewertung eindimensionale Kette eindimensionales Bewertungssystem eindimensionales Datenfeld Eindringen Eindringen Eindringenenergie calibration current calibration flow calibration temperature gauge transformation calibration control rod calibration measuring instrument calibration calibration accuracy calibration resistance natural attenuation natural damping self‐admittance auxiliary generator self‐modulation characteristic energy natural frequency natural frequency of robot natural frequency response of the system eigenfunction intrinsic kinetics damped natural angular frequency eigenfunction arbitrary function basic noise differential address self‐admittance autooscillation self‐oscillation selfvibration free oscillation natural oscillation autooscillations in servosystems self‐stabilization inherent stability strongly monotonic eigenvector eigenvalue eigenvalue problem eigenvalue equation characteristic value problem eigenvalue problem characteristic state suitability input‐output control one‐axis laser gyroscope single‐axis laser gyroscope single‐axle orbital motion on‐off on‐off controller on‐off regulator twolevel controller two‐position [action] on‐off switch stop‐start control on‐off servomechanism on‐off control on‐off keying install v setup v single‐chip computer unique uniquely determined one‐valued function simple function unique coordinate assignment uniqueness of solution uniqueness theorem one‐dimensional one‐dimensional scanning one‐dimensional evaluation one‐dimensional circuit one‐dimensional evaluation system one‐dimensional data field penetration penetrating penetration energy stran 71 od 326 EN ‐DE: slovar avtomatizacije in robotike Eindringtiefe Eindringtiefe Einebenen‐Interruptsystem Einerrücklauf eines Schweißroboters einfach zusammenhängend Einfachbetrieb einfache (leichte) Programmierung einfache Dekomposition einfache Einlegefunktion einfache Funktion einfache Funktion einfache Genauigkeit einfache Genauigkeit einfache Handhabetechnik einfache Montageoperation einfache Robotersprache einfache Signalauswertung einfache Werkstückmontage einfache Werkstückmontage einfacher Abstandssensor (Distanzsensor) einfacher Bewegungszyklus einfacher Greiferantrieb einfacher Kraftsensor einfacher Manipulator einfacher Montageautomat einfacher Montageroboter einfacher Regler einfacher Roboter einfacher Roboterservoregler einfacher Sensor einfacher Sensoraufbau einfacher Sichtsensor einfaches Einlegegerät einfaches Fügen mittels Industrieroboters einfaches Kontrollelement einfaches Montagesystem einfaches Regelkreissystem einfaches Roboterfügen einfaches Verzögerungsnetzwerk einfachlogarithmisch Einfachregelkreis Einfachregister Einfachroboter Einfachstrom simple Einfachstrom simple Einfachstrom simple Einfahren eines IR in eine Position Einfahrverhalten Einflussgröße Einflußgröße Einflussgröße Einflußgröße Einflussgröße Einflusskorrektur Einfügegerät Einfügekopf Einfügen der Bauteile Einfügeoperation Einfügeroboter Einfügeroboter für Bauteile Eingabe analoger Informationen Eingabe geometrischer Strukturen Eingabe von Steuerinformationen Eingabeadressenbereich Eingabe‐Ausgabe‐Einheit Eingabe‐Ausgabe‐Einheit Eingabe‐Ausgabe‐Gerät Eingabe‐Ausgabe‐Gerät Eingabe‐Ausgabe‐Interface Eingabe‐Ausgabe‐Liste Eingabe‐Ausgabe‐Modell Eingabe‐Ausgabe‐Puffer Eingabe‐Ausgabe‐Pufferspeicher Eingabe‐Ausgabe‐Steuersystem Eingabe‐Ausgabe‐Supervisor penetration penetrating single‐level interrupt system end‐around carry welding robot movement cycle simply connected simplex operation simple programming simple decomposition simple loading function one‐valued function simple function single precision single accuracy simple handling technique simple assembly operation simple robot language simple signal evaluation simple assembly simple work piece assembly simple distance sensor single‐movement cycle simple gripper drive simple force sensor simple handler simple assembly automaton simple assembly robot simple controller simple robot, single robot simple robot servo‐regulator simple sensor simple sensor structure simple visual sensor simple loading device simple robot Jointing simple check element simple assembly system one‐loop control system simple robot Jointing simple lag network semi‐logarithmic single‐variable control system simple register simple robot, single robot neutral current simple current single current initial operation of IR in the position approach mode actuating variable influence size influence size influencing value influencing variable action correction inserting device insertion head insertion of composants insertion operation insertion robot insertion robot for compos‐ analog input geometric structure input input of control information input address area input‐output device input‐output unit input‐output device input‐output unit input‐output interface input‐output list, I O list input‐output model input‐output buffer input‐output buffer store input‐output control system input‐output supervisor, I O supervisor stran 72 od 326 EN ‐DE: slovar avtomatizacije in robotike Eingabe‐Ausgabe‐Uberwachung Eingabe‐Ausgabe‐Zyklus Eingabebereich Eingabe‐Bustyp Eingabedaten pl Eingabedaten pl (eines Roboterprogramms) Eingabefluss Eingabe‐Freigabesignal Eingabefunktion Eingabegerät Eingabegerät Eingabegerät Eingabegeschwindigkeit Eingabekanal Eingabelochband Eingabemaschine Eingabemechanismus Eingabeprogramm Eingabeprogrammbeschreibung Eingabespeicher Eingabesteuereinheit Eingabestrom Eingabetor‐ Aktivierungssignal Eingabeverfahren Eingangs Eingangsachse Eingangsamplitudenbereich Eingangsanzeigeleitung Eingangsdaten pl Eingangselement Eingangsempfindlichkeit Eingangsfilter Eingangsgitterkapazität Eingangsgleichspannung Eingangsgroße Eingangsgröße Eingangsgröße mit Polynomcharakteristik Eingangsimpuls Eingangsinformation Eingangsinformationsdauer Eingangsinfrarotstrahl Eingangskennwortleitung Eingangskontrolle Eingangskoordinate Eingangsleistung Eingangsmatrix Eingangsscheinwiderstand Eingangssignal Eingangssignalwert Eingangsspeicher Eingangsstörung input power 332 Eingangsstrom Eingangstransformator Eingangsvariable Eingangsvektor Eingangsverstärker Eingangsvorrichtung Eingangsvorrichtung Eingangswarenkontrolle Eingangswicklung Eingangswicklung Eingangszeitkonstante Eingangszustand eingebaute Eichleitung eingebaute Kontrolle eingebaute Prüfung eingebaute Schutzvorrichtung eingebaute Weiderholautomatik eingebauter Manipulator eingebauter Mikroprozessor eingebauter Minirechner eingebauter Spannungsausfallschutz eingebauter Temperaturfühler Eingenverluste eingeschwungene Datensignale eingeschwungener Zustand input‐output monitoring input‐output cycle input area input bus type input data input data (of robot program) input flow input enable signal input function input equipment input unit sensing unit input speed input channel input punched tape input machine input machine input program input program description input store input control unit input flow input enable signal input action input input axle input amplitude range tag line in input data input element input sensitivity input filter input grid capacity direct current input voltage input variable input quantity polynomial input input pulse input information input information duration infrared input flow tag line in incoming‐material control input coordinate input power input matrix input impedance input signal value of input signal input store input perturbation input current input transformer input variable input vector input amplifier input device input element incoming‐material control input [power] winding supply winding input time constant input state built‐in gauge line built‐in check built‐in check built‐in protection mechanism built‐in repetition automatism built‐in manipulator built‐in microprocessor built‐in minicomputer built‐in power fail protection embedded temperature detector internal losses stable data state, steady stran 73 od 326 EN ‐DE: slovar avtomatizacije in robotike eingeschwungener Zustand Eingrenzung Eingriffmöglichkeit Eingriffsfunktion Eingriffsignal Eingriffsignal Eingriffstelle Eingrößensystem Eingrößensystem Einheit Einheit für die Regelung Einheitensystem Einheitenunabhängigkeit f einheitliche Maschinensprache einheitlicher Datenträger Einheitsanstiegs Einheitsanstiegs Einheitsanstiegsantwort Einheitsanstiegsantwort Einheitsanstiegsfunktion Einheitsanstiegsfunktion Einheitsimpuls Einheitsimpuls Einheitsimpuls Einheitsimpuls Einheitsimpulsantwort Einheitsimpulsfunktion Einheitsimpulsfunktion Einheitsimpulsfunktion Einheitsimpulsreaktion Einheitsintervall Einheitskreis Einheitsmatrix Einheitsmatrix Einheitsmethode Einheitssprung Einheitssprung Einheitssprungantwort Einheitssprungfunktion Einheitssprungfunktion Einheitssystem Einheitsvektor Einheitsvektorkomponente Einhüllende Einkanalanalysator Einkoordinatenmodul Einlaßsystem inlet temperature control 330 Einlegeeinrichtung Einlegefunktion Einlege‐Handhabetechnik Einlegen Einleger Einlegeroboter einleiten Einleitung der Berechnung Einleitung der Berechnung einmalig einmalige Anwendung Einmodenbetrieb Einmodenlaser Einmodenverteilung einmodiger optischer Impuls einordnen Einphasenasynchronmotor r Einphasenlinearmotor Einphasensystem Einphasentakt Einprogrammbetrieb Einpulslidar Einpunktbetrieb einreihen Einrichtung mit wahlfreiem Zugriff Einrichtung zur Informationsgewinnung Einrichtungsendzustand Ein‐Richtungsübertragung Einsatz steady state localization mesh possibility influencing function interrupt[ing] signal break signal point of engagement single‐input single output system SISO‐system (SISO = single‐input‐singel‐output) unit automatic controller system of units device independence common machine language common information carrier unit ramp unit‐ramp unit ramp response unit‐ramp response unit ramp function unit‐ramp function unit‐impulse delta function unit impulse function unit impulse unit‐impulse response unit‐impulse function delta function unit impulse function response to unit impulse unit interval unit circle identity matrix unit matrix standard method unit‐step unit step unit‐step response unit vector step function unit‐step function standard system unit vector unit vector component envelope single‐channel analyzer one‐coordinate module inlet system loading device loading function loading handling technique loading loading device loading robot, inserting robot begin v calculation initialization computation initiation unique one‐time application single‐mode operation unimodal laser unimodal distribution single‐mode optical pulse arrange v single‐phase asynchronous motor single‐phase linear motor monophase system single‐phase clock single‐program mode monopulse lidar burst mode arrange v random access device device of information winning device end status unidirectional transfer commitment stran 74 od 326 EN ‐DE: slovar avtomatizacije in robotike Einsatz Einsatz Einsatz Einsatz der Industrieroboter Einsatz der Industrieroboter Einsatz der Industrieroboter Einsatz der Industrieroboter Einsatz der Industrieroboter Einsatz der Mikroelektronik in Roboter Einsatz intelligenter Sensoren Einsatz mehrerer Roboter Einsatz mit zugeschnittenem Funktionsspektrum Einsatzbedingung Einsatzbedingung eines IR Einsatzbedingung eines Manipulators Einsatzbedingung für Greifer Einsatzbereich Einsatzbereich eines Industrieroboters Einsatzeffekt Einsatzerprobung Einsatzfall Einsatzflexibilität Einsatzproblem Einsatztest Einsatzvorbereitung von Schweißrobotern Einsaugen Einsaugen Einschaltbefehl einschalten Einschalten Einschaltor normal magnetization curve 438 Einschaltspannung Einschaltspannung Einschaltstellung Einschaltstromspitze Einschaltung Einschaltverzögerung Einschaltverzug Einschaltzeit Einschätzung Einschätzung Einschienenmanipulator einschleifig einschleifige Regelung Einschubkreis Einschubsystem interchangeable a fiches Einschubverstärker Einschwingeffekt Einschwingimpuls Einschwingsignal Einschwingvorgang m Einschwingzeit Einschwingzeit Einschwingzeit Einschwingzeit Einschwingzustand einseitige Laplace‐Transformation einseitige Verzerrung einseitiger Grenzwert einseitiges Hybridsystem Einselement einsetzen einsteckbarer Mikroprozessor‐Emulator Einsteckkreis Einsteckverstärker Einsteileinrichtung Einstein Produkt Einstein Summe einstellbare Abformbacken einstellbare Aussteuerung einstellbare Backengeometrie einstellbare Erregerkräfte einstellbare Formbacken einstellbare Greiferbacken einstellbare Größe einstellbare Länge application use employment robot operation, industrial robot operation, application of rob applications of robots industrial robot operation robot operation use of robots application of microelectronics for robots intelligent sensor application multi‐robot application dedicated‐function application manipulator application condition robot application condition manipulator application condition application condition of grip‐per area of application robot use region, use region of industrial robot threshold effect field test employment case application flexibility application problem field test operating preparation of welding robots absorption absorbing closing order connect v switching‐on normally open gate closing voltage pull‐in voltage switch‐on position peak making current switching‐on turn‐on delay closing delay turn‐on time appreciation evaluation monorail manipulator single‐circuit single‐loop feedback system plug‐in circuit plug‐in system plug‐in amplifier transient effect transient pulse transient signal transient [phenomenon] time of response build[ing]‐up time transient period rise time transient state one‐sided Laplace transformation bias distortion one‐sided limit unilateral hybrid system identity element begin v in‐circuit emulator plug‐in circuit plug‐in amplifier adjusting device Einstein product Einstein sum adjustable form jaws adjustable drive adjustable jaw geometry adjustable exciter forces adjustable form jaws adjustable gripper jaws regulating quantity adjustable length stran 75 od 326 EN ‐DE: slovar avtomatizacije in robotike einstellbare Zeitkonstante einstellbarer Anschlag einstellbarer Antrieb einstellbarer Impulszähler mit automatischer Wiederholung einstellbarer Kontakt einstellbarer Regler einstellbarer Schwellwert einstellbarer Sensor einstellbarer Spannungsstabilisator einstellbares Drosselventil einstellbares Gegengewicht einstellbares Greiferspiel einstellbares Grenzmoment Einstellbefehl Einstellbereich Einstellbereich Einstellbereich Einstellcharakteristik Einstellelement Einstellelement einstellen einstellen einstellen einstellen einstellen Einstellen der Messkanäle Einstellen der Schichtdicke am Spritzroboter Einstellen des Aufzeichnungsgerätes Einsteller Einstellgenauigkeit Einstellgerät Einstellgerät Einstellimpuls Einstellimpuls Einstellkennwert Einstellkurve Einstellmoment Einstellmoment Einstelloperation Einstellpunkt der Warnung Einstellregeln Einstellskale Einstellskale Einstellskale Einstellsystem füt Potentiometer Einstellung Einstellung"des Roboterarbeitsganges Einstellungskennwert Einstellungsschlüssel Einstellverfahren Einstellvorrichtung Einstellwert Einstellwert Einstellwert Einstellwert bei Teilehandhabung Einstellwiderstand Einstellzeit Einstranganlage Einstufenprozess einstufige Robotermontage einstufiger Verstärker einstufiger Verstärker Eintaktrelaissystem unique Eintaktzyklusäquivalent Einteilung Einteilungssystem eintretender Strom eintretender Strom Eintrittsdruck Eintrittsstrom Eintrittsstrom Eintrittstemperaturregelung Eintrittswahrscheinlichkeit Eintrittswinkel Einwegautomat Einweggleichrichter adjustable time constant adjustable striking adjustable drive adjustable impulse counter with automatic rerun adjustable contact adjustable controller adjustable threshold adjustable sensor adjustable voltage stabilizer adjustable restriction valve adjustable counter‐balance adjustable gripper play adjustable limit moment adjustment instruction adjustment range range of set value tuning range adjusting characteristic adjusting element setting device adjust v set v align v tune v trim v adjustment of measuring‐channels coat thickness adjustment on spray robot recorder adjustment adjuster setting accuracy adjusting element setting device set pulse setting pulse adjusting characteristic adjustment curve controlling torque driving torque adjusting operation alarm setting tuning rules regulation scale tuning scale tuning dial potentiometer‐setting system setting adjustment of robot operation adjusting characteristic adjusting key adjusting method adjusting device set point setting set value adjustment value by manipulation of components adjustable resistance setting time single‐stand unit single‐stage process single‐stage robot assembly one‐stage amplifier single‐stage amplifier one‐tact relay system single‐cycle equivalent mapping mapping system incoming stream input stream input pressure incoming stream input stream inlet temperature control probability of occurrence root‐locus, angle of arrival one‐way automaton half‐wave rectifier stran 76 od 326 EN ‐DE: slovar avtomatizacije in robotike Einweisung eines Roboters Einwirkungsdauer Einwirkungsdauer Einzeichensignalempfänger Einzelbauelement Einzelbusstruktur Einzelfehlerkorrektur Einzelgreiffläche Einzelimpuls Einzelimpulse Einzelimpulsverzögerung Einzelinstrumentierung Einzelleitungssteuereinheit Einzelobjekt Einzelprogrammbetriebsart Einzelpunktsteuerung Einzelschaltkontrolle Einzelschrittarbeitsweise Einzelschrittarbeitsweise Einzelschrittbetrieb Einzelschrittmodus Einzelschrittverfahren Einzelsteckeinheit‐Mikroprozessor unique Einzelteil Einzelverarbeitungsmodus Einzelwert Einzelzyklusbetrieb eines IR Ein‐Zustand Einzweckautomat Einzweckautomat Einzweckautomat Einzweckautomat für Montage Einzweckkanal Einzweckmanipulator Einzweckregler Einzweckterminal Einzweckterminal elastische Elemente (einer IR‐Hand) elastische Handelemente elastische Membranlagerung elastische Rückführung elastische Rückführung elastische Zwischenschicht elastischer Auslegearm elastischer Greiferfinger elastischer Greiffinger elastischer Körper elastischer Robotergreiffinger elastisches Getriebeglied elastisches Greiferglied electrodynamischer Durchflussmesser electronic electronisches Bahnabweichungsanzeigegerät elektrisch elektrisch angetriebene Hauptachsen elektrisch angetriebene Lineareinheit elektrisch angetriebener Roboterfaltarm elektrisch angetriebener Roboterknickarm elektrisch betriebene Roboterachse elektrisch gesteuert elektrisch löschbarer Speicher elektrisch programmierbarer Speicher elektrische Abfühlung elektrische Abscheidung elektrische Analogie elektrische Anlage elektrische Anpassung elektrische Busstruktur elektrische Datenabtastung elektrische Datenausgabe elektrische Datenspeicherung elektrische Datenübertragung elektrische Endlagensicherung elektrische Feldstärke elektrische Fernsteuerung elektrische Fernübertragung instruction of robot duration of action duration of effect single‐signal receiver separate component single‐bus structure single‐layer board single‐grip surface, individual grip surface individual pulse discrete pulses one‐pulse delay single instrumentation single‐line controller individual object single‐program mode point‐to‐point positioning control single‐switching test single‐step mode single‐step operation; step‐by‐step operation step‐by‐step mode single‐step method single‐board microprocessor one‐off part dedicated mode particular value single‐cycle operation of IR one state single‐purpose automatic machine, single‐purpose automaton single‐purpose automatic machine singlepurpose single‐purpose automatic machine for assembly, single‐purpo dedicated channel single‐purpose manipulator single‐duty controller application‐dedicated terminal application‐dedicated terminal, ADT, dedicated terminal elastic elements elastic manual elements, elastic hand elements elastic membrane support elastic feedback variable feedback elastic intermediate layer elastic jib, elastic arm elastic gripper finger elastic grip finger elastic body elastic robot finger‐grapping elastic gear element elastic gripper element electrodynamic flowmeter electronic electronic trajectory deviation indicator electric[al] electric‐driven main axles electric‐operated linear unit electric‐driven buckling arm of robot electric‐driven buckling arm of robot electric‐operating robot axis electrically operated electric‐erasable memory electric‐programmable memory electrical sensing electrical separation electrical analogy electrical installation electric adapting electric structure of bus electric data scanning electric data output electric data storage electric data transmission electric limit fuse electric field intensity electric remote control electric remote transmission stran 77 od 326 EN ‐DE: slovar avtomatizacije in robotike elektrische Fourier‐Analyse elektrische Informationsspeicherung elektrische Informationstechnik elektrische Interfacebedingung elektrische IR‐Steuerung elektrische Isolierung elektrische Kenndaten pl elektrische Kontrolle elektrische Korrektur elektrische Lasthebeeinrichtung elektrische Leitfähigkeit elektrische Leitfähigkeit elektrische Mess‐ und Prüfeinrichtung elektrische Nullstellung elektrische Prüfung elektrische Regelung elektrische Regelung elektrische Regelvorrichtung elektrische Regelvorrichtung elektrische Regelvorrichtung elektrische Robotersteuerung elektrische Rückführung elektrische Sensoreigenschaft elektrische Signalauswertung elektrische Signalauswertung elektrische Stellglieder elektrische Verbindung elektrische Verschiebung elektrische Ziffernlesung elektrischer Analysator elektrischer Antrieb elektrischer Antrieb elektrischer Antrieb elektrischer Antrieb des Manipulatorarmes elektrischer Dehnungsmesser elektrischer Dehnungsmesser elektrischer Differenzdruckgeber pression elektrischer Druck‐Messumformer pression elektrischer Entfernungsmesser elektrischer Entladungsvakuummesser elektrischer Entladungsvakuummesser elektrischer Erfassungssensor elektrischer Geber mechanischer Größen elektrischer Industrieroboter elektrischer Kontaktregler elektrischer Lochprüfer elektrischer Manipulator elektrischer Master‐Slave‐Manipulator elektrischer Prüfer elektrischer Regler elektrischer Regler elektrischer Regler elektrischer Roboter elektrischer Schreiber elektrischer Servomotor elektrischer Servomotor elektrischer Spindelantrieb elektrischer Stellmotor elektrischer Stellmotor elektrischer Steuermotor elektrischer Steuermotor elektrischer Steuerungsantrieb elektrischer Widerstand elektrischer Zeitplangeber elektrisches Abtastgerät elektrisches Fernmessgerät elektrisches Fernmesssystem elektrisches Gleichgewicht elektrisches Interface elektrisches Relaiselement elektrisches Resonanzrelais elektrisches Signal elektrisches Speicherregister elektrisches Steuerungsgerät elektrisches Widerstandsthermometer elektroakustischer Effekt electrical Fourier's analysis electric information storage electric information technique electric interface condition electric robot control, electric IR‐control electrical insulation electrical characteristics electric test[ing] electrical correction electric load lift device electrical conductance electric conductivity electrical measuring and test equipment electrical zero electric test[ing] electric control electrically operated control electrically operated controller electric controller electric regulator electric robot control, electric IR‐control electric feedback electric sensor property electric signal evaluation, electrical signal evaluation electric[al] signal evaluation electric final control elements electric connection electric displacement electric digital reading electrical analyzer electrically operated drive electric drive electric propulsion electric drive of manipulator hand electrical dilatometer electric strain gauge electric transmitter of differential pressure electrical pressure measuring converter electric telemeter electric discharge vacuum gauge vacuum electric discharge gauge electric acquisition sensor electric transmitter of mechanical values electric industrial robot, electrical industrial robot, electrical] electrical contact controller electric verifier electric manipulator, electrical manipulator electric master slave manipulator electric verifier electrically operated controller electric controller electric regulator electric industrial robot, electrical industrial robot, electrical] electrical recorder electric actuator electric servomotor electric spindle drive electric actuator electric servomotor electric actuator electric servomotor electric control gear electric resistance electric time schedule transmitter electrical scanner electric telemeter electric telemetering system electrical balance electric interface electrical relay element electric resonance relay electric signal electric store register electric control gear electric resistance thermometer electroacoustic effect stran 78 od 326 EN ‐DE: slovar avtomatizacije in robotike elektroakustischer Wandler electroacoustic transducer Elektroanalyse electroanalysis Elektroantrieb electrically operated drive Elektroantrieb electric drive Elektroantrieb electric propulsion Elektroantrieb mit geradliniger Bewegung motion s 4716 electric drive with progressive movement Elektroantrieb mit geradliniger Bewegung motion s 4716 electric drive with rectilinear motion Elektroantriebsblockierung electric drives blocking elektroautomatische Leistungsregelung electrochemical proceelectroautomatic power control elektrochemisches Verfahren electrochemical process elektrodynamische Analogie electrodynamic analogy elektrodynamischer Schwingungsgeber electrodynamic vibration pick‐up elektrodynamischer Strahler electrodynamic radiator elektrodynamisches Instrument electrodynamic instrument elektrodynamisches Relais electrodynamic relay Elektroentladungsvakuummesser electric discharge vacuum gauge Elektroentladungsvakuummesser vacuum electric discharge gauge elektroerosive Bearbeitung electroerosion treatment electrographic recording technique elektrografische Aufzeichnungstechnik elektrohydraulisch angetriben electrohydraulically operated elektrohydraulischer Effekt electrohydraulic effect elektrohydraulischer Greiferantrieb electrohydraulic gripper drive elektrohydraulischer Greiferantrieb electro‐hydraulic gripper drive elektrohydraulischer Regelkreis electrohydraulic control circuit elektrohydraulischer Regler electrohydraulic controller elektrohydraulischer Servomechanismus electrohydraulic servomechanism elektrohydraulischer Umformer electrohydraulic converter elektrohydraulisches Regelungssystem electrohydraulic control system elektrohydraulisches Servoventil electro‐hydraulic servo valve elektrohydraulisches Servoventil electrohydraulic servovalve Elektroinstallation electrical installation elektrokinetisches Potential electrokinetic potential Elektrokontaktbearbeitung electrocontact machining Elektrolumineszenzdarstellungsschirm electroluminescent display panel Elektrolumineszenzelement electroluminescent element Elektrolumineszenzgeber electroluminescence sensor Elektrolumineszenzschirm electroluminescent screen Elektrolumineszenzsensor electroluminescence sensor electroluminescence sensor for manipulator control Elektrolumineszenzsensor für Manipulatorsteuerung elektrolytische Polarisation electrolytic polarization elektrolytische Wanne electrolytic tank electrolytic solution pressure elektrolytischer Lösungsdruck elektrolytischer Speicher electrolytic store elektrolytischer Zeitschalter electrolytic timer elektrolytisches Hygrometer electrolytic hygrometer Elektrolytkondensator electrolytic capacitor Elektromagnetgreifer electromagnet gripper elektromagnetische Ablenkung electromagnetic deflection elektromagnetische Abschirmung electromagnetic screening elektromagnetische Abschirmung electromagnetic shielding elektromagnetische Auslenkung electromagnetic deflection elektromagnetische Auslösung electromagnetic release elektromagnetische Dämpfung electromagnetic damping elektromagnetische Einheit electromagnetic unit elektromagnetische Greifereinrichtung electromagnetic gripper equipment elektromagnetische Kompensation electromagnetic compensation elektromagnetische Konstante electromagnetic constant elektromagnetische Kopplung electromagnetic coupling elektromagnetische Kriterien electromagnetic criteria elektromagnetische Linse electromagnetic lens elektromagnetische Pumpe electromagnetic pump elektromagnetische Schichtdickenmessung electromagnetic thickness measurement of layers elektromagnetische Schwingungen electromagnetic oscillations elektromagnetische Speicherleitung electromagnetic transmission line storage elektromagnetische Steuerung electromagnetic control elektromagnetische Verriegelung electromagnetic locking elektromagnetische Verzögerungsleitung electromagnetic delay line elektromagnetischer Greifer electromagnet gripper elektromagnetischer Ordner electromagnetic order device elektromagnetischer Strömungsmesser electromagnetic flowmeter elektromagnetischer Vibrationsbunker electromagnetic vibration‐type buncer elektromagnetischer Wandler electromagnetic transducer elektromagnetischer Zähler electromagnetic counter elektromagnetisches kontaktloses Relais electromagnetic contactless relay elektromagnetisches Kopieren electromagnetic copying elektromagnetisches Schütz electromagnetic contactor stran 79 od 326 EN ‐DE: slovar avtomatizacije in robotike elektromagnetisches Ventil elektromagnetisches Wahrnehmungssystem elektromechanische Blockierung elektromechanische Roboterhardware elektromechanische Verriegelung elektromechanischer Abtaster elektromechanischer Antrieb elektromechanischer Impulsschreiber elektromechanischer Manipulator elektromechanischer Niederfrequenzoszillator elektromechanischer Regler elektromechanischer Umschalter elektromechanischer Verstärker elektromechanisches Differentialanalysiergerät elektromechanisches System elektromechanisches Zählrelais elektrometrischer Verstärker Elektromotorenmontage Elektron Elektronenbandspektrum Elektronenemission Elektronenkaskade Elektronenkopplung Elektronenleitfähigkeit Elektronenmikroanalysator Elektronenoptik elektronenoptischer Bildwandler Elektronenstoß Elektronenstrahl Elektronenstrahlbehandlung elektronenstrahlgeschweißte Verbindung Elektronenstrahlmagnetometer Elektronenstrahloszillograf Elektronenstrahlröhre Elektronenstrahlschwaißverbindung Elektronenstrahlschweißparameter Elektronenstrahlschweißtechnik Elektronenstrahlschweißtechnologie Elektronenstrahltechnologie Elektronenstrahlumschmelzverfahren Elektronenstrahlverteiler Elektronenstrom Elektronik einer Robotersteuerung Elektronik feines Industrieroboters Elektronikanwendung Elektronikindustrie elektronisch geregeltes Stromversorgungsgerät elektronisch gesteuert elektronisch gesteuerte Endmontage elektronisch gesteuerter Umformer elektronisch integrierter Arbeitsablauf elektronische Abstimmempfindlichkeit elektronische Auswuchtung elektronische Automatisierung elektronische Baugruppe elektronische Baugruppe elektronische Datenbank elektronische Datenerfassung elektronische Datensammlung elektronische Datenstation elektronische Datenverarbeitung elektronische Datenverarbeitung elektronische Drehzahlmessung elektronische Fernsteuerung elektronische Führung elektronische IR‐Steuerung elektronische Koordinateneinstellung elektronische Kopplung elektronische Leitung elektronische Leseeinrichtung elektronische Leseeinrichtung elektronische Löschschaltung elektronische Messergebniskompensation elektronische Messwerterfassung elektronische Münze elektronische Niveauregelung electromagnetic valve electromagnetic perceptive system electromechanical interlock electromechanical robot hardware electromechanical interlock electromechanical scanner electromechanical drive electromechanical impulse recorder electromechanical manipulator electromechanical low‐frequency control oscillator electromechanical controller electromechanical change‐over switch electromechanical amplifier electromechanical differential analyzer electromechanical system electromechanical metering relay electrometric amplifier electric motor assembly electron electron band spectrum electron emission electron cascade electron coupling electron conductivity electronic microanalyzer electron optics electron‐optical image converter electronic impact electron beam electron‐beam treatment electron beam weld[ed] joint electron‐beam magnetometer electron‐beam oscillograph cathode‐ray tube electron beam weld[ed] joint electron beam welding parameters electron beam welding technique electron beam welding technology electron‐beam technology electron beam remelting process electron‐beam distributor electron current electronics of robot control robot electronics, industrial robot electronics electronic application electronics industry electronically controlled power supplay unit electronically controlled electronic‐controlled final assembly electronically controlled converter electronic‐integrated processing electronic tuning sensitivity electronic balancing electronic automation electronic building brick electronic building bloc electronic data bank electronic data collection electronic data collection electronic data station electronic data processing EDP electronic measurement of revolutions electronic remote control electronic direction electronic robot control, electronic IR control electronic coordinate setting electron coupling electronic direction electronic reader electronic reading device electronic quenching circuit electronic measuring result compensation electronic logging of measured values electronic coin electronic level control stran 80 od 326 EN ‐DE: slovar avtomatizacije in robotike elektronische optische Eingabeeinrichtung electron‐optical input device elektronische Regelung electronically operated control elektronische Regelung electronic control elektronische Regelung der Leitfähigkeit electronic conductivity control elektronische Roboterhardware electronic robot hardware elektronische Robotersteuerung electronic robot control, electronic IR control electronic circuit technique elektronische Schaltungstechnik elektronische Schlupfmesseinrichtung electronic slip measuring device electronic voltage controller elektronische Spannungskontrolleinrichtung f electronic elektronische Spannungskontrolleinrichtung f elektronische Speichereinheit electronic storage device elektronische Steuerung electronically operated control elektronische Steuerung electronic control elektronische Uhr mit kodiertem Digitalsignal electronic clock with coded digital signal elektronische Zählschaltung electronic couting circuit elektronische Zeichenerkennung electronic character recognition elektronische Ziffernlesung electronic digit reading elektronischer Abstimmbereich electronic tuning range elektronischer Antrieb electronic drive elektronischer Antriebsregler electronic drive regulator elektronischer Anzeigesichtbereich electronic display viewing area elektronischer automatischer Schalter electronic automatic swith elektronischer Baustein electronic building brick elektronischer Baustein electronic building bloc elektronischer Belichtungszeitmesser electronic exposure time indicator elektronischer Dampfturbinenregler electronic control systemelectronic controller of vapour turbines elektronischer Dekadenzähler electronic decade counter elektronischer Drehzahl‐Grenzwertschalter electronic switch of marginal speed elektronischer Drehzahlmesser electronic tachometer elektronischer Erfassungssensor electronic acquisition sensor elektronischer Fehlerdetektor electronic error detector elektronischer Feuchtigkeitsmesser electronic hygrometer elektronischer Funktionsblock functional electronic block elektronischer Generator sehr niedriger Frequenzen electronic generator of very low frequencies elektronischer Grenzwertmelder electronic limiting value indicator elektronischer Impulsregler electronic impulse regulator elektronischer Kompensationsferngeber electronic compensation teletransmitter elektronischer Kreis electronic circuit elektronischer Leser electronic reader elektronischer Leser electronic reading device elektronischer Löschkreis electronic quenching circuit elektronischer Messwerterfasser electronic logger (of measured values) elektronischer Multiplikator electronic multiplier elektronischer Paralleldigitalrechner electronic parallel digital computer elektronischer Profilprojektor electronic profile projector elektronischer Raumthermostat electronic spatial thermostat elektronischer Rechenautomat electronic computing automaton elektronischer Rechner computer elektronischer Rechner computing machine elektronischer Rechner calculating machine elektronischer Rechner calculator elektronischer Regler electronic regulator elektronischer Regler electronically operated controller elektronischer Regler electronic controller elektronischer Roboter electronic robot elektronischer Rückstromregler electronic reverse current controller elektronischer Schaltautomat electronic automatic swith elektronischer Schreibautomat electronic writing automaton elektronischer Stift light pen elektronischer Stift light stylos elektronischer Stift beam pen elektronischer Stift electronic pen electronic overload detector elektronischer Überlastungsdetektor elektronischer Vielkanalanalysator electronic multichannel analyzer elektronischer Wählautomat electronic select automaton elektronischer Zeitauslöser electronic timer elektronischer Zufallszahlengenerator electronic random number generator elektronisches electronic data collection electronic component elektronisches Bauelement electronic element elektronisches Bauelement elektronisches Bausteinsystem electronic modular system elektronisches Bauteil electronic component elektronisches Bauteil electronic element elektronisches Datenverarbeitungssystem electronic data processing system elektronisches Datenverarbeitungssystem EDP system elektronisches Geld electronic coin stran 81 od 326 EN ‐DE: slovar avtomatizacije in robotike elektronisches Gerät electronic device elektronisches Geschwindigkeitssteuergerät n electronic speed controller elektronisches Informationsverarbeitungssystem electronic information processing system elektronisches Klassiergerät electronic classifying instrument elektronisches Lenkungsgerät electronic guidance equipment elektronisches Manometer electronic pressure gauge elektronisches Modell electronic model elektronisches Polarimeter electronic pressure gauge 244 electronic polarimeter elektronisches Programmiergerät electronic programming device elektronisches Rechengerät electronic calculator device elektronisches Regelsystem electronic control system elektronisches Relais electronic relay elektronisches Schrittgebersystem electronic step‐by‐step system elektronisches Simulieren electronic controller of vapour turbelectronical simulating electronic control desk elektronisches Steuerpult elektronisches System für Temperaturregelung electronic system for temperature control elektronisches Untersystem electronic subsystem elektronisches Verfahren electronic process elektronisches Warnsignalgerät electronic warning signal device elektronisches Zeitfolge‐Steuergerät electronic time sequence control unit elektronisches Zeitrelais electronic timer elektronisch‐magnetischer Stabilisator electronic magnetic stabilizer elektrooptisch abstimmbarer Laser electrooptically tuned laser elektrooptische Abbildung und Speicherung electrooptical imaging and storage elektrooptische Kopplung electrooptical coupling elektro‐optischer Annäherungssensor electrooptical approximation sensor elektro‐optischer Annäherungssensor electro‐optical approximation sensor elektrooptischer Funktionsgenerator electrooptical function generator elektro‐optischer Geber electrooptical sensor elektro‐optischer Geber electro‐optical sensor elektrooptischer Kaskadenmodulator cascade electrooptic modulator elektro‐optischer Sensor electrooptical sensor elektro‐optischer Sensor electro‐optical sensor elektropneumatisch electropneumatic electropneumatically controlled feed slide elektropneumatisch gesteuerter Zuführapparat elektropneumatische Folgesteuerung electropneumatic sequential control elektropneumatische Sperre electropneumatic interlock elektropneumatische Steuervorrichtung electropneumatic control device elektropneumatischer Effektor electropneumatic actuator elektropneumatischer Fahrschalter electropneumatic controller elektropneumatischer Hochdruckumformer electropneumatic high‐pressure converter elektropneumatischer Kleinregler small electropneumatical regulateur elektropneumatischer Pegelregler electropneumatic level controller elektropneumatischer Regler electronic‐pneumatic controller elektropneumatischer Schalter electric‐pneumatic switch elektropneumatischer Stellungsregler positions electropneumatic position governor elektropneumatisches Ventil electropneumatic valve elektropneumonische Pegelregelung pneutronic level control Elektroregler electrically operated controller Elektroregler electric controller Elektroregler electric regulator elektrostatische Ablenkung electrostatic deflection elektrostatische Abschirmung electrostatic screen elektrostatische Abstoßung electrostatic repulsion elektrostatische Abtastung electrostatic scanning elektrostatische Anziehung electrostatic attraction elektrostatische Bündelung electrostatic beaming elektrostatische Bündelung electrostatic focusing elektrostatische Fokussierung electrostatic beaming elektrostatische Fokussierung electrostatic focusing elektrostatische Operation electrostatic process elektrostatische Technik electrostatic technique elektrostatischer Schirm electrostatic screen elektrostatisches Abfühlen electrostatic sensing Elektrotechnik electrical engineering elektrothermisch electrothermal elektrothermische Bearbeitung electrothermal machining elektrothermischer Drucker thermal printer elektrothermischer Drucker electrothermic printer elektrothermischer Drucker thermoprinter Element member Element element Element der Matrix matrix element Element eines IR element of industrial robot Element für digitale Automatisierung element for digital automation Element mit saturating nonlinearity stran 82 od 326 EN ‐DE: slovar avtomatizacije in robotike Element mit Begrenzung Element mit eindeutiger Kennlinienfunktion Element mit Hysterese Element mit Lose Element mit mehrdeutiger Kennlinienfunktion Element mit mehrdeutiger Kennlinienfunktion Element mit Sättigung Element mit Spiel Element mit Totzeit Element mit verteilten Parametern Element mit zweideutiger Kennlinienfunktion Element mit Zweipunktverhalten Element ohne Trägheit Elementaralgorithmus Elementaralgorithmus Elementaranalyse Elementarbaustein Elementarbewegung feiner Greifereinheit elementare Information elementare logische Verknüpfungen elementarer Automat elementarer logischer Satz elementarer Sensor elementarer Sensor elementares Ereignis elementares Iterationsverfahren elementares Systemunterprogramm Elementarfunktion Elementarglied Elementarintervall Elementaroperation Elementarreaktion Elementarsensor Elementarsensor Elementarvorgang Elementarvorgang Elementvariable Elementwirkungsgrad elliptische Funktion elliptische Gleichung elliptisches System Emissionsanalyse Emissionshäufigkeit Emissionsimpuls Emissionskennlinie Emissionsmesstechnik Emissionsspektralanalyse Emissionsstärkemessung Emissionssteuerung Emissionswahrscheinlichkeit emittierter Impuls Empfänger Empfänger für kohärente Strahlen Empfängerprogramm Empfängertakt Empfangsanlage Empfangsbestätigung Empfangsbestätigungsrelais Empfangsdaten pl Empfangseinrichtung Empfangseinrichtung Empfangseinrichtung Empfangsgeschwindigkeit Empfangskanal Empfangsseite Empfangsterminal empfindlich empfindlicher Berührungssensor empfindlicher Kraftsensor empfindlicher programmierbarer Roboter empfindlicher Roboter Empfindlichkeit Empfindlichkeit gegenüber elektromagnetischen Feldern Empfindlichkeitsanalyse Empfindlichkeitsbereich Empfindlichkeitsbereich limiting nonlinearity single‐valued nonlinearity nonlinearity with hysteresis backlash nonlinearity multivalued nonlinearity multi‐valued nonlinearity saturating nonlinearity backlash nonlinearity element with time delay element with distributed parameters two‐valued nonlinearity on‐off nonlinearity element without inertia elementary algorithm primary algorithm elementary analysis elementary building block elementary movement of gripper elementary information elementary logical connections elementary automaton elementary logical theorem elementary sensor simple sensor simple event elementary iteration procedure elementary system subprogram elementary function elementary member unit interval elementary operation elementary reaction elementary sensor simple sensor basic process elementary process element variable element efficiency elliptic function elliptical equation elliptical system emission analysis emission rate emission pulse emission characteristic emission measurement technology emission spectral analysis emissivity measurement emission control emission probability emission pulse receiver laser pick‐off unit receiver program receive clock receiving plant acknowledgement acknowledge, ACK, answerback acknowledging relay receive data reception device receiving device receiving gear receiving speed receive channel receiving end receiving terminal sensitive sensitive contact sensor sensitive force sensor programmable sensitive robot sensory robot sensitivity magnetic field sensitivity sensitivity analysis range of sensitivity sensitivity region stran 83 od 326 EN ‐DE: slovar avtomatizacije in robotike Empfindlichkeitsfunktion Empfindlichkeitsgrad Empfindlichkeitskehrwert Empfindlichkeitskriterium Empfindlichkeitskurve Empfindlichkeitsverlust Empfindung empirischer Wert empirisches Modell empirisches Verfahren Emulationssprache Emulationssystem Emulgiermaschine emulierte Struktur Endanschlaggeber Enddruck Ende des Zyklus Endeffektor Endeinstellung Endgröße Endkontrolle feines Industrieroboters Endkontrollgerät Endkörper eines Roboters Endlage Endlagengeber Endlageninitiatoren Endlagenüberwachung endlich endlich‐dimensional endlich‐dimensionaler Vektorraum endliche Breite des Impulses endliche Differenzen endliche Folge endliche Impulsbreite endlicher Automat endlicher Stabilitätsgrad endliches Zeitmoment Endlosanlage Endmontage Endmontage mittels Industrieroboters Endposition Endposition Endposition Endprüfung Endpunkt (einer Greiferbahn) Endpunkt eines Manipulators Endpunkt eines Verschiebevektors Endpunktlage eines Manipulators Endpunkt‐Monitorprogramm Endpunktroboter Endregelgröße Endregelungsorgan Endregelunsorgan Endschalter Endstelle Endstellen‐Monitorprogramm Endstufe Endübertrag Endvakuumdruck Endwert Endwert der Verstärkung Endwertregelung Endwertsatz Endwertsatz Endzustand energetische Methode energetischer Wirkungsgrad energetischer Zustand energetisches Modell Energie Energie am absoluten Nullpunkt Energie feiner Greifeinheit Energieabnahme Energieanalysator Energieaufwand Energiebalancemethode sensitivity function degree of sensitivity sensibility reciprocal sensitivity criterion sensitivity curve sensitivity loss perception empirical value empirical model empirical procedure emulation language emulation system emulsifier emulated structure final dog indicator ultimate pressure end of cycle end effector, final effector final adjustment final quantity final checking of industrial robot transmission monitor final body of robot full home position final dog indicator final position initiators final position monitoring finite finite‐dimensional finite dimensional vector space finite pulse width finite differences finite sequence finite pulse width finite automaton finite degree of stability finite time instant endless installation final assembly, end assembly end assembly by means of the industrial robot end position, final position end position final position final inspection end point manipulator end point end point of shift[ing] vector manipulator end point position terminal monitor program end point robot final controlled variable final regulation element final regulation element limit switch terminal terminal monitor program final stage end‐around carry ultimate pressure final value final value of amplification terminal control final value theorem final‐value theorem end status energetic method energetic efficiency energy state energy model energy energy of absolute zero energy of grip unit energy decrement energy analyzer energy consumption energetic balance method stran 84 od 326 EN ‐DE: slovar avtomatizacije in robotike Energiebalancemethode Energiebalancemethode Energieband Energiebedarf Energiebedarf Energiebetrag Energiebilanz Energiedekrement Energiedichte Energieeingang Energieeingang Energieeinspeisung Energieeinspeisung Energieempfindlichkeit Energieerhaltungssatz Energiefernleitung Energiefortleitung Energiefortleitung Energiefortleitung Energiegleichgewicht Energieleitung Energiemenge Energiemodell Energieniveau Energieniveauabstand Energieniveauänderungswert energieökonomisches System energieoptimale Steuerung Energiepegeldiagramm Energiequelle Energiesatz Energieschema Energieschranke Energieschwelle energiesparende Technologie Energiespeichereinheit Energiespektrum Energiestufenabstand Energietransportleitung Energieübertragung Energieübertragung Energieübertragung Energieübertragungskoeffizient Energieumformer Energieumformung Energieumsatz energieunabhängiger Speicher Energieverbrauch Energieverbrauch (des Roboters) Energieverlust Energieversorgungssystem Energieverteilung Energiezufuhrabschaltung Energiezustand eng gekoppelte Prozessoren mpt entartetes Energieband Entartungsgrad entblocken entblocken entblocken Entdämpfung Enterprise‐Informationssystem Enterprise‐Informationssystem entfernt aufgestellte Datenendstation entfernt aufgestellte Datenendstation Entfernungsbestimmung feines Roboters Entfernungserkennungssystem Entfernungserkennungssystem (mittels Mikrowellen) Entfernungsmarkierergenerator Entfernungsmesser mit hoher Auflösung Entfernungsmesskreis Entfernungsrichtigstellung Entfernungssensor Entfeuchtungsanlage Entfeuchtungsprozess m Entgraten durch Roboter method of energetic balance power balance method energy band power consumption power demand amount of energy energy balance energy decrement energy density energy input addition of energy energy input addition of energy energy sensitiveness energy theorem power transmission line energy transfer energy transmission power transmission energy balance energy line amount of energy energy model energy level energy‐level spacing energy‐level change value energy‐economical system energy‐optimal control energy‐level diagram source of energy energy theorem energy‐level diagram energy barrier energy barrier energy‐saving technology energy storage unit energy spectrum energy‐level spacing power transmission line energy transfer energy transmission power transmission energy transfer coefficient energy converter power conversion energy transfer coefficient energy‐independent store energy consumption power consumption (of robot) energy decrement power supply system power distribution tripping of power supply energy state tightly coupled processors degenerate energy level degree of degeneration unlock v unblock v deblock v damping elimination enterprise information system EIS remote terminal remote station robot distance identification distance recognition system distance recognition system (by means of microwaves) range marker generator high‐definition rangefinder range circuit range correction distance sensor dehumidifying plant dehydration process robot deburring, deburring by robot stran 85 od 326 EN ‐DE: slovar avtomatizacije in robotike Entgraten plastischer Teile Entgraten von Werkstücken Entgratungsarbeitsplatz Enthaltensein‐Relation Entkellern entketten Entkopplung Entkopplung von Mehrfachregelungen Entkopplungsanteil Entkopplungsglied Entkopplungsschaltung Entkopplungsschaltung Entlastungsventile für den Armgliedmasseausgleich Entmagnetisierautomat Entmagnetisierungseffekt Entmagnetisierungsfaktor Entnahmebetrieb Entnahmeeinrichtung Entnahmemanipulator Entpolarisierungsgrad entregen Entropie Entropie des optischen Signals Entropiestabilität entscheiden Entscheiderschwelle Entscheidung Entscheidungsbefehl Entscheidungsbefehl für Robotereinsatz Entscheidungselement Entscheidungsfunktion Entscheidungskriterien Entscheidungsmodell entscheidungsorientierte Information Entscheidungsraum Entscheidungsregeln Entscheidungsschaltung Entscheidungsschaltung Entscheidungsstrategie für Robotereinsatz Entscheidungstheorie Entscheidungsverfahren Entscheidungsverfahren für Robotereinsatz Entscheidungswert entschlüsseln Entschlüsselung Entschlüsselungsautomat Entschlüsselungsautomat Entschlüssler Entschlüssler Entschlüßler der Operationen Entschlüsslerkreis entspannter Greiferfinger Entspannungssystem entsperren entsperren entsperren Entstaubungsanlage Entstörer Entstörungseinrichtungen Entstörungsmessung entwerfen entwerfen entwickelte Robotersprache entwickelter Roboter Entwickler für Rechner Entwicklung der integrierten Elektronik Entwicklung der Roboteranwendung Entwicklung nach Eigenwerten Entwicklung von Robotern Entwicklungsarbeit Entwicklungsarbeit Entwicklungspotential Entwicklungsprojekt Entwicklungspunkt Entwicklungsstand der Steuerungstechnik Entwicklungstendenz trimming of plastic pieces deburring of wor pieces trimming workplace inclusion relation pop delink v non‐interaction decoupling of multiloop control decoupling part decoupling joint isolating circuit stopper circuit safety valves for arm element mass compensation automatic demagnetization device demagnetizing effect factor of demagnetization draw‐off mode taking device charging manipulator, loading handler degree of depolarization deenergize entropy optical signal entropy entropic stability arbitrate v decision threshold decision decision instruction decision instruction for robot application decision element decision function decision criteria decision model decision‐oriented information policy space decision rules decision element logical element decision strategy for robot application decision theory decision procedure decision procedure for robot application decision value decode v decoding automaton for decoding decoding automaton decoder decoding machine operation decoder decoding circuit relaxed gripper finger blow‐down system unlock v unblock v deblock v dust removal plant noise suppressor noise‐eliminating device interference elimination measuring design v construct v developed robot language advanced robot computer designer development of integrated electronics development of robots application eigenfunction expansion development of robots development work experimental work development potential development project development point (theory of automata) development stage of control technique development trend stran 86 od 326 EN ‐DE: slovar avtomatizacije in robotike Entwicklungsverfahren Entwicklungszeit Entwurf Entwurf des Regelvorganges Entwurf durch Iteration Entwurf eines digitalen Systems mittels Rechners Entwurf eines Montagesystems Entwurf verfahrenstechnischer Systeme Entwurf von Schaltkreisen Entwurfalgorithmus Entwurfsabkömmlinge Entwurfsanalyse Entwurfsarbeitsplatz Entwurfsautomatisierung conception Entwurfsautomatisierung conception Entwurfsbaum Entwurfsbedingungen Entwurfsbelastung Entwurfsgrundsatz Entwurfskriterium eines Greifermechanismus Entwurfsmethode Entwurfsmodell Entwurfsparameter Entwurfsphase Entwurfsprinzip Entwurfsstrategie Entwurfsziel Entzerrer Entzerrückkopplung Entzerrung Entzerrung Entzerrung durch quantisierte Rückkopplung Entzerrungselement Entzerrungselement Entzerrungselement Entzerrvorkopplung Erdbeschleunigung Erdbeschleunigung Erdfehlerschutz Erdleitungsprüfer Erdschluß Erdschlußprüfer Erdschlußstrom Erdschlußstromschutzschalter Erdschlußstromunterbrecher erdsymmetrische Spannung Erdungsanschluss Erdungskontakt Erdungskontakt Erdungsmesser Ereignis Ereignis Ereignis hoher Priorität Ereignis niederer Priorität Ereigniskennzeichnung Ereignissteuerblock Ereignissynchronisation erfasste Roboterumwelt erfasste Teilinformation erfasstes Einzelobjekt Erfassungvon Bauteilen in Erfassung der charakteristischen Infrarotstrahlung Erfassung der Sensorinformation Erfassung eines Handhabungsvorgangs Erfassung feines Handhabungsvorgangs Erfassungssensor Erfolgswahrscheinlichkeit erforderliche Objektlage erforderlicher Greifbereich erforderlicher Raumpunkt (Roboter) Erforschung mittels Roboters Erfüllbarkeit erfüllen Erfüllung Erfüllungsgrad einer Regel Ergänzungsmachine development technique development time design control process design iterative design computer‐aided digital system design design of assembly system, project of assembly system design of chemical engineering system design of switching circuits design algorithm design issues design analysis engineering working station, engineering workplace, construc design automation automation of project design tree design conditions design load design principle design criterion of gripper mechanism design procedure design model design parameter design phase design principle design strategy design goal equalizer correcting feedback distortion elimination compensation of distortion quantized feedback equalization correcting element correction element correction term correcting feedforward gravitational acceleration gravity acceleration earth‐fault protection earth tester earth‐fault ground detector earth leakage current earth leakage current breaker earth leakage current breaker balanced voltage earth terminal earthing contact earthing contact, ground contact earth tester event occurrence high‐priority event low‐priority event event identification event control block event synchronization acquired environment of robot acquired partial information acquired individual object acquisition of components in characteristic infrared radiation detection acquisition of sensor information acquisition of handling process acquisition of handling process acquisition sensor probability of success required object position required grip region required space position investigation by robot satisfiability satisfy v satisfaction degree of fulfillment auxiliary machine stran 87 od 326 EN ‐DE: slovar avtomatizacije in robotike Ergänzungsprogramm eines IR Ergänzungsschaltung Ergänzungsspeicher Ergodenhypothese ergodische Eigenschaft ergodische Vermutung Ergometer erhöhen erhöhte Temperatur Erholungszeit erkennbar Erkennen Erkennung Erkennung (von Objekten) Erkennung einer Parole Erkennungsalgorithmus Erkennungsalgorithmus Erkennungsaufgabe Erkennungsautomat Erkennungsdaten pl Erkennungseinrichtung Erkennungsfunktion Erkennungsinformation Erkennungsinrichtung Erkennungskode Erkennungslogik Erkennungsmethode Erkennungsorgane Erkennungssensor Erkennungssensor Erkennungssensor Erkennungssensor für feste Objekte Erkennungssoftware Erkennungssoftware eines Industrieroboters Erkennungssystem eines IR Erkennungssystem mobiler Objekte Erkennungssystem mobiler Objekte mobiles Erkennungsteile Erkennungsverfahren Erkennungszeichen Erkennungszeit Erkundungssystem Ermittlung der Grobposition Ermüdung Ermüdungstest Ermüdungstest Ermüdungsversuch Ermüdungsversuch Erneuerungstheorie Eröffnung erproben erregende Größe Erreger Erregeranlage Erregerkaskade Erregerkraft Erregerkraftvektor Erregerkreis Erregermaschine Erregersatz Erregung Erregung und Hemmung Erregungsdichte Erregungsfluss Erregungsfrequenz Erregungsimpuls Erregungsquerschnitt Erregungsspannung Erregungsspannung Erregungsströmung Erregungssystem Erregungsübertragung Erregungswicklung Erregungszeit erreichbar erreichbare Genauigkeit complementary program of IR complementary circuit backing store ergodic hypothesis ergodic property ergodic hypothesis ergometer increment v elevated temperature recovery time identifiable identification (of objects) recognition identification (of objects) recognition of parole identification algorithm recognition algorithm recognition task recognition automaton recognition data recognition equipment recognition function recognition information recognition equipment identifying code recognition logic recognition method perception parts perception sensor, identification sensor perception sensor identification sensor sensor for identification of solid objects identification software robot identification software robot identification system, IR identification system recognition system of mobile objects recognition system of mobile objects perception parts recognition procedure acknowledge character, ACK recognition time pilot system determination of coarse position fatigue fatigue test fatigue trial fatigue test fatigue trial renewal theory opening evaluate v actuating quantity exciter exciter set cascade exciter exciter force exciter force vector excitation circuit exciter exciter set activation excitation and inhibition excitation density excitation flow excitation frequency excitation pulse excitation cross‐section excitation potential excitation voltage excitation flow excitation system excitation transfer excitation winding excitation time accessible obtainable accuracy stran 88 od 326 EN ‐DE: slovar avtomatizacije in robotike erreichbare Zuverlässigkeit Erreichbarkeit Erreichbarkeit Ersatz diskreter Logikbausteine discrets Ersatzdämpfung Ersatzfunktion Ersatzgröße Ersatzleitweg Ersatzmarke Ersatzmodell Ersatzregelstrecken Ersatzregelstreckenkonstanten Ersatzregelung Ersatzschaltung Ersatzschaltung Ersatzteil Ersatztheorie Ersatzzeitweg Wechselkontakt Erscheinungsdarstellung erste Annäherung erste Generation erste Generation von Sichtsystemen erste Harmonische erste Harmonische erste IR‐Generation erste Manipulatorgeneration erste Methode von Lyapunow erste Robotergeneration erste Sichtsystemgeneration Ersteinsatz erster Taktimpuls erstes Entwicklungsprojekt (für Manipulatoren erwärmungsbegrenztes Folgesystem Erwärmungseffekt Erwärmungsverlust erwarteter Mittelwert Erwartungswert erweiterbar erweiterbar erweiterte Datenverwaltung erweiterte Datenverwaltung erweiterter mnemonischer Kode erweitertes Zeitteilungssystem Erweiterung Erweiterung Erweiterung feines Speicherbereichs Erweiterungsbaustein Erweiterungsfähigkeit Erweiterungsfähigkeit Erweiterungsfähigkeit Erweiterungsfähigkeit Erweiterungsmodul Erweiterungsschaltkreis erwünschtes System Erzeugen eines Binärbildes erzeugende Frequenz erzeugende Funktion erzeugende Gleichung erzeugendes Programm erzeugtes Assemblerprogramm Erzeugung eines scharfen Wertes Erzeugung feiner Greiferdrehung Erzeugung geometrischer Strukturen Erzeugungsfrequenz Erzeugungsfunktion erzwungene Linearisierung erzwungene Reaktion forced state 280 erzwungene Roboterbewegung erzwungene Schwingungen erzwungener Anteil erzwungener Zustand erzwungener Zustand ESAutomat ESAutomat ES‐Schweißautomat ES‐Schweißautomat achievable reliability accessibility availability replacing discrete logic equivalent damping fallback equivalent parameter alternate route alternate mark, AM replacement model supplementary controlled systems supplementary controlled system constans emergency control equivalent network equivalent circuit maintenance part replacement theory alternate route, ARU alternating contact event representation first approximation first visual system generation first visual system generation first harmonic fundamental harmonic first robot generation first manipulator generation first method of Lyapunov first robot generation first visual system generation pilot run first clock pulse first development project (for manipulators, robots) heat‐limited servomechanism heating effect Joulean effect expected average value anticipated value expandable extensible advanced data management, ADAM advanced data management extended mnemonic code advanced time‐sharing system, ATS expansion extension store zone extension, memory zone extension, store area exten expander expandability expansibility extendibility extensibility expander expander chip wanted system production of binary image generating frequency generating function generating equation generating routine generated assembler program defuzzification generation of gripper rotation generation of geometric structures generating frequency generating function forced linearization forced response forced robot movement forced oscillations forced component forced state forced regime automatic electroslag welder automatic electroslag welding machine automatic electroslag welder automatic electroslag welding machine stran 89 od 326 EN ‐DE: slovar avtomatizacije in robotike Eulersche Differentialgleichung Euler‐Venn‐Diagramm europäische Normen (Standards) Europakarten (Leiterplattenformat) Europakartensystem Evans‐Methode Evans‐Methode exakte Kopie exakter Regelalgorithmus Exaktheit Exaktheit Exaktheit Exaktheit Exekutivprogramm Exekutivsteuerung exergetischer Elementwirkungsgrad exergetischer Systemwirkungsgrad Existenz‐ und Eindeutigkeitssatz von Cauchy‐Lipschitz Existenzbedingungen Existenzsatz Exklusion exklusive Steuerung EXKLUSIV‐ODER‐Gatter EXKLUSIV‐ODER‐Gatter EXKLUSIV‐ODER‐Gatter EXKLUSIV‐ODER‐Operation EXKLUSIV‐ODER‐Operation EXOR EXOR exothermer Prozess Expansionsgrad Experiment Experimentalaufbau Experimentalmodell Experimentalmodell einer einfachen Fertigungsstraße Experimentalroboter Experimentalsysteme experimentelle Arbeit experimentelle Arbeit experimentelle Bedingungen experimentelle Daten pl experimentelle Identifizierung von Regelstrecken experimentelle Strömungsdynamik experimenteller Montageroboter experimenteller Wert explizit explizite Funktion expliziter Sensorbefehl Exponent Exponent Exponentialabklingen Exponentialgleichung Exponentialkurve Exponentialverteilung Exponentialverzerrung Exponentialvorgang exponentiell zunehmende Verstärkung exponentielle Absorption exponentielle Einheit exponentielle Näherung exponentielle Verzerrung exponentielle Verzögerung exponentieller Abfall exponentieller Verstärker externe Daten pl externe Funktion externe Geometriebeschreibung externe Hilfslogikschaltung externe Regelung externe Robotereinrichtung externe Roboterprüfeinrichtung externe Taktfreigabe externe Taktierung externe Unterbrechung externer Geber externer Geber (Sensor) Euler's differential equation diagram of Euler and Venn European standards European cards European card system method of Evans Evans method exact copy exact regulation algorithm accuracy exactness exactitude precision executive program executive control exergetic element efficiency exergetic system efficiency Cauchy‐Lipschitz theorem existence conditions existence theorem exclusion exclusive control EXCLUSIVE‐OR gate non‐equivalence gate modulo sum gate EXCLUSIVE‐OR operation XOR EXCLUSIVE‐OR operation XOR exothermic process coefficient of expansion experiment experimental assembly experimental model experimental model of simple production line experimental robots experimental systems development work experimental work experimental conditions experimental data experimental identification of systems experimental fluid dynamics experimental assemblage robot experimental value explicit explicit function explicit sensor instruction exponent power exponent exponential damping exponential equation exponential curve exponential distribution exponential distortion exponential process exponentially increasing amplification exponential absorption exponential unit exponential approximation exponential distortion exponential lag exponential decay exponential amplifier external data external function external geometry description external support logic external control external robot device external robot measuring device external clock enable external clocking external interrupt external sensor external sensor stran 90 od 326 EN ‐DE: slovar avtomatizacije in robotike externer IR‐Takt externer Programmspeicher externer Registersatz externer Robotersensor externer Robotertakt externer Sensor externes Ereignis externes Programm externes Roboterprogramm Externgerät Extraktionsapparat Extraktionsprozess Extraktionssystem Extraktionsverfahren Extrapolation Extremalbedingungen Extremalschrittschaltsystem Extremalschrittsystem Extremalsystem mit Extremwertspeicherung Extremalwert Extremalwertregler Extremalwertregler Extremalwertregler Extremalwertregler Extremwertregelung Extremwertregelung Extremwertregelung Extremwertregelung Extremwertregelung Exzess‐Geräuschtechnik f s. P 222 Fabrikationsdaten pl Fachdialogsystem Fachdialogsystem Fachsoftware Fachsprachensoftware Fachwählertastatur Fachwählertastenfeld Fähigkeit Hur Robotermontage Faktor Q Faktor Q Faktor Q Faktoranalysensystem Faktorenwert Fallbügelregistrierung Fallbügelregler fallende Kennlinie Fallklappenrelais Fallstudie Falschauslösung Falschbetätigung falsche Verteilung Falscheinstellung falscher Informationseingang falsches Ausgangssignal Falschschaltung Falsch‐Steuereingangssignal Faltarm Faltung der Wahrscheinlichkeitsverteilung Faltungssatz Faltungssatz Familie fvon System Programmiersprachen FAMS Fangbetrieb Farbdosimetrie Farbe des Roboters farbenkodierte Verbindung Farberkennung Farberkennung eines Roboters Farbgebung mittels Roboters farbige Abbildung mittels Laser Farbmesser Farbpyrometer Farbregelung Farbsensor Farbsensorm external robot cycle, external IR cycle external program memory external register record external robot sensor external robot cycle, external IR cycle external sensor external event external program external robot program external device extraction apparatus extraction process extraction system extraction process extrapolation extremum conditions stepping extremal system stepping extremal system extremal system with storage of the extremum optimum extremal controller extremum controller optimizing controller peakholding peak‐holding optimizing control extremum control optimal control peakholding control optimum control; excess noise technique position perception manufacturing data technical dialogue system special dialogue system; software in a special field nomenclature language software classification keyboard classification keyboard capacity of robot assembly Q‐factor quality factor figure of merit factor analysis system factor value chopper‐bar recording controller with locking device falling characteristic drop indicator relay case study false trip false trip maldistribution maladjustment false information input false output signal false trip false control input signal folding arm convolution of probability distribution convolution integral convolution theorem family of system programming languages flexible automatic assembly (mounting) system, FAMS hunt mode colorimetric dosimetry colour of robot colour‐coded communication colour identification robot colour identification colouring by robot colour laser display colorimeter colour pyrometer colour control colour sensor colour sensor stran 91 od 326 EN ‐DE: slovar avtomatizacije in robotike Farbspritzen Farbspritzmanipulator Farbspritzroboter Farbspritzroboterzyklus Farbstabilität Farbzeilenkamera Faser eines Sensors Faserbündel Faseroptik faseroptische Sensordaten pl faseroptischer Analysator faseroptischer Analysator faseroptischer Drucksensor faseroptischer Entfernungssensor faseroptischer Magnetfeldsensor faseroptischer Magnetfeldsensor faseroptischer Rotationssensor faseroptischer Sensor faseroptischer Temperatursensor faseroptisches Sensorsignal Fasersensor Fasersensortyp Fasertechnik Fassungsvermögen n fastlineares System fastperiodische Lösung Feder‐Masse‐Dämpfer‐System Fehlanpassung Fehlanpassungsverlust Fehlanzeige Fehlbedienung Fehlbedienung Fehlbehandlung Fehlbehandlung Fehlbetätigung Fehlbetätigung Fehleinstellung Fehler beim Annehmer Fehler der Geräte Fehler der Simulation Fehler‐ und Symmetriedämpfung Fehlerabschätzung Fehlerabstand Fehleranfälligkeit Fehleranzeiger Fehleraufspürgerät Fehlerausgleich Fehlerbedingung Fehlerbehandlungsroutine Fehlerbestimmung Fehlerbestimmung fehlerbetätigtes System Fehlerdämpfung Fehlerdetektor Fehlerdiagnose Fehlerdiagnose (von Robotern) fehlererkennender Kode fehlererkennender Kode Fehlererkennung am Roboter Fehlererkennungsschaltung Fehlererkennungsschaltung Fehlererkennungssignal fehlerfrei machen fehlerfreie Hardware fehlerfreie Technik fehlerfreie Übertragung fehlerfreier Betrieb fehlerfreier Fall Fehlerfreiheit Fehlerfreiheit Fehlerfunktion fehlergesteuerte Anlage Fehlergrenze Fehlergrenze Fehlergrenze Fehlergrenze (bei Objekterfassung) paint spraying paint spray manipulator, paint spray handler paint spray robot paint spray robot cycle colour stability colour line camera sensor fibre fibre bundle, fiber bundle (US) fibre optics, fiber optics (US) fibre‐optical sensor data, , fiber‐optical sensor data (US) fibre‐optical analyzer fiber‐optical analyzer (US) fibre‐optical pressure sensor, fiber‐optical pressure sensor (U fibre‐optical distance sensor, fiber‐optical distance sensor fibre‐optical magnetic field sensor fiber‐optical magnetic field sensor (US) fibre‐optical rotation sensor, fiber‐optical rotation sensor (US) sensor with optical fibre fibre‐optical temperature sensor, fiber‐optical temperature se fibre‐optical sensor signal, fiber‐optical sensor signal (US) fibre sensor, fiber sensor (US) type of fiber sensor fibre technique, fiber technique (US) capacity almost linear system almost periodic solution spring‐mass‐dashpot system mismatch mismatch loss nil report operating error faulty operator intervention abuse operation error operating error faulty operator intervention misadjustment acceptor error, AE equipment failure error in the simulation error and balance attenuation error estimation error distance susceptibility to defects error indicator error‐sensing device compensation of errors error condition error handling routine determination of errors error diagnostic error‐actuated system balance attenuation error detector error diagnostic error detection, fault diagnosis (of robots) error‐detecting code check code robot error detection, fault detection of robot error‐detection circuitry fault‐detection circuitry error diagnostic signal debug v fault‐free hardware fault‐free hardware error‐free transmission error‐free operation error‐free fall freedom of defects absence of failures error function error‐actuated system error limit tolerance limit of error (by object registration) limit of error (by object registration) stran 92 od 326 EN ‐DE: slovar avtomatizacije in robotike fehlerhafte Handhabung fehlerhafter Modul fehlerhaftes Element fehlerhaftes Signal Fehlerhäufigkeit Fehlerhäufung Fehlerimpuls Fehlerkompensation des Resolvers Fehlerkompensation des Tachogenerators Fehlerkontrolle fehlerkontrollierender Kode Fehlerkorrektur Fehlerkorrektur Fehlerkorrektureinrichtung Fehlerkorrekturmittel Fehlerkorrekturprogramm Fehlerkriterium Fehlerlokalisationsprogramm Fehlerlokalisierung Fehlerlokalisierung Fehlerlokalisierung Fehlerlokalisierung einer Testroutine Fehlerlokalisierung einer Testroutine Fehlermaßnahmeprogramm Fehlermeldung Fehlermeldung durch Robotersteuerung Fehlermeldung eines IR‐Programms Fehlermeldung eines Roboters Fehlermessung Fehlerortungsgerät Fehlerprüffähigkeit Fehlerprüfungstauglichkeit Fehlerquelle Fehlerquelle Fehlerquelle Fehlerrate Fehlerrechnung Fehlerschutz eines Roboters Fehlerschutzverfahren Fehlerstromschutzschaltung Fehlersuche Fehlersuche Fehlersucher Fehlersuchhilfen Fehlersuchpaket Fehlersuchprogramm Fehlertheorie Fehlertheorie fehlertolerantes Rechnersystem fehlertolerantes Rechnersystem fehlertolerantes System Fehlertoleranz Fehlerübermittlung Fehlerübertragungsfunktion Fehlerüberwachung Fehlerursache Fehlerursachenlokalisierung Fehlerzulässigkeit Fehlfunktion Fehlfunktion Fehlfunktion Fehlgreifanzeige Fehlgreifkontrolle Fehlimpuls Fehlverteilung Feinabtastung Feinbewegung Feineinstellung Feineinstellung des Manipulatorsystems Feineinstellung von Roboterelementen feiner Sensorraster Feinjustierung Feinmontage Feinmontageaufgaben fpi Feinortung Feinpositionierung faulty manipulation faulty module faulty element faulty signal error rate clustered errors error pulse error compensation of the resolver error compensation of the tachogenerator error control error‐controlled code error control error correction error‐correcting device debug[ging] aids error‐correcting program error criterion error localization program error localization defect localization fault localization error localization of test routine error localization of test routine error routine alarm message error message by robot control error message of IR program robot error message error measurement fault‐location instrument error‐checking capability error‐checking capability source of defects source of error error source error rate computation of error robot error protection error protection procedure fault‐current relay protection failure detection trouble shooting fault finder debug[ging] aids debugging packet error localization program error theory theory of error error‐tolerant computer system fault tolerant computer system fail‐soft system fault tolerance fault communication error transfer function error control cause of defects localization of defect causes fault tolerance failure breakdown malfunction nil grip report faulty grip checking spurious pulse maldistribution accurate scanning fine motion (movement) fine adjustment fine adjustment of manipulator system fine adjustment of robot elements fine sensor raster critical alignment fine assembly fine assembly tasks accurate scanning accurate positioning stran 93 od 326 EN ‐DE: slovar avtomatizacije in robotike Feinpositionierung Feinpositionierung eines Effektors Feinpositionierung eines Manipulators Feinpositionierung feines Industrieroboters Feinregelung Feinstellvorrichtung f Feinwegvorgabe Feldbegrenzung Feldbestimmung Feldmodellierung Feldpol Feldunterbrechungsschalter Fermessverfahren mit geschlossenem Messkreis Fernabfrage Fernablesung Fernablesung von Messinstrumenten Fernanzeige Fernanzeige Fernanzeiger Fernbedienung Fernbedienung Fernbedienung Fernbefehl Ferndiagnose Ferndrucker Ferndrucker Ferndrucker Ferndruckregler Ferneingabe Ferneingriff Fernfehlersuche Fernfeldanalysator Ferngeber ferngesteuert ferngesteuerte Robotermontagestation ferngesteuerter Unterwasserroboter Fernkommunikation Fernkontrolle fernladen Fernlenkung f Fernlenkung f Fernlenkung f Fernmeldeleitungsanschluss Fernmeldung Fernmessanzeigensummierung Fernmesseinrichtung Fernmessen Fernmessen Fernmessgeber Fernmessmethode Fernmessmethode Fernmessstromkreis Fernmesssystem Fernmesssystem mit Ausgleichsstrom Fernmessumsetzer Fernmessung Fernmessung Fernmessung Fernmessung Fernmesswandler Fernregler Fernschaltung Fernschaltung Fernschaltung Fernschaltung Fernschreiber Fernschreiber Fernschreiber Fernschreibgerät Fernschreibgerät Fernschreibgerät Fernsehkamera für Fehlerdiagnose Fernsehsensor Fernsteuereinrichtung Fernsteuersystem Fernsteuerung fine positioning fine positioning of effector manipulator fine position fine positioning of robot, fine positioning of industrial robot fine adjustment microadjuster fine presetting of displacements field boundary field definition field simulation field pole field break switch closed‐loop telemetry remote inquiry distant reading measuring instruments remote reading remote display remote indication remote indicator distance control distant control remote control instruction by remote control remote diagnostic teleprinter teletype [writer] teletype printer remote pressure controller remote input distance intervention remote diagnostic far‐field analyzer teletransmitter remotely controlled remotely robot assembly station remotely controlled underwater robot remote communications supervisory control telecharge v distance control distant control remote control communication line adapter remote signalling indication summation in telemetering telemetering device telemetering telemetry telemetering transducer telemetering method method of telemetering telemetric circuit telemetering system balanced‐current telemetry system remote measurement feedback converter remote measurement telemetering distance measurement telemetry remote measurement feedback converter remote controller distance control distant control remote control teleswitching teleprinter teletype [writer] teletype printer teleprinter teletype [writer] teletype printer Tele‐camera for error diagnostic television sensor remote control equipment telecontrol system distance control stran 94 od 326 EN ‐DE: slovar avtomatizacije in robotike Fernsteuerung Fernsteuerung Fernsteuerungsanlage Fernsteuerungskanal Fernsteuerungsschutz Ferntemperaturregelung Fernterminal Fernterminal Fernübertragung Fernübertragung Fernübertragung Fernübertragung mit Amplitudenmodulation Fernübertragung mit quantisiertem Signal Fernübertragungs‐Zugriffsmethode Fernüberwachung Fernüberwachung Fernverarbeitungssystem Fernverarbeitungssystem Fernvorschubsteuerung Fernwartung Fernwirksystem Fernwirktechnik Fernwirktechnik Fernwirktechnikmodulation Fernzugriff Ferrit‐Hallgenerator Ferrittransfluxor ferrodynamisches Relais Ferroresonanzbetrieb Ferroresonanzrechenschaltung Ferroresonanzwirkung Fertigeinstellung Fertigmeldeleitung Fertigungsablauf mittels Industrieroboters Fertigungsanlage Fertigungsaufgabe Fertigungsausrüstung fertigungsgerechte Roboterkonstruktion Fertigungskarte Fertigungskette Fertigungskette Fertigungskette (Reihenschaltung von Maschinen) Fertigungslinie Fertigungslinienroboter Fertigungsmassenspeicher Fertigungsmöglichkeit Fertigungsprogrammspeicher Fertigungsprozess Fertigungsprozessanalyse Fertigungsprüfung Fertigungsprüfung Fertigungsquote Fertigungssteuersystem Fertigungssteuersystem Fertigungssteuerung Fertigungsstraße Fertigungsstraße Fertigungsstückzahl (eines Roboters) Fertigungssystem Fertigungsüberwachung Fertigungszeitdaten pl Fertigungszelle Fest[wert]speicher Fest[wert]speicher Festanschlag feste IR‐Kopplung feste Roboterkopplung feste Struktur feste Verdrahtung fester Armbewegungsablauf fester Befehlssatz fester Bereich fester Endzustand fester Knoten fester Wert festes Hindernis im Roboterarbeitsraum distant control remote control remote control installation remote control channel protection in remote control system remote temperature control remote terminal remote station teletransmission remote transfer remote transmission amplitude‐modulated remote transmission discrete‐signal distance transmission telecommunication access method remote monitoring remote supervision teleprocessing system, TPS teleprocessing system remote feed control remote maintenance remote action system teleautomation telecontrol engineering remote control modulation remote access ferrite‐Hall‐generator ferrite transfluxor ferrodynamic relay ferroresonant operation ferroresonant computing circuit ferroresonant operation final adjustment ready line robot manufacturing sequence, manufacturing sequence by m production equipment manufacturing task processing equipment robot construction suitable to production process card production line production chain production chain flow process flow process robot manufacturing mass memory manufacturability manufacturing program memory manufacturing process analysis of the manufacturing process production test[ing] production testing] production rate assembly control systems assembly control systems, ACS manufacturing control production line production chain production rate (of robot) manufacturing system monitoring of manufacturing manufacturing time data manufacturing cell, production cell fixed memory permanent memory fixed stop fixed robot coupling fixed robot coupling fixed structure fixed wiring fixed arm movement running fixed command set fixed range fixed terminal state fixed vertex fixed value fixed obstacle in operating space of robot stran 95 od 326 EN ‐DE: slovar avtomatizacije in robotike festes Manipulatorgestell festes Objekt festes Roboterablaufprogramm festes Robotermagazin festgesetzter Bereich Festigkeitsziffer Festkörperglied Festkörperschaltkreise Festlegen von Anfangsbedingungen Festlegung der Zugehörigkeitsfunktionen für die Fuzzifizierung Festprogramm Festprogramm Steuerung festprogrammierbarer Industrieroboter festprogrammierbarer Rechner Festprogrammsteuerung Festspannvorrichtung feststehender Portalmanipulator Festwertregelung Festwertregelung Festwertregelung Festwertregelung maintien Festwertspeichersteuerung Festzeitverzögerung Festzeitverzögerung Festzeitverzögerung Feuchtigkeitsabnehmer Feuchtigkeitsanzeiger Feuchtigkeitsbereich Feuchtigkeitsgeber Feuchtigkeitsmessgerät Feuchtigkeitsmessung mit der Infrarotmethode Feuchtigkeitsregelung Feuchtigkeitsregler Feuchtigkeitsregler Feuchtigkeitswert Ficksches Diffusionsgesetz Ficksches Diffusionsgesetz Ficksches Gesetz Ficksches Gesetz figurative Konstante fiktive Belastung fiktive Belastung File Filmdosimetrie Filter mit Abtastung Filter mit begrenztem Gedächtnis Filter mit begrenztem Gedächtnis Filter mit digitalen Elementen Filter mit kammförmigem Frequenzspektrum Filter mit unbegrenztem Gedächtnis Filter mit unbegrenztem Gedächtnis Filteranlage Filterbereich Filtercharakteristik Filterdämpfung Filterfotometer Filterkreis Filtersynthese Filtersyntheseprogramm Filterung durch Zusatzfilter Finger einer Roboterhand Finger eines Industrieroboters Fingeraktion Fingeranzahl (eines Greifsystems) Fingergelenk Fingergelenkanzahl Fingergelenkigkeit Fingergreifeinheit Fingergreifer Fingersensor Fingersystem Firmware fixiertes Bauteil Fixierung (durch Roboter) Flächenabtastung fixed manipulator frame solid object fixed development program of robot fixed magazine of robot fixed range modulus of resistance solid‐state element, solid element solid‐state circuits presetting partitioning fixed program fixed‐program control fixed‐programmable industrial robot fixed‐programmable computer fixed program control clamping device fixed portal manipulator constant value control regulator system control with fixed set point fixed command control fixed memory control definite time lag fixed time lag permanent delay humidity‐sensitive element hygroscope humidity range humidity‐sensitive element humidity measuring instrument moisture measurement by infrared method humidity control humidity controller moisture content controller moisture value Fick's diffusion law Fick's law of diffusion Fick's diffusion law Fick's law of diffusion figurative constant fictitious load phantom load file film dosimetry sampled‐data filter filter of finite memory finite‐memory filter digital filter comb filter filter of infinite memory infinite‐memory filter filtration plant filter range filter characteristic filter attenuation filter photometer filter circuit filter synthesis filter synthesis program additional filtration finger of robot hand robot finger finger action finger number (of grip system) finger joint finger joint number articulation of finger finger grip unit finger gripper finger sensor finger system firmware fixed component fixing (by robot) surface scanning stran 96 od 326 EN ‐DE: slovar avtomatizacije in robotike flächenbeschreibendes Element area‐descriptive element flächenbeweglicher Roboter robocarrier, surface‐mobile robot Flächengestaltung surface modeling Flächengleichrichter junction rectifier surface scanning flächenhafte Abtastung Flächenprogramm (Programm zur Greifersteuerung) surface program Flächenstapelprogramm surface batch program flacher Impuls flat pulse flacher Impuls flat‐topped pulse Flachgehäuse 1 flat pack Flachkabel t flat cable Flachstruktur des Schaltstromkreises flat switching circuit structure Flachteil j flat part Flackereffekt flicker effect Flackerzeichen flashing signal Flammenfotometer flame photometer Flammenlichtstärkemesser flame photometer Flammenregelung flamestat control flutter effect Flattereffekt flexibel einsetzbarer freiprogrammierbarer Industrieroboter flexible to use free‐programmable industrial robot Flexibilität eines Gesamtsystems total system flexibility flexible automatische Montagezelle flexible automatic assembly cell flexible Automatisierung flexible automation flexible autonome Montagezelle flexible autonomous assembly cell flexible Fertigungslinie flexible flow process flexible Fertigungslinie flexible free‐programmable handling dflexible flow process flexible Fertigungszeile flexible production cell. flexible manufacturing cell, flexible pr flexible grip unit flexible Greifeinheit flexible Greifeinrichtung flexible gripping equipment flexible handling device flexible Handhabeeinrichtung flexible handling technique flexible Handhabetechnik flexible multilogic flexible Multilogik flexible order device flexible Ordnungseinrichtung flexible Produktionsstätte flexible production place flexible Rechnerstruktur flexible computer structure flexible Roboterprogrammierung flexible robot programming flexible Roboterstruktur flexible robot structure flexible Robotertechnik flexible robotics, flexible industrial robot[s] technique flexible Roboterzelle flexible robot cell flexible Robotik (Industrierobotertechnik) flexible robotics, flexible industrial robot[s] technique flexible Verkettung flexible linkage flexible feed technique flexible Zuführungstechnik flexibler Greifer flexible gripper flexibler Industrieroboter (Roboter) flexible industrial robot flexibler Informationsspeicher flexible information memory (store) flexibler Montageprozess flexible assembly process flexibler Produktionskomplex flexible production complex flexibler Produktionsmodul flexible production module flexibler Produktionsroboter flexible production robot flexibler Robotergreifer flexible robot gripper flexibles automatisches Montagesystem flexible automatic assembly (mounting) system, FAMS flexibles automatisches Montagesystem flexible flexible automatic assembly system flexibles Automatisierungsmittel flexible automation medium flexibles Backenprofil flexible jaw profile flexibles Befehlssystem flexible instruction system flexibles Fertigungssystem flexible fabrication system flexibles Fingersystem flexible finger system flexibles freiprogrammierbares Handhabungsgerät flexible free‐programmable handling device flexibles Greiferglied flexible gripper element flexibles Greifersystem flexible gripper system flexibles Handhabungssystem flexible handling system flexibles Montagesystem flexible assembly system flexibles Produktionselement flexible production cell. flexible manufacturing cell, flexible pr flexibles Programmieren flexible programming flexibles Speichersystem flexible storage system Fliehkraftregler centrifugal governor Fliehkraftregler gravity regulator Fliehkraftrelais centrifugal relay Fließband flow line Fließbandroboter flow‐line robot Fließbetrieb continuous action Fließbetrieb continuous operation Fließmontage line assembly work Fließschema process diagram Fließschema flow sheet Fließwiderstand forward resistance stran 97 od 326 EN ‐DE: slovar avtomatizacije in robotike Flimmereffekt Flimmerfrequenz Flimmerfrequenz Floating‐Zustand Floating‐Zustand Floppy‐Datei Floppy‐Dateispeicherung Floppy‐Dateiverzeichnis Floppy‐Disk Floppy‐Disk‐Laufwerk Floppy‐Disk‐Steuerung Floppy‐Disk‐Unterstützung Floppy‐Zuweisung flüchtige Speicherung Flugbahnbestimmung durch Laser fluidischer Abstandssensor fluidisches Verknüpfungssystem Fluoreszenzmesser Fluorometer Flussdiagramm Flüssig[keits]abschaltsystem flüssige Dämpfung flüssig‐homogener Reaktor Flüssigkeitschromatografie Flüssigkeitsdruckgeber flüssigkeitsgekühlter Reaktor Flüssigkeitsnetzwerkanalysator Flüssigkeitsniveauanzeiger Flüssigkeitsniveaumesswandler Flüssigkeitsreibung Flüssigkeitsstandanzeiger Flüssigkeitsstandsregelung Flüssigkeitsstromsteuerung Flüssigkeitsströmung Flüssigkeitsumlaufsystem Flüssigmetallkühlkreis Flüssigmetall‐Kühlkreislauf Flussprozess Flußzeit FM‐Modulation Fokussierungsschallsystem Folge Folge von Greiferraumpunkten Folge[r]stufe Folgeadresssteuerung Folgealternator Folgeautomatik Folgeautomatik Folgeautomatik Folgebewegung Folgefrequenz récurrence Folgenbegrenzung Folgeprogrammierung Folgeregelung Folgeregelung Folgeregelung Folgeregelung Folgeregelung Folgeregelungssystem Folgeregelungssystem Folgeregler Folgeregler Folgeregler Folgeregler Folgerung Folgeschalter Folgeschaltkreis Folgeschaltung mit Speicherkreisen Folgesteuerung Folgesteuerung Folgesteuerung Folgesystem mit Erwärmungsbegrenzung Folgewahlschalter Folgezustand eines Industrieroboters Folienspeicher einer IR‐Steuerung Folienspeichersteuerung flicker effect flicker frequency fusion frequency floating state high‐impedance state floppy file storage of floppy file floppy file list floppy disk floppy‐disk drive floppy‐disk control floppy‐disk support floppy assignment volatile storage laser determination of the trajectory fluid distance sensor fluid‐logic system fluorometer fluorometer flow diagram liquid shutdown system viscous damping liquid fuel homogeneous reactor liquid chromatography fluid pressure transducer liquid cooled reactor fluid network analyzer fluid level indicator float level gauge fluid friction fluid level indicator liquid level control fluid‐flow control liquid flow liquid recirculating system liquid metal coolant circuit liquid metal coolant circuit flow process on period frequency modulation focusing acoustic system sequence sequence of space points follower sequence address control, sequential address control sequence alternator follow‐on automatic mechanism sequence automatics sequential automation sequence movement repetition rate limitation of the consequences sequence programming cascade action control dependent control follow‐up control tracking control system tracking system follow‐up system servosystem follower controller follow‐up controller servofollower servoregulator conclusion sequence controller sequential switching circuit sequential circuit with memories run‐off control series control sequential control heat‐limited servomechanism sequence selector switch robot sequence state robot diskette floppy‐disk control stran 98 od 326 EN ‐DE: slovar avtomatizacije in robotike Förderbandzuführung Fördereinrichtung Förderkette Formadaption formale Logik formales Roboterprogramm formales System Formalparameter Formbacke Formelübersetzer Formerkennung Formerkennung Formerkennung formgebendes Filter Formgebung feines Greiforgans Formierkreis Formierkreis Formierungseinrichtung Formierungsglied Formierungsglied Formkode formschlüssige Robotersicherung formschlüssiger Greifer formschlüssiges Greifen Formsteuerung Formungselement Forschung Forschung für Industrieroboter Forschungsarbeit Forschungsergebnis Forschungsmethode forschungsorientierte Verarbeitung Forschungszentrum fortgeschrittene Robotertechnik (Robotik) fortgeschrittener Roboter fortlaufende Kontrolle fortlaufende Kontrolle fortlaufende Überwachung fortlaufende Überwachung Fortpflanzung Fortpflanzungsgeschwindigkeit Fortpflanzungsverhältnis Fortschaltmotor Fortschaltmotor Fortschaltmotor fortschrittliche (progressive) Robotersteuerung fortschrittliche Konzeption fortschrittliche Prüftechnik fortschrittliche Schaltkreistechnik fortschrittliche Testungstechnik Fotodiodenmatrix fotoelektrische Abtastung fotoelektrische Konstante fotoelektrische Messung mittels Nullmethode fotoelektrische Qualitätskontrolle fotoelektrische Steuerung fotoelektrische Wechselwirkung fotoelektrischer fotoelektrischer fotoelektrischer Analogteiler fotoelektrischer Empfänger fotoelektrischer Farbmesser fotoelektrischer Funktionsgenerator fotoelektrischer Komparator fotoelektrischer Leser fotoelektrischer Leser fotoelektrischer Schwärzungsmesser fotoelektrischer Stellungsregler fotoelektrischer Stromkreis fotoelektrischer Verschiebungsgeber fotoelektrisches Bauelement fotoelektrisches Spektralfotometer fotoelektrisches Verfahren Fotoelement Fotoelement Fotoelement belt feed conveyor device conveyor chain Form adaptation formal logic formal robot program formal system formal parameter lot in formula translator object identification pattern recognition object identification, pattern recognition shaping filter forming of gripper shaping circuit shaping network shape‐forming device shaping circuit shaping network graphic code positive robot protection positive gripper, solid gripper positive grip, solid grip shape control forming unit research robot research, industrial robot research research work result of research research method research‐oriented processing research centre advanced robotics advanced robot continuous monitoring continuous supervision continuous monitoring continuous supervision propagation velocity of propagation propagation ratio pecking motor stepping motor repeat motor progressive robot control advanced concept advanced testing technique advanced circuit technique advanced testing technique matrix of photodiode photoelectric scanning photoelectric constant photoelectric measurement by null method photoelectric inspection of quality photoelectric control photoelectric interaction photocell pick‐up photoelectric sensor photoelectric analog divider photoelectric receiver photoelectric colorimeter photoelectric function generator photoelectric comparator photoelectric reader optical scanner photoelectric densitometer photoelectric position controller photoelectric circuit photoelectric displacement transmitter photoelectric building block element photoelectric spectrophotometer photoelectric method photoelectric cell photocell photoelement stran 99 od 326 EN ‐DE: slovar avtomatizacije in robotike Fotoemission photoelectric emission Fotoemission photoemission Fotoemissionsdetektor photoemissive detector Fotoemissionswandler photoemission pick‐off fotogrammetrische Messmethode photogrammetric measuring method fotogrammetrische Technik photogrammetric technology fotoinduziert photoinduced Fotoleitfähigkeit photoconductivity Fotolekteur electronic reader Fotolekteur electronic reading device Fotolumineszenz photoluminescence fotomagnetischer Effekt photomagnetic effect Fotometer photometer Fotometerrechner photometric computer Fototransistorschaltung phototransistor circuit Fotowiderstand photoconductive cell Fotowiderstand photoresistance Fotowiderstandszelle photoconductive cell Fotowiderstandszelle photoresistance Fotozelle photoelectric cell Fotozelle photocell Fotozelle photoelement Fotozelle mit äußerem lichtelektrischem Effekt vacuum photocell Fotozellenfühler photocell pick‐up Fotozellenfühler photoelectric sensor Fotozellenkreis phototube circuit Fotozellentonabnehmer photocell pick‐up Fotozellentonabnehmer photoelectric sensor Fotozellenverstärker photocell amplifier Fourier‐Rücktransformation inverse Fourier transform Fouriersche Reihenentwicklung Fourier expansion Fouriersche Transformation Fourier transformation random logic frei gestaltete Logik freie Bewegung (des Manipulatorarms) free movement, independent movement (of manipulator arm) freie Komponente free component freie Programmierung free programming freie Roboterprogrammierung free robot programming freie Schwingung autooscillation freie Schwingung self‐oscillation freie Schwingung selfvibration freie Schwingung free oscillation freie Schwingung natural oscillation freier Automat free automaton freier Parameter arbitrary parameter freier Schwingungszustand free‐oscillation regime Freigabesignal enable signal freigeben unlock v freigeben unblock v freigeben deblock v Freiheitsgrad degree of freedom Freiheitsgrad eines Greifergelenks gripper joint degree of freedom Freiheitsgrad eines Industrieroboters freedom degree of robot, freedom degree of industrial robot Freiheitsgrad eines Manipulators degree of freedom of manipulator Freiheitsgradachse eines Roboters axis of freedom of robot Freiheitsgradezahl number of freedom degree freiprogrammierbare automatische Montage free‐programmable automatic assemblage freiprogrammierbare automatische Montage librement free‐programmable automatic assemblage freiprogrammierbare Mikroprozessorsteuerung für Industrierfree‐programmable microprocessor control for industrial robo freiprogrammierbare Robotersteuerung (Industrieroboterste free‐programmable robot control, free‐programmable industr freiprogrammierbare Steuerung eines Industrieroboters free‐programmable robot control, free‐programmable industr freiprogrammierbarer Bewegungsablauf free‐programmable movement sequence freiprogrammierbarer Kleinmanipulator free‐programmable miniature manipulator freiprogrammierbarer Kleinmanipulator librement free‐programmable miniature manipulator freiprogrammierbarer Punktschweißroboter free‐programmable spot welding robot freiprogrammierbarer Roboter (Industrieroboter) free‐programmable robot, free programmable industrial robot Freiraumdämpfung free‐space attenuation freischwingende Schaltung free‐running circuit freischwingende Schaltung free‐swinging circuit Freisetzung von Arbeitskräften (durch Robotereinsatz) release of manpower (by application of robots) freiwählbare Gelenkachse free‐selectable joint axis Fremderregung external excitation frequency Frequenz Frequenz der Ansprechschwelle threshold frequency Frequenz des angeregten Überganges stimulated transition frequency Frequenzabweichung frequency deviation frequenzanaloger Umsetzer analogue‐to‐frequency converter, AFC stran 100 od 326 EN ‐DE: slovar avtomatizacije in robotike Frequenzanalyse Frequenzausgangsgeber Frequenzausgleich Frequenzband frequency bandwidth 282 Frequenzbandbreite Frequenzbereich Frequenzbereich Frequenzbereich eines Übertragungssystems Frequenzdetektor Frequenzdiskriminator Frequenzeinstellung Frequenzfehlergrenzen Frequenzfernmessgerät n Frequenzfernmesssystem Frequenzgang Frequenzgang des geschlossenen Regelkreises Frequenzgang des offenen Kreises Frequenzgang des offenen Regelkreises Frequenzganganalysator Frequenzkode frequenzkonstant Frequenzkontrolleinrichtung Frequenzkriterium der Stabilität Frequenzkriterium von Nyquist Frequenzmesser Frequenzmesser Frequenzmethode Frequenzmitzieheffekt Frequenzmodulation Frequenzmodulator frequenzmodulierter Generator des Fernwirksystems frequenzmodulierter Kode Frequenzmultiplex Frequenznormal Frequenz‐Phasen‐Kennlinie Frequenzregler Frequenzregler Frequenzrelais Frequenzschutz Frequenzschwankungsrelais frequenzselektives Element Frequenzsieb Frequenzspektrum frequenzstabilisiert Frequenzsteuerung von Motoren Frequenzteilung von Kanälen Frequenztelemeter Frequenztoleranz Frequenzumtastung Frequenzverdoppler Frequenzvervielfacher Frequenzverzerrungen Frequenzwandler Friktionsregler Frischdampfmaximaldruckregler Frischdampfminimaldruckbegrenzer Front des logischen Impulses Frontbedienfeld Frontplatte Frühanzeigegerät Frühausfall Füge Vorgang eines Industrieroboters Fügeabmessung Fügebewegung Fügeeinheit Fügeflächengestaltung Fügeflächengestaltung Fügeflächenmatrix Fügefunktion feiner IR‐Montage Fügegeschwindigkeit Fügehilfe Fügehilfe Fügekraft Fügekraftbegrenzung Fügeloch Fügelochanfahren frequency analysis frequency output transducer frequency compensation frequency band frequency bandwidth frequency domain frequency range frequency range of a transmission system frequency detector frequency discriminator frequency adjustment frequency error limits frequency telemeter frequency‐telemetering system frequency response closed‐loop frequency response open‐loop transfer function open‐loop frequency response frequency response analyzer frequency code frequency‐stabilized frequency monitor frequency stability criterion Nyquist criterion frequency meter frequency counter frequency method entrainment of frequency frequency modulation frequency modulator frequency‐modulated telecontrol system generator frequency code frequency division multiplex frequency standard frequency‐phase characteristic frequency controller frequency regulator frequency relay frequency protection frequency variation relay frequency‐selective element frequency filter frequency spectrum frequency‐stabilized frequency control of motors frequency division of channels frequency telemeter frequency tolerance frequency‐shift keying frequency doubler frequency multiplier frequency distortions frequency changer friction adjuster main steam maximum pressure controller main steam minimum pressure limiter front of logic pulse front panel front panel warning device initial failure jointing process of [industrial] robot jointing dimension jointing movement jointing unit jointing surface modelling jointing surface modeling jointing surface matrix jointing function of IR‐assembly jointing speed joint[ing] aid jointing aid, joint aid jointing force limitation of jointing force jointing hole jointing hole starting stran 101 od 326 EN ‐DE: slovar avtomatizacije in robotike Fügelochkonstruktion Fügelochlokalisation Fügemechanismus Fügen eines Stiftes (Montageoperation) Fügen von asymmetrischen Werkstücken Fügeoperation feines Industrieroboters Fügerichtung einer IR‐Mon tage Fügestelle (Wirkbereich eines Roboters) Fügesystem Fügetheorie Fügevorgang Fügezeit Fühler Fühler Fühlerkontakt Fühlglied Führung Führung Führungseinheit Führungsfläche eines Roboterarms Führungsglied Führungsgriff (eines Roboterarms) Führungsgröße Führungsgröße Führungsgröße Führungsgröße Führungsgrößenerzeugung einer IR‐Bahn Führungsregelung Führungsrohr eines Greifers Führungssäule Führungsschiene Führungsschiene eines Manipulators Führungssignal Führungssignal Führungssystem eines Roboters Führungstoleranz eines Greifers Führungsübertragungsfunktion Führungsverhalten Führungsverhalten Fülleinrichtung Füllfaktor Füllstandsmessgerät Füllungsgrad Functionsgenerator Fundamentalabstand Fundamentalfolge Fundamentalfunktion Fundamentalsystem Fundamentaltheorem der Informationsübertragung Fünffingerhand Fünf‐Phasenmotor für Roboter Funkeleffekt Funkenoszillator für induktive Erwärmung Funkfernlenkung Funkfernmessung Funkleitung Funksteuerung Funktion eines Greifers Funktion feines Greifweges Funktional Funktionalanalysis Funktionaldeterminante funktionale Beziehung funktionaler Fuzzy‐Regler nach Sugeno funktionaler Fuzzy‐Regler nach Sugeno funktionell vollständige Basis funktionelle Abhängigkeit funktionelle Auswahlmöglichkeit funktionelle Dekomposition funktionelle Klassifizierung funktionelle Möglichkeiten funktionelle Roboterklassifizierung funktionelle Verschachtelung funktionelles Roboterteilsystem funktionelles Symbol Funktionsablauf eines IR jointing hole construction jointing hole localization jointing mechanism jointing of pin (assembly operation) jointing of asymmetric s robot Jointing operation, IR jointing operation jointing direction of IR‐assembly jointing position (active region of robot) jointing system jointing theory jointing process jointing time contact feeler contouring tracer tracer contact sensing component member guidance guide command module guide surface of robot lever set‐point mechanism guide handle (of robot lever) command variable reference input reference variable control variable reference input generating of IR path variable command control guide tube of gripper, gripper guide tube guide column guide rail manipulator guide rail command signal control signal guiding system of robot guide tolerance of gripper control transfer function command input response command response charging device bulk factor wave level gauge charge coefficient function generator fundamental interval Cauchy sequence basis function fundamental system fundamental theorem of information transmission five‐finger hand five‐phase‐motor for robots flicker effect spark‐type induction heating generator radio remote control radiotelemetering radio control radio control gripper function function of grip path functional functional analysis functional determinant functional relationship Sugeno controller SuGENO‐controller functionally complete base functional dependence functional optionality functional decomposition functional classification functional capabilities functional robot classification functional interleaving functional partial system of robot functional symbol function flow of IR stran 102 od 326 EN ‐DE: slovar avtomatizacije in robotike Funktionsausgang Funktionsbefehl Funktionsbeschreibung Funktionsdefinition Funktionsdefinition Funktionsdezentralisierung Funktionseingang Funktionseinheit Funktionsgeber funktionsgerechte Roboterkonstruktion Funktionsglied des Reglers Funktionskennwerte Funktionskontrolle von Relaiskreisen Funktionskorrektur Funktionsmodell Funktionsmodul Funktionsmuster eines Roboters Funktionsnetz Funktionsorganisation funktionsorientierte Programmierung funktionsorientierte Robotereinteilung Funktionspotentiometer Funktionsschema Funktionsschema Funktionsschwankung Funktionsschwelle Funktionssignal Funktionsstörung Funktionsstörung Funktionsstörung Funktionsstruktur Funktionstabellenprogramm Funktionstaste Funktionstest Funktionstest bei Wartung Funktionstestgenerator Funktionsübersicht Funktionsüberwachung Funktionsumformer Funktionsumformer für mehrere Veränderliche Funktionsunabhängigkeit eines Industrieroboters Funktionsverteilungsanalysator Funktionswahl feiner Arithmetik‐Logik‐Einheit Fuzzifizierung Fuzzy‐Logik Fuzzy‐NICHT‐Operator Fuzzy‐ODER‐Operator Fuzzy‐PID‐Regler Fuzzy‐Regelung Fuzzy‐Regelungssystem Fuzzy‐UND‐Operator G reifstelle (Wirkbereich eines Roboters) gältige Ziffer gältige Ziffer galvanische Kopplung galvanischer Kontakt Galvanometerkonstante Gammaeinstellung Gammafunktion Gammaradiometer Gammaspektrometrie Gammastrahlungsabsorption Gangschalter Gangverlust ganze Funktion Ganzheit ganzmagnetisches System ganzzahliges Optimierungsprogramm Gas[entladungs]relais Gas[entladungs]relais Gas[entladungs]relais Gasanalysator Gasanalyse Gasanzeiger gasbetätigt Gaschromatografie operational output function instruction functional description function definition functional definition decentralization of function operational input function unit function generator robot construction suitable to function function element of controller functional characteristics function checking of relay circuits action correction function simulator functional module function model of robot nomogram functional organization function‐oriented programming function‐oriented robot classification function potentiometer symbolic circuit functional scheme function oscillation threshold of operation functional signal failure breakdown malfunction functional structure function table program function key functional test maintenance function test arbitrary function generator functional overview functional monitoring function generator multivariable function generator function independence of industrial robot function distribution analyzer ALU‐function selection, function selection of arithmetic‐logic u fuzzification fuzzy logic fuzzy NOT fuzzy OR fuzzy‐PID‐controller fuzzy control fuzzy control system fuzzy AND grip position (active region of robot) valid digit relevant digit galvanic coupling ohmic contact galvanometer constant gamma control gamma function gamma radiometer gamma[‐ray] spectrometry gamma radiation absorption gang switch loss of cycle entire function integrity all‐magnetic system integer optimization program gas‐discharge relay gas‐filled relay ionic relay gas analyzer gas analysis gas detector gas operated gas chromatography stran 103 od 326 EN ‐DE: slovar avtomatizacije in robotike gaschromatografische Analyse Gasdruckregler Gasdynamik Gasentladungsanzeige Gaserzeugungsanlage Gasexpansionskühlsystem Gasfeuchtemessung Gasflussschreiber gasgefüllte Fotozelle gasgekühlter Reaktor Gaskalorimeter Gaskonstante Gasmesser Gasreinigungsanlage Gasreinigungsprozess Gasrückgewinnungsverfahren Gasschmelzschweißautomat Gasspaltanlage Gasspurenschreiber Gastrennanlage Gasturbinenreaktor Gasverflüssigungsanlage Gatterimpuls Gatterimpuls Gatterimpuls Gatterschaltungslogik Gausskurve belt feed 88 Gausssche Kurve Gausssche Verteilung Gausssche Verteilung Gaussscher Zufallsprozess Gauss‐Tiefpass Gay‐Lussac‐Gesetz geaue Annäherung Geber Geber Geber Geber mit Frequenzausgang Geber mit veränderlichem Widerstand Geberabstand Gebereinheit Geberglied Gebermatrix Gebläsewirkungsgrad ventilateur Gebrauchsanweisung gebrauchsgerechte Roboterkonstruktion gebrochene rationale Funktion Gedächtnis Gedächtnisfunktion Gedächtnisfunktion Gedächtnisgleichung gedämpfte Eigenfrequenz gedämpfte Eigenfrequenz gedämpfte Schwingung gedämpfte Schwingungen gedämpfte Schwingungen gedämpftes Messgerät gedämpftes Strommessgerät gedrängte Kodierung geeichte Skale geeichte Spannungsimpulse tension Gefährdungsanalyse Gefährdungsraum eines IR Gefahrenmeldung Gefahrensicherheit eines Industrieroboters Gefahrensicherheit eines Manipulators Gegendruckmontageplatte gegengekoppelter elektronischer Regler gegengekoppelter Kreis gegengekoppelter Verstärker Gegenkopplung Gegenkopplung Gegenkopplung Gegenkopplungschleife Gegenkopplungsschaltung Gegenkopplungsverstärker gaschromatographic analysis gas pressure regulator gas dynamics gas discharge display gas producting plant gas expansion refrigerating system gas moisture measurement gas‐flow recorder gas‐filled phototube gas‐cooled reactor gas calorimeter gas constant gas‐flow meter gas cleaning unit gas cleaning process gas recovery process automatic gas welding machine gas reforming plant gas traces recording device gas fractionation plant gas turbine reactor gas liquefaction plant indicator gate pulse gate pulse gating pulse gate circuit logic bell‐shaped curve Gaussian curve Gaussian distribution normal distribution Gaussian random process Gaussian low pass filter Gay‐Lussac's law exact approximation converter transducer transductor frequency output transducer variable resistance transducer sensor distance set unit set unit sensor matrix blower efficiency direction for use robot construction suitable to use fractional rational function memory memory function store function memory equation damped frequency (US) damped natural frequency damped oscillation convergent oscillations damped oscillations dead‐beat instrument dead‐beat ammeter compressed coding calibrated dial calibrated voltage‐level pulses hazard analysis danger room of IR alarm message danger safety of industrial robot danger safety of manipulator back‐pressure mounting plate degenerative electronic controller degenerative circuit degenerative amplifier feedback loop degenerative feedback negative feedback negative feedback loop degenerative circuit feedback amplifier stran 104 od 326 EN ‐DE: slovar avtomatizacije in robotike Gegenkopplungsverstärker Gegenkopplungswiderstand Gegenleistung Gegenmodulation Gegennebensprechdämpfung Gegenphase Gegenprobe Gegenschaltung Gegenschaltung gegenseitig synchronisierte Systeme gegenseitig unabhängige Größen gegenseitige Modulation gegenseitige Modulationsverzerrung Gegensinnschaltung Gegenstromapparat Gegenstrombremsung Gegenstrombremsung von Elektroantrieben Gegenstromprinzip Gegenstromprinzip Gegenstromprozess Gegenstromprozess Gegenstromverfahren Gegenstromverfahren Gegenstromwärmeübertragungsprinzip Gegentaktstufe Gegenverbunderregung Gegenverbundkaskadenregelung Gegenverfahren gegenwärtiger Wert Gehäuse für Robotersteuerung Geiferausgleichseinheit Geigerzähler gekoppelte Selbstregelung gekoppelte Selbstregelung gekoppelte Stromkreise gekoppelter Analog‐ und Digitalrechner gekoppeltes Verhalten gekürzt gelagerter Roboterschlitten Gelenk Gelenkachse Gelenkanzahl gelenkartiger Robotermodul Gelenkbelastung Gelenkbewegungen Gelenkdimensionierung Gelenkeinheit eines Greifers Gelenkeinheit feines Industrieroboters Gelenkelement Gelenkfreiheitsgrad Gelenkimpulsgeber Gelenkkinematik Gelenkkonfiguration Gelenkkraft Gelenkkraftvektor Gelenkmanipulator Gelenkmoment Gelenkmomentvektor Gelenkprinzip Gelenkreaktion Gelenkrechner Gelenkregelung Gelenkroboter Gelenksensor Gelenksteuerrechner Gelenkvariable Gelenkwinkel Gelenkwinkel einer Robotertrajektorie Gelenkwinkeldaten pl Gelenkwinkelgröße Gelenkwinkelistwert Gelenkwinkelsolldaten pl Gelenkwinkelsollwerte gemeinsam benutzbar gemeinsame Datenleitung gemeinsame Kommunikationsschnittstelle degenerative amplifier negative feedback coupling resistor negative sequence power push‐pull modulation far‐end cross‐talk attenuation reverse phase check test counter connection connection in oposition mutually synchronized systems mutually independent variables intermodulation cross distortion countercurrent system counterflow apparatus back‐current bracking electrodrive dynamic braking back‐current principle countercurrent principle counterflow operation counterflow process counterflow operation counterflow process heat transmission counter flow principle push‐pull stage differential excitation differential concatenation control back‐to‐back method current value robot control case balancing unit of gripper Geiger counter interacting control multivariable control coupled circuits hybrid computer compound action short pivoted robot carriage joint, hinge joint axis joint number articulated robot module joint load movement of joints dimensioning of joint unit of gripper joint, gripper joint unit robot joint unit, IR joint unit joint element freedom degree of joint, joint freedom degree joint impulse generator joint kinematics joint configuration joint force vector of joint force joint manipulator joint moment vector of joint moment joint principle joint reaction joint computer joint regulation joint robot wrist sensor joint control computer joint variable joint angle joint angle of robot joint angle data joint angle actual value joint angle actual value joint angle nominal value, joint angle nominal data joint angle nominal value, joint angle nominal data shareable common data line common communication interface stran 105 od 326 EN ‐DE: slovar avtomatizacije in robotike gemeinsame Peripherie common peripherals gemeinsame Sprache common language gemeinsame Verteilung join distribution gemeinsames Regelungssystem common control system Gemeinschafts‐Spektrometeranlage installation spectrométriqmultiuser spectrometer facility gemessene Reaktion measured response gemessener Betriebswert measured operating value gemessener Robotergelenkwinkel measured joint angle of robot gemischte Digital‐Analog‐Schaltung hybrid digital‐analog circuit gemischte Steuerung mixed control gemischte Technologie merged technology genaue Fügeoperation precise insert operation genaue Roboterachsregelung accurate robot axis regulation Genauigkeit accuracy Genauigkeit exactness Genauigkeit exactitude Genauigkeit precision Genauigkeit bei der Handhabung mechanischer Bauteile handling accuracy of mechanical components Genauigkeit der Entfernungsmessung range accuracy Genauigkeit der Informationsübertragung fidelity of information transmission Genauigkeit der Regelung accuracy of control Genauigkeit der Regelung accuracy of regulation Genauigkeit der Regelung regulation precision Genauigkeit der Roboteroperation operation accuracy of robot Genauigkeit des Manipulationssystems accuracy of manipulation system Genauigkeit des Steuerungssystems accuracy of control system Genauigkeit eines Roboters accuracy of robot, robot precision Genauigkeitsbestimmung digitaler Voltmeter definition of the accuracy of digital voltmeters Genauigkeitsgrad accuracy grade Genauigkeitsgrad degree of accuracy Genauigkeitsgrenze accuracy limit Genauigkeitsklasse accuracy class Genauigkeitsklasse class of accuracy Genauigkeitskontrollzeichen accuracy check character, ACC accuracy check Genauigkeitsprüfung Genauigkeitstoleranzen (eines Roboters) accuracy tolerances (of a robot) Genauigkeitsüberwachungssystem accuracy control system accuracy study Genauigkeitsuntersuchung Genauigkeitsverlust loss of accuracy electrical heat generator Generator für Dielektrikheizung Generator für sägezahnförmige Schwingungen saw‐tooth wave form generator Generator mit gesteuerter Drehzahl controlled‐speed generator Generator mit selbsttätiger Steuerung automatic generator Generator mit veränderlicher Frequenz variable frequency generator Generator sinusförmiger Signale sinusoidal signal generator Generator von Zufallssignalen generator of random signals Generatorimpulsbetrieb generator pulse regime Generatorspannungsregler generator voltage controller Generieren eines Montagesystems assembly system generation generierte Effektorbahn generated effector path generierte Montagedaten pl generated assembly data generierte Prüfdaten pl generated checking data generierte Roboterkoordinaten generated robot coordinates genietete Baugruppe riveted assembly genügende Näherung adequate approximation Geometrie einer Roboterbahn geometry of robot path, robot path geometry Geometrie mit schmalem Streifen narrow‐stripe geometry Geometriebeschreibung geometry description geometrieorientierte Objektbeschreibung geometry‐oriented object description Geometriesprache geometry language Geometrieverarbeitung geometry treatment geometrische Analogdaten pl geometric analog data geometrische Armelementekonfiguration geometric arm element configuration geometrische Armkonfiguration (Roboterarmkonfiguration) geometric arm configuration (robot) geometrische Information geometric information geometrische Programmiersprache geometric programming language geometrische Roboterkonfiguration geometric robot configuration geometrische Struktur geometric structure geometrische Strukturanalyse geometric structure analysis geometrische Strukturausgabe geometric structure output geometrische Struktureingabe geometric structure input geometrischer Greiferparameter geometric gripper parameter geometrisches Modell geometric model geometrisches Objekt geometric object geordnete Struktur ordered structure Geothermometer geothermometer stran 106 od 326 EN ‐DE: slovar avtomatizacije in robotike gepackte Schaltung geprüfte Große gerade Funktion gerade Funktion gerades Programmstück geradlinige Greiferbewegung geradliniger Bewegungsablauf Geradschiebung eines Greiforgans Geradsichtspektroskop geradzahlige Harmonische Gerät mit byteweiser Übertragung Gerät mit netzunabhängiger Stromversorgung Gerät mit veränderbarer Geschwindigkeit Gerät zur automatischen Ziffernerkennung Geräte der Pneumatik Geräte der Pneumatik Geräteangaben Geräteauswahl Gerätebau Gerätedaten pl Gerätedatenbank Gerätefehler Gerätefehler eines Roboters Gerätefertigung Geräteinnovation Gerätekompatibilität Gerätekomplex Gerätepriorität Geräteprüfungsbit Gerätestatus Gerätestatus Gerätestatus Gerätestatusregister Gerätesteuerblock Gerätesteuerprogramm Gerätesteuerprogramm Gerätesteuerung Gerätestörung Gerätetechnikausfall Gerätetechnikfehler Gerätetechnikschnittstelle gerätetechnisch ausgelöste Unterbrechung gerätetechnisch realisiert Gerätetest Gerätetest Gerätetyp Geräteunabhängigkeit Gerätezuordnung Gerätezuordnung Geräusch geräuscharmer Funktionsablauf geräuscharmer Lauf Geräuschbegrenzer Geräuschmesser Geräuschmesser Geräuschmesser Geräuschpegel Geräuschpegel Geräuschsensor Geräuschsimulation Geräuschunterdrücker geregelte Stromversorgung geregelte Stromversorgung geregelte Temperatur geregelter Effektorzustand geregelter Gleichrichter geregelter Mikrorechner geregelter Roboterantrieb geregelter rotatorischer Positionierantrieb geregeltes Medium geregeltes Netzwerk Gergentaktmodulator gerichtet gerichtete Kette gerichtete Übertragung gerichteter Graph packaged circuit checked quantity even function parity function linear program part rectilinear gripper movement rectilinear sequence of motions straight displacement of grip organ direct vision spectroscope even harmonics byte device self‐powered device variable speed device automatic digit recognizer automatic pneumatic devices pneumatic automation installations device specifications device selection instrument manufacture device specifications device data file, device data bank device error robot device error equipment production equipment innovation equipment compatibility device complex device priority equipment check bit device status, assembly status device status unit status assembly status register, ASR, device status register unit control block device driver program device driver program, device control program device control equipment trouble hardware failure hardware fault hardware interface hardware‐interrupt hardware‐implemented device test unit test device type device independence device allocation device assignment noise quiet operation quiet operation noise limiter noise measuring instrument noise meter noise test set noise level noise ratio sound sensor noise simulation noise suppressor regulated supply stabilized power supply controlled temperature controlled effector state regulated rectifier controlled microcomputer controlled robot drive controlled rotation positioning drive controlled medium controlled network balanced modulator oriented unidirectional circuit directional transmission directed graph stran 107 od 326 EN ‐DE: slovar avtomatizacije in robotike gerichteter Leistungsschutz gerichteter Szintillationszähler geringe Leistungsaufnahme geringe Stromabgabe geringe Stromaufnahme geringster Personalaufwand Geruchssensor Gesamtabmessung Gesamtamplitude Gesamtanlage Gesamtanlage Gesamtbeiwert der stationären Strömung gesamte Entwurfsprobleme gesamte Maschinencharakteristik Gesamteinschaltzeit Gesamtelektroleitfähigkeit Gesamtfehler Gesamtfehler Gesamtflexibilität Gesamtgenauigkeit Gesamtoperation Gesamtplan Gesamtplan Gesamtstruktur Gesamtstruktur eines Hybridsystems Gesamtsystem Gesamtsystem Gesamtsystem Gesamtsystem Gesamtsystemleistung Gesamtübertragungsfunktion Gesamtverhalten Gesamtverlust Gesamtwirkungsgrad Gesamtwirkungsgrad gesättigt gesättigt geschlossene Kurve geschlossene Kurve geschlossene Robotertrajektorie geschlossene Schleife geschlossene Schleife geschlossener Kreislauf geschlossener Lageregelkreis geschlossener Stromkreis geschlossener Stromkreis geschlossener Zyklus geschlossener Zyklus geschlossenes Impulssystem geschlossenes System geschlossenes Unterprogramm Geschwindigkeit Geschwindigkeit Geschwindigkeit der Armkomponenten Geschwindigkeit der Schaltung Geschwindigkeit der Schaltung Geschwindigkeit der Schaltung Geschwindigkeit des Selbstausgleiches Geschwindigkeit des Selbstausgleiches Geschwindigkeit feiner Roboterbewegung Geschwindigkeitsabnahme Geschwindigkeitsbereich Geschwindigkeitsbetrag Geschwindigkeitsdaten pl Geschwindigkeitsdifferenzmessgerät Geschwindigkeitsfehler Geschwindigkeitsgeber Geschwindigkeitsinformation Geschwindigkeitskoordinate Geschwindigkeitsmesser Geschwindigkeitsmodulation Geschwindigkeitsregelung Geschwindigkeitsregelung Geschwindigkeitsregelung Geschwindigkeitsrückführung Geschwindigkeitsrückführung directional power protection directional scintillation counter low‐power consumption low‐power source low‐power drain minimum of staff deodorizing sensor overall dimension net amplitude overall plant complete plant overall steady‐flow coefficient overall design problems (of a computer) overall machine characteristic total closing time addition electrical conductivity gross error total error total system flexibility overall accuracy total operation layout plan general plan total structure total structure of hybrid system total system compound system interconnected system overall system overall system performance overall transfer function summation action overall loss net efficiency overall efficiency saturated saturating closed curve closed graph closed robot trajectory closed loop closed path closed cycle closed loop position control closed circuit complete circuit closed loop closed path closed‐loop pulse system closed system closed subroutine velocity performing operation speed speed of arm components circuit speed operation speed switching speed rate of inherent regulation rate of selfregulation speed of robot movement deceleration speed range speed value speed data, data of assembly speed speed difference measuring device velocity (ramp) error speed sensor speed information velocity speedometer speed modulation speed control velocity control system velocity servomechanism rate feedback velocity feedback stran 108 od 326 EN ‐DE: slovar avtomatizacije in robotike Geschwindigkeitssensor Geschwindigkeitssensorsystem Geschwindigkeitssollwert Geschwindigkeitssteuerung Geschwindigkeitssystem Geschwindigkeitswert Gesenkschmiedekomplex mit Roboter Gesenkschmieden gespannter Greiferfinger gespeicherte Logik gespeicherte Montageerfahrung gespeicherte Roboterwertetabelle gespeichertes Einzelteil gespeichertes Referenzbild gesperrte Auslösung gesperrte Auslösung gesperrter Wert Gesprächszeitmesser gesstörtes System Gestalterkennung Gestalterkennung Gestalterkennung Gestaltungsmethode gestattete Unterbrechung Gestellelement eines Industrieroboters Gestellsystematik von Industrierobotern gesteuerte Beimischung von Unreinheiten gesteuerte Dämpfung gesteuerte Größe gesteuerter Fügemechanismus gesteuerter Funktionsgenerator gesteuerter Leistungsgleichrichter gesteuerter Speicher gesteuerter Synchronmanipulator gesteuerter Übertrag gesteuertes Netzwerk gesteuertes System gesteuertes Zeitintervall gesteuertes Zugriffssystem gesteuertes Zugriffssystem gestörte Bewegung gestörte Greiferbewegung gestörte Leitung gestörter Wert gestörter Zustand gestörtes Element gestörtes Nullausgangssignal gesuchtes System getaktete Logik getaktetes System getastete automatische Verstärkungsregelung getrennt getrennt getrennte Arbeitsweise getrennte Daten getrennte Einheit getrennte Verarbeitung getrennter Handhabezyklus getrennter Steuerteil getrenntes konvexes Gebiet Getriebe eines Zangengreifers Getriebe für Servomechanismen Getriebefreiheitsgrad Getriebeglied Getriebeglieder eines Greifers Getriebegliedergewicht getriebeloser Robotermotor Getriebesteuerkommando (Roboter) Getriebesteuerung Getriebeübersetzungsverhältnis Getriebeübersetzungsverhältnis Getriebeübersetzungsverhältnis Gewährungsebene Gewicht der Getriebeglieder Gewichtete‐Mittelwerte‐Methode Gewichtsfaktor speed sensor speed system of sensor speed nominal value speed control speed system speed value drop forging complex with robot die forging, drip forging tensioned gripper finger stored logic stored assembly experience stored value table of robot stored one‐off part stored reference image fixed trip locked trip inaccessible value chargeable‐time indicator perturbated system object identification, pattern recognition object identification pattern recognition design method enabled interruption robot frame element, frame element of industrial robot robot frame systematics controlled addition of impurities controlled damping controlled variable controlled joint mechanism controlled function generator controlled power rectifier controlled store weight arm manipulator instructed carry controlled network controlled system controlled time interval controlled access system controlled access system, CAS disturbed motion disturbed gripper movement faulted line disturbed value disturbed state faulty element disturbed‐zero output wanted system synchronous logic clocked system gated automatic gain control offline autonomous offline mode separated data separated unit offline processing separated manipulation cycle split control section disjoint convex region gear of pincer gripper gear for servomechanisms gear degree of freedom gear element gripper gear elements weight of gear elements gearless robot motor gear control command gear control gear ratio transfer ratio transfer number compliance level weight of gear elements weighted average defuzzification weight factor stran 109 od 326 EN ‐DE: slovar avtomatizacije in robotike Gewichtsfunktion Gewichtskompensation Gewinn Gewinn des Lasers Gewinn im aktiven Lasermedium Gewinn nach der Demodulation gewinngeführt gewinngeführter Laser Gewinnpegel gewöhnliche Differentialgleichung gewöhnlicher Punkt gewollte Betätigung GH gießen (durch Roboter) Gießereiroboter Gießroboter Gitterableitwiderstand Gitterbasisschaltung Gitterkreis Gitterspektroskop Gittersteuerleistung Gittersteuerung Gitterstromkennlinie Gitterverlustwiderstand Gittervorspannungsmodulation grille glatte Nichtlinearität glätten glättendes Filter Glättung Glättungsdrossel Glättungsfilter Glättungskoeffizient Glättungskreis Glättungsschaltung Gleichaufwinkelübertragung gleichberechtigt gleichbleibende Daten pl Gleichdruckprozess gleichförmig Gleichgangsteuerung Gleichgangstromkreis gleichgerichteter Wechselstrom gleichgerichtetes Signal Gleichgewicht Gleichgewicht Gleichgewichtsbedingungen Gleichgewichtsbedingungen Gleichgewichtsdaten pl Gleichgewichtsenergie Gleichgewichtsgewinn Gleichgewichtslage Gleichgewichtspunkt Gleichgewichtswert Gleichgewichtszustand Gleichgewichtszustand Gleichgewichtszustand Gleichheitsrelation Gleichlaufprüfung Gleichlaufsteuerung gleichmächtig gleichmäßig beschränkt gleichmäßig verteilte Energieniveaus uniforme gleichmäßige Beschickung gleichmäßige Konvergenz gleichmäßige Luftdruckregulation gleichmäßige Roboterarmbewegung gleichmäßige Skale gleichmäßige Skale gleichmäßige Temperaturregeking gleichmäßige Temperaturregelung Gleichmäßigkeit Gleichmäßigkeitsfaktor Gleichphasendetektor gleichphasiges Signal Gleichrichter für hohe Sperrspannungen Gleichrichter‐Fotodiode weighting function compensation of weight gain laser gain active medium gain post‐detection gain gain‐guided gain‐guided laser gain level ordinary differential equation ordinary point deliberate actuation graphical interactive interface cast to (by robot) foundry robot casting robot grid leak grounded‐grid circuit grid circuit grating spectroscope grid driving power grid control grid current characteristic grid leak grid bias modulation smoothed non‐linearity smooth v smoothing filter smoothing smoothing reactor smoothing filter smoothing coefficient smoothing circuit smoothing circuit synchro‐angle transmission peer adj permanent data constant‐pressure cycle uniform gang control gang circuit rectified alternating current rectified signal balance equilibrium equilibrium conditions balance conditions equilibrium data equilibrium energy equilibrium gain uniform steady state equilibrium point conservative value equilibrium position uniform steady state equilibrium state equality relation synchronism check synchronization equipotent uniformly bounded evenly spaced energy levels regular loading, regular feeding uniform convergence continuous pneumatic pressure regulation regular robot lever motion evenly divided scale uniform scale continuous temperature regulation continuous temperature regulation uniformity uniformity factor inphase detector in‐phase signal high‐inverse‐voltage rectifier rectifier photodiode stran 110 od 326 EN ‐DE: slovar avtomatizacije in robotike Gleichrichterfotozelle Gleichrichtermessgerät Gleichrichterparallelschaltung Gleichrichterwandler Gleichrichtung Gleichrichtungswirkungsgrad gleichsinnige Ableitung Gleichspannungspegel Gleichspannungswandler Gleichstrommikromotor Gleichstromübertragung Gleichstromversorgung Gleichstromversorgungsausfall Gleichstromverstärker Gleichstromvorspannung Gleichtaktbetrieb Gleichtaktunterdrückung Gleichung der Regelstrecke Gleichung des statischen Regelkreises Gleichung freier Schwingungen Gleichung in relativen Variablen Gleichungsfehler Gleichungslöser Gleichungssystem gleichzeitig existent gleichzeitiger Betrieb Gleichzeitigkeitswähler Gleichzeitigkeitszähler Gleitelement eines Greifers gleitende Mittelwertbildung gleitende Robotermontage gleitendes Verhalten mit konstanter Geschwindigkeit Gleitführung Gleitgelenk Gleitkommabefehl Gleitkommadarstellung Gleitkommamethode Gleitkommaverfahren Gleitmontageprinzip Gleitzustand Glied Glied des Roboters Glied mit konzentrierten Parametern Glied ohne Ausgleich Gliederzahl eines Manipulatorantriebes Gliederzahl eines Manipulatorantriebes Gliederzahl feines Manipulatorantriebes global geregelter Effektorzustand globale Programmierung globale Reaktivität globale Reaktivität globale Roboterbewegung globale Stabilität globale Stabilität globaler Effektorzustand globales Automatisierungssystem Globaloptimisator Glockenkurve Gradient Gradient elektrischer Feldstärke Gradiometer Grafentheorie Grafikhardware Grafikplotter Grafikprozessor Grafikschreiber grafisch‐analytische Methode grafische Addition grafische Analyse grafische Angaben grafische Bestimmung grafische Darstellung grafische Darstellung grafische Darstellungstheorie grafische Dateneingabetechnik grafische Dateneingabetechnik rectifier photoelectric cell rectifier instrument parallel rectifier circuit rectifier converter rectification rectification efficiency equidirectional derivative direct current level direct current converter DC ‐micro motor direct current signalling direct current [power] supply direct current dump direct current amplifier direct current bias [voltage] common mode common mode rejection equation of controlled system equation of static control circuit equation of free oscillations equation in relative variables equation error equation solver equation system concurrent simultaneous operation coincidence selector coincidence counter sliding element of gripper, gripper sliding element moving‐average floating robot assembly single‐speed floating action sliding guide sliding joint floating‐point instruction floating‐point representation floating‐point method floating‐point method line assembly work sliding regime block robot element element with lumped parameters element without selfregulation drive element number element number of manipulator drive drive element number, element number of manipulator drive global‐controlled effector state global programming static reactivity global reactivity global robot movement stability in the large global stability global effector state global automation system absolute extremum optimizer bell‐shaped curve gradient electric field gradient gradiometer graph theory graphics hardware graphic plotter graphic processor graphic plotter semigraphical method graphic addition graphical analysis graph data graphical determination graph chart graphic representation graph theory graphical data input technique graphical data input technique stran 111 od 326 EN ‐DE: slovar avtomatizacije in robotike grafische Datenstruktur grafische Datenverarbeitung grafische Erfassungseinheit grafische Größe grafische Information grafische Interpretation grafische Komponente grafische Mensch‐Maschine‐Kommunikation grafische Methode grafische Roboterprogrammierung grafische Struktur grafische Unterprogrammbibliothek grafische Vorlage grafische Zugriffsmethode grafischer Achtungssteuerblock grafischer Entwurf grafischer Informationsaustausch grafischer Plotter grafischer und taktiler Bildschirm grafisches Bildschirmprogramm grafisches Display grafisches Endgerät grafisches Grundelement grafisches interaktives Interface grafisches interaktives Programmsystem grafisches interaktives Programmsystem graphique grafisches Paneel grafisches Programmsystem grafisches Rauschen grafisches Sichtanzeigegerät grafisches Zeichen Gramsche Determinante Graphenproblem Graphentheorie Graphenverarbeitung Gratstanzen Grauwert Grauwertbildverarbeitung Gravitationskraft Greensche Funktion Greffersteuergröße Greif art Greif köpf Greif kraft feines Industrieroboters Greif organschließen Greif seil Greif zeit Greifanzeige Greifbacken Greifbackenmitte Greifbedingung eines Werkstücks Greifbereich Greifcharakteristik Greifeinheit Greifeinheit mit drei Fingern Greifeinheitenenergie/ Greifeinrichtung (für Beschickungsroboter) Greifen Greifen eines Stiftes (Montageoperation) Greifen von Handhabungsobjekten Greifer Greifer mit beweglichem Backen Greifer mit Gummifedern Greifer mit symmetrischer Klauenbewegung Greifer mit taktilem Sensor Greifer‐ und Fügewerkzeuge Greiferablaufsteuerung Greiferabmessung Greiferachse Greiferanalyse Greiferanfangspunkt Greiferanpassung Greiferantrieb Greiferantriebsart Greiferantriebsfunktion Greiferantriebsgeschwindigkeit graphic data structure graphic data processing graphic acquisition unit graphic quantity graphic information graphic interpretation graphic component graphic man‐machine communication graphic method graphical robot programming graphic structure graphic subprogram library graphical sheet graphic access method graphic attention control block graphic design graphic communication graphic plotter graphic and tactile screen graphic display program graphic display graphic terminal graphic basic element graphical interactive interface graphical interactive program system graphical interactive program system graphic panel graphical program system graphic noise graphic display graphic character Gram determinant problem of graphs graph theory treatment of graph burr punching grey value processing of grey value images gravitational force Green's function gripper control size grip mode grip head robot grip power, grip power of industrial robot closing of grip organ grip rope, grip cable grip time grip report grip jaw centre of grip jaw grip condition of grip region grip characteristic grip unit three‐finger grip unit energy of grip unit gripping equipment (for feeding robot) grip grip of pin {assembly operation) grip of handling objects gripper, grab, gripping device gripper with movable jaw gripper with rubber springs gripper with symmetrical movement of claw gripper with tactile tensor gripper and jointing tools gripper trace control gripper dimension gripper axis analysis of gripper initial point of gripper gripper adaptation gripper drive kind of gripper drive gripper drive function gripper drive speed stran 112 od 326 EN ‐DE: slovar avtomatizacije in robotike Greiferarbeitsbahn Greiferarbeitspunkte mpf Greiferarbeitsraum Greiferarm Greiferaufbau Greiferaufwand Greiferausführung Greiferausgleichseinheit Greiferausleger Greiferauswahl Greiferauswahlkriterium Greiferbacken Greiferbackenbewegung Greiferbahn Greiferbauelement Greiferbauform Greiferbaugruppe Greiferbedingung Greiferbetätigung Greiferbewegung von Punkt zu Punkt Greiferbewegungsbereich Greiferbewegungseinheit Greiferbewegungsparameter Greiferbreite Greiferdreheinheit Greiferdreherzeugung Greiferdrehgelenk Greiferdrehgeschwindigkeit Greiferdrehung Greiferdrehwinkel Greiferdurchmesser Greifereffektor Greifereigenschaft Greifereinflussgrösse Greifereinrichtung Greifereinsatzbedingung Greifereinstellung Greiferelementarbewegung Greiferendpunkt Greiferenergiekopplung Greiferenergieleitung Greiferentwurf Greiferfinger Greiferflexibilität Greiferfolgebewegung Greiferform Greiferformadaptation Greiferformgebung Greiferfühlelement Greiferführung Greiferführungsgetriebe Greiferführungsgetriebe mit Drehgelenken Greiferführungsgetriebe mit Schubgelenk Greiferführungsprofil Greiferführungsrohr Greiferführungssystem Greiferfunktion Greifergelenk Greifergelenkabstand Greifergelenkeinheit Greifergelenkelement Greifergelenkfreiheitsgrad Greifergestalt Greifergestaltadaptati on Greifergetriebe Greifergetriebeglieder Greifergleitelement Greiferglied Greifergliedlänge Greifergrobbewegung Greifergrobeinstellung Greifergrundbauelement Greifergrundbaugruppe Greiferhand Greiferhand mit berührenden Sensoren Greiferhandbaugruppe gripper working path [of robot] gripper working points gripper working space gripper arm gripper structure gripper expense gripper construction balancing unit of gripper gripper boom, boom of robot gripper selection of gripper, gripper selection choice criterion of gripper gripper jaws gripper jaw movement, movement of gripper jaw gripper path gripper component gripper type of construction assembly of gripper gripper condition actuating of gripper gripper movement from point to point region of gripper motion (movement) movement unit of gripper, motion unit of gripper gripper movement parameter gripper width gripper rotation unit generation of gripper rotation rotation joint of gripper gripper rotation speed gripper rotation (arm) gripper rotation angle gripper diameter gripper effector gripper property gripper influence size gripper equipment application condition of grip‐per adjustment of gripper, gripper adjustment elementary movement of gripper end point of gripper energy coupling of gripper gripper energy line design of gripper gripper finger flexibility of gripper gripper movement sequence form of gripper form adaptation of gripper forming of gripper gripper sensing element gripper guide gripper guide gear, gripper guide transmission gripper guide gear with rotation joints gripper guide gear with shear joint gripper guide profile guide tube of gripper, gripper guide tube gripper guide system gripper function gripper joint distance of gripper joint unit of gripper joint, gripper joint unit gripper joint element gripper joint degree of freedom form of gripper form adaptation of gripper gripper gear gripper gear elements sliding element of gripper, gripper sliding element gripper element length of gripper element gross motion of gripper coarse adjustment of gripper basic element of gripper gripper basic assembly gripper hand gripper hand with touching sensors gripper hand sub‐assembly stran 113 od 326 EN ‐DE: slovar avtomatizacije in robotike Greiferhandbewegung Greiferhanddrehung Greiferhandform Greiferhandsteuerung Greiferhöhe Greiferhub Greiferkatalog Greiferklaue Greiferkonstruktion Greiferkoordinatensystem Greiferkopf Greiferkopplung Greiferkraftmessung Greiferkraftrichtung Greiferlagerung Greiferlänge Greiferlineareinheit Greifermasse Greifermasse Greifermechanismus Greifermechanismusvarianten Greifermoment Greifermontage Greifernullpunktlage Greiferobjekt Greiferöffnen Greiferoperation Greiferordnung Greiferorgan Greiferorientierung Greiferparameter Greifer‐Peripherie Greiferplatte Greiferposition Greiferpositionierung Greiferprinzip Greiferprofil Greiferprofilform Greiferprogramm Greiferraumpunkt Greiferrichtung Greiferrolle Greiferrollenführung Greiferrotation Greiferrotationsachse Greiferrotationsangaben Greiferrotationsdaten pi Greiferrückführung Greiferschließen Greiferschubbewegung Greiferschubweg Greiferschwenkbewegung Greiferschwenkwinkel Greiferschwerpunkt Greiferschwingung Greiferselektion Greifersicherheit Greiferspiel Greiferspieleinstellung Greiferstandardbahn Greiferständer Greifersteilung Greifersteuerleitung Greifersteuerung Greiferstillsetzzeit Greiferstruktur Greiferstrukturauswahl Greiferstrukturbezeichnung Greiferstrukturvariante Greifersuchbewegung Greifersystem Greifersystem mit starren Fingern Greifersystematik Greifersystematik Greifertastorgan Greifertechnik hand motion (movement) of gripper gripper hand rotation gripper hand form hand control of gripper gripper height gripper stroke gripper catalogue gripper claw gripper construction gripper coordinate system gripper head coupling of gripper measurement of gripper force direction of gripper force gripper support gripper length gripper linear unit gripper weight mass of gripper, gripper mass gripper mechanism variants of gripper mechanism gripper moment gripper assembly gripper zero point position gripper object, object of gripper gripper opening (robot command) gripper operation order of gripper gripper claw orientation of gripper parameter of gripper periphery of gripper gripper plate gripper position, position of gripper gripper positioning principle of gripper profile of gripper gripper profile form gripper program sequence point of gripper gripper direction roll of gripper, gripper roll roll guide of gripper, gripper roll guide gripper rotation gripper rotation axis data of gripper rotation data of gripper rotation recycling of gripper gripper termination, gripper closing (robot command) gripper sliding movement, robot gripper sliding movement gripper sliding route swivel motion (movement) of gripper swivel angle of gripper centre of gravity of gripper gripper vibration selection of gripper, gripper selection gripper safety play of gripper, gripper play adjusting of gripper play, gripper play adjusting gripper standard path gripper support gripper position, position of gripper gripper control line gripper control gripper stopping time gripper structure gripper structure selection gripper structure designation (of robot) gripper structure variant search movement of gripper gripper system gripper system with rigid fingers systematic of gripper systematics of gripper gripper touching organ gripper technique stran 114 od 326 EN ‐DE: slovar avtomatizacije in robotike Greifertranslationseinheit Greifertyp Greiferüberblick Greiferumgebung Greiferunterdruck Greiferuntersuchung Greifervariation Greiferverfahrensgeschwindigkeit Greiferverfahrgeschwindigkeit Greiferverlagerung Greiferverschluss Greifervolumen Greiferwechsel Greiferwechseleinrichtung Greiferwechselminimierung Greiferwechselsystem Greiferwechselzeit Greiferwelle Greiferwerkzeug Greifer‐Y‐Achse Greifer‐Z‐Achse Greiferzange Greiferzuverlässigkeit Greiffinger Greiffläche Greifflächenabstand Greifflächenanalyse Greifflächenform Greifflächengestalt Greifflächenkontur Greifflächenpaar Greifgenauigkeit Greifhilfen Greifkraft Greifkraftalgorithmus Greifkraftbegrenzung Greifkraftberechnung Greifkraftbestimmung Greifkraftermittlung Greifkraftkennlinie Greifkraftkontrolle Greifkraftregelung Greifkraftsensor Greifkraftüberwachung Greifkraftvektor Greifkraftverlust Greifkraftverstärkung Greifkraftwirkung Greiflänge Greifmasse Greifmoment Greiforgan Greiforganantrieb Greiforganbewegung f( Bewegung eines Greiforgans Greiforgandimensionierung Greiforgandrehung Greiforganlagerung Greiforganlamelle Greiforganöffnen Greiforganspitze Greifposition Greifpunkt (eines Greifers) Greifseilanordnung Greifsensor Greifsicherheit/' Greifstelle Greifsystem Greiftechnik Greiftheorie Greifvorgang Greifvorrichtung Greifvorrichtung für kleine Teile Greifvorrichtung grappin Greifvorrichtung grappin Greifweg Greifwegfunktion translation unit of gripper gripper type gripper review environment of gripper gripper under pressure gripper study variation of gripper gripper process speed gripper process speed gripper displacement gripper closure gripper volume gripper change gripper change device gripper change minimizing gripper change system gripper change time gripper shaft gripper tool gripper Y‐axis gripper Z‐axis gripper pliers, gripper pincer, gripper nippers gripper reliability grip finger grip surface, gripping, (grab) area distance of grip surface, distance of gripping surface grip surface analysis grip surface form form of grip surface contour of grip surface pair of grip surfaces grip accuracy grip aids grip force, grip power algorithm of grip force limitation of grip power calculation of grip force determination of grip force investigation of grip force characteristic line of grip power checking of grip force regulation of grip force sensor of grip force grip force survey grip force vector expense of grip force intensification of grip power action of grip force grip length grip mass grip moment grip organ grip organ drive grip organ movement dimensioning of grip organ grip organ rotation ‐ support of grip organ, grip organ bearing lamina of grip organ opening of grip organ grip organ point grip position grip point (of gripper) arrangement of grip cable gripping sensor grip safety grip place grip system grip technique grip theory grip process grip device gripping device for small parts grip device gripper equipment grip path function of grip path stran 115 od 326 EN ‐DE: slovar avtomatizacije in robotike Greifzentrum Greifzyklus Grenzbedingung Grenzbedingungen Grenzdämpfung Grenzdaten pl Grenzeffekt Grenzenpaar Grenzfall Grenzfrequenz Grenzfrequenz Grenzfrequenz Grenzfrequenz Grenzkontakt Grenzkontakt Grenzkraft grenzkraftgesteuerte Fügebewegung Grenzmoment Grenzmomentcharakteristik Grenznutzentheorie Grenznutzentheorie Grenznutzungsdauer Grenzschichtspannungsmesser interfaciale Grenzstabilität Grenzstörung Grenzstrom Grenztemperatur Grenztoleranz Grenzwert Grenzwert Grenzwert Grenzwertbetrachtung Grenzwertprozess Grenzwertprüfung Grenzwertregler Grenzwertsatz Grenzwertsatz Grenzwertschalter Grenzwertsignal Grenzwertvergleicher Grenzwiderstand Grenzzyklus Grerferentwicklung Grerfertiefe Gretferbackenbearbeitung Grifffestigkeit Grifffläche Griffflächenabstand Griffflächendistanz Griffflächenform Griffflächenkennzahl Griffflächenlage Grob weg vorgäbe Grobabstimmung Grobbewegung eines Industrieroboters grobe Annäherung grobe Regelung Grobeinstellung Grobfilterung Grobfilterung Grobposition eines IR Grobposition eines Manipulators Grobpositionierung Grobpositionsermittlung Grobregler Grobstruktur Grobstruktur Grobstruktur Grobwegvorgabe Großbereichsintegration Größe große Bestrahlungsanlage Größe des Faktors große EDV‐Anlage große Informationsmenge große Transiente grip centre grip cycle limiting condidion boundary conditions cut‐off attenuation maximum rating threshold effect bound pair limit case cut‐off frequency edge‐frequency limiting frequency critical frequency alarm contact limit contact limit force limit force‐controlled jointing movement limit moment characteristic of limit moment boundary utility theory marginal utility theory marginal service life interfacial tensiometer limit stability boundary perturbation limiting current limit temperature limit tolerance boundary limit value limit limiting process limiting process marginal checking limiting controller boundary value theorem threshold theorem limiting value switch limit [value] signal limit comparator critical resistance limit cycle gripper development gripper depth gripper jaw working ability to withstand handling gripping surface distance of grip surface, distance of gripping surface distance of grip surface, distance of gripping surface form of gripping surface index of gripping surface position of gripping surface coarse presetting of displacements coarse tuning coarse movement of industrial robot rough approximation coarse control coarse adjustment prefiltration preliminary filtration coarse position of robot, coarse position of industrial robot coarse position of manipulator coarse positioning determination of coarse position preregulator coarse structure, MAC restructure coarse structure macrostructure coarse presetting of displacements large‐scale integration variable large‐irradiation plant factor value large‐scale computing system bulk information large transient stran 116 od 326 EN ‐DE: slovar avtomatizacije in robotike Größenordnung Größensteuerung großer Ausfall großer Schaden großes Monitorprogramm Großflächenproportionalzähler Großpegel‐Logik Großraumspeicher Großraumspeicher Großrechnersystem Großserienfertigung Großsignalanalyse Großsignalbereich Grundauftrag (Grundierung f) mittels Spritzroboters Grundausführung Grundausrüstung Grundausrüstung Grundausstattung Grundbandsignalgabe Grundbauart eines IR Grundbauelement Grundbauelement eines Greifers Grundbaugruppe Grundbaustein eines Greifers Grundbefehl Grundbewegung Grundbeziehung Grundbeziehung Grunddatei Grunddatendarstellung Grundecho Grundformat Grundfrequenz Grundfunktion Grundgeschwindigkeit Grundgesetz Grundgleichung Grundgleichung Grundkode Grundkomponente der Stomänderungen Grundkonfigurationeines Manipulators Grundkonfiguration eines Manipulators Grundkonstante Grundkreis Grundmaschine Grundmodell Grundoperation Grundoperation Grundplatte Grundplatte eines Manipulators Grundprogrammierung Grundrahmen Grundrauschen Grundrechenelement Grundsatz der Robotertechnikanwendung Grundsatzentscheidung Grundschaltung Grundschaltung Grundschwingung Grundschwingungstyp Grundstellung Grundsymbol Grundsymbol einer Programmiersprache Grundtaktfrequenz Grundtyp Grundverfahren Grundzeit Grundzustand Gruppe von Montagerobotern Gruppenlaufzeit Gruppenlaufzeitcharakteristik mit konstanter Steilheit Gruppenlaufzeitmesser Gruppentheorie Gruppenumformer für Millivoltsignale Gruppenunterbrechung Gruppierung (durch Roboter) order of magnitude size control major failure major failure large monitor program large‐area proportional counter high‐level logic bulk store bulk memory large‐scale computing system large‐scale production large‐signal analysis large‐signal region ground coat application by spray robot basic execution basic equipment basic hardware basic hardware baseband signalling basic construction of IR basic element basic element of gripper basic unit basic module of gripper basic instruction base movement base equation fundamental equation basic file basic data representation background return basic format base frequency basic function basic speed fundamental law base equation fundamental equation basic code fundamental component of the current variations basic configuration of manipulator basic configuration of manipulator basic constant basic circuit basic machine basic model basic operation unit operation base plate manipulator base plate basic programming base frame background noise basic computing element principle of robot technique application leading decision schematic circuit schematic diagram basic oscillation fundamental vibration mode normal position basic symbol basic symbol of programming language basic clock pulse frequency basic model unit process basic time ground state assembly robot group envelope delay [time] linear‐slope group delay characteristic envelope delay [time] meter group theory millivolt‐signal group converter control break grouping (by robot) stran 117 od 326 EN ‐DE: slovar avtomatizacije in robotike gültige Daten pl Gültigkeit Gültigkeitsbestätigung Gültigkeitskontrolle Güteabschätzung Gütebedingungen Gütefaktor Gütefaktor Gütefaktor Gütefunktion Gütefunktional Gütegrad Gütegrad Gütegrad Güteklasse Gütekriterium Gütekriterium Gütekriterium Gütekriterium für die Regelung Güteparameter indirect control checking Güteparameter indirect control checking Gyrofrequenz Haftfestigkeit Haftfestigkeitsprüfung Haftmagnet (Wirkorgan) Haftprinzip Haftspannung halbautomatisch halbautomatische Bahnverfolgung halbautomatische Einstellung halbautomatische Einstellung halbautomatische Einstellung halbautomatische Maschine halbautomatischer Betrieb halbautomatischer Regler halbautomatisches Datenerfassungssystem halbautomatisches Prüfgerät halbautomatisches Verfahren Halbbetriebautomatisierung Halbbildübertragung eines IR Halbfertigfabrikat Halbfertigprodukt halbkreisartige Abweichung Halbleiter Halbleiter‐ Dünnschichtlaser Halbleiterbauelement Halbleiterbildwandler Halbleitergeräteparameter Halbleitermikroprozessor Halbleitersensor Halbleitertechnologie Halbleitertriode Halbleiterverstärker halblogarithmisch halblogarithmische Zahlendarstellung halbparallele Verarbeitungseinheit Halbperiode Halbperiode Halbperiodengleichung halbstabiler Grenzzyklus halbstetige Funktion Halbstofferzeugung Halbweggleichrichter Halbwelle Halbwelle Halbwertszeit Hall‐Effekt Hall‐Effektsensor Hall‐Sensor Haltbedingung Haltebedingung Haltebefehl Haltegenauigkeit {eines Greifers) Halteglied Halteglied nullter Ordnung Haltekraft valid data validity validation validity check[ing] estimation of quality performance conditions Q‐factor quality factor figure of merit criterion function cost function Q‐factor quality factor figure of merit grade performance criterion performance index estimation of quality performance index index of quality quality index gyro‐frequency adherence adherence test magnetic pick‐up adhesive principle sticking voltage semi‐automatic aided tracking semi‐automatic adjusting semi‐automatic regulation, semi‐automatic adjusting semi‐automatic regulation semi‐automatic machine semi‐automatic operation semi‐automatic controller semi‐automatic data acquisition system semi‐automatic tester semi‐automatic procedure half‐process automation half‐image transmission of IR semi‐finished product semi‐finished product semicircular deviation semiconductor semiconductor film laser semiconductor building block element optical image chip semiconductor instruments parameters semiconductor microprocessor semiconductor sensor semiconductor technology transistor semiconductor amplifier semi‐logarithmic floating‐point representation semi‐partial processing unit half period semicycle equation of halfperiods half‐stable limit cycle semicontinuous function half‐material generation half‐wave rectifier half period semicycle half life Hall effect Hall [effect] sensor Hall [effect] sensor hold condition hold condition breakpoint halt (instruction) stopping accuracy (of gripper) holding element zero‐order hold element (ZOH) tractive force (power) (manipulator) stran 118 od 326 EN ‐DE: slovar avtomatizacije in robotike Haltekreis Halten eines Objekts Haltepunkt Haltepunkt Halterelais Halterelais Halterelais Halterung für Schweißwerk‐ Halteschalter Halteschaltung Halteschlüssel Haltesicherheitsfaktor Haltestromkreis Haltestromschaltung Haltevorrichtung eines Industrieroboters Haltevorrichtung eines Industrieroboters Haltevorrichtung für Montage Haltewirkung Haltezange Haltezeit Hamacher Produkt Hamacher Produkt Hamacher Summe Hamacher Summe Hamilton‐Jacobische Gleichung Hamiltonsches Prinzip Hand feines Industrieroboters Hand mit drei Fingern Handbediengerät einer IR‐Steuerung Handbetätigung Handbetätigung Handbetätigung Handbetätigungseinheit Handbetrieb eines Manipulators Handeingabeprogrammierung Handelemente Handgelenk eines Industrieroboters Handgelenkbewegung Handgelenkkraftsensor Handhabeaufgabe Handhabebaukasten Handhabebaukasten Handhabebaukasten Handhabeeinrichtung Handhabeeinrichtung Handhabeeinrichtung Handhabeeinrichtungssignal Handhabefehler Handhabefehler Handhabefehler Handhabefehler Handhabefehler Handhabefunktion Handhabegerät Handhabegerät Handhabegerät Handhabegerät Handhabegerät Handhabegerät mit Rechnerkopplung Handhabegerät mit Rechnerkopplung calculatrice Handhabegerät mit Rechnerkopplung calculatrice Handhabemasse Handhaben handhaben handhaben Handhabeobjekt Handhabeoperation Handhabeprogramm Handhaberoboter Handhabesteuergerät Handhabetechnik Handhabetechnik manipulation Handhabetechnik manipulation Handhabevorgang Handhabevorgang Handhabevorgang hold[ing] circuit holding of object holding point breakpoint blocking relay guard relay interlocking relay support for welding tool with holding key hold[ing] circuit holding key safety factor for holding hold[ing] circuit lock[ing] circuit robot support, support of industrial robot robot support, support of industrial robot assembly support holding action gripping pliers hold time Hamacher intersection operator Hamacher product Hamacher sum Hamacher union operator Hamilton‐Jacobi equation Hamilton's principe robot hand hand with three fingers hand‐operated device of IR‐control hand operation manual control manual setting manual control unit manual operation of manipulator manual input programming manual elements, hand elements hand Joint of [industrial] robot hand joint movement force sensor of hand joint handling task handling assembly unit, manipulation assembly unit handling assembly unit manipulation assembly unit handling equipment, manipulation equipment handling equipment manipulation equipment handling device signal handling error, handling defect, manipulation error (defect) handling error handling defect manipulation error manipulation defect handling function handling device, manipulation device handling device manipulation device manipulator handler handling device with computer coupling, manipulation device handling device with computer coupling manipulation device with computer mass of manipulation handling handle v manipulate v handling object handling operation handling program handling robot handling control device handling technique, manipulation technique handling technique manipulation technique handling process handling process, manipulation process manipulation process stran 119 od 326 EN ‐DE: slovar avtomatizacije in robotike Handhabezyklus Handhabezyklus Handhabezyklus Handhabung Handhabung (von Werkstücken) Handhabung mechanischer Teile Handhabung mittels Roboter Handhabung von Montageteilen Handhabung von Montageteilen Handhabung von Montageteilen Handhabung von Objekten Handhabung von Prismateilen Handhabung von Rotationsteilen Handhabung von vormontierten Baugruppen Handhabungsanforderung Handhabungsarm Handhabungsautomat Handhabungsautomatisierung Handhabungshilfen Handhabungshilfen Handhabungsobjekt Handhabungsoperation Handhabungsprozess Handhabungsprozessdaten pi Handhabungsroboter Handhabungssequenz Handhabungssequenz Handhabungssystem Handhabungstechnik Handhabungstechnik Handhabungstechnik Handhabungstechnikbaukasten Handhabungstechnologie Handhabungsvorgang Handhabungsvorgang Handhabungsvorgang Handlerpaket Handmontage Handmontageanteil Handoperation Handregelsystem asservissement Handregelsystem asservissement Handregelung Handregelung Handregelung Handrückstellung Handsteuerung Handsteuerung Handsteuerung Handsteuerung der Nachfolgearbeit hängender Greiferständer Hardware Hardware feines Industrieroboters Hardware für Montageroboter Hardware Unterbrechung Hardware‐Assembler Hardware‐Ausfall Hardwarebereich Hardwarefehler Hardware‐Fehler Hardware‐Identifikation Hardware‐Kompatibilität Hardware‐Konfiguration Hardwarerobotersteuerung Hardware‐Schnittstelle Hardwaresignal Hardwaresignalspiel Hardwaresignalspiel Hardwarespiel Hardwarestandardisierung Hardware‐Steuerung Hardwaresystemrücksetzen Hardwaresystemrücksetzen Hardwaresystemrücksetzen Harmonic Drive Harmonic‐Drive‐System handling cycle, manipulation cycle handling cycle manipulation cycle handling handling handling of mechanical components handling by means of robots, manipulation by means of robots handling of assembly parts handling of assembly parts, manipulation of assembly parts manipulation of assembly parts handling of objects handling of prism parts handling of rotation parts handling of pre‐assembled assemblies handling requisition manipulation arm handling automaton handling automation handling aides handling aids handling object handling operation handling process, manipulation process handling process data handling robot handling sequence sequential handling handling system handling technique, manipulation technique handling technique manipulation technique handling technique building block handling technology handling process handling process, manipulation process manipulation process handler packet hand assembly hand assembly part hand operation manual closed‐loop control system manual‐monitored control system hand operation manual control manual setting manual reset adjustment hand operation manual control manual setting hand control of following work pendant gripper support hardware robot hardware, IR hardware assembly robot hardware hardware‐interrupt hardware assembler hardware failure hardware area hardware error hardware fault hardware identification hardware compatibility hardware configuration hardware robot control hardware interface hardware signal backlash of hardware signal backlash of hradware signal hardware backlash hardware standardization hardware control backspace of hardware system, reset of hardware system backspace of hardware system reset of hardware system harmonic drive harmonic drive system stran 120 od 326 EN ‐DE: slovar avtomatizacije in robotike Harmonie Drive Harmonie‐Drive‐System Harmonische harmonische Analyse harmonische Balance harmonische Bewegung Harmonische des Lasers harmonische Komponenten harmonische Linearisierung harmonische Teilschwingungen harmonische Zeitfunktion harmonischer Analysator harmonischer Analysator harmonischer Eingriff harmonischer Frequenzteiler harmonischer Frequenzwandler harmonischer Oszillator harmonischer Synthetisator harmonisches Filter harmonisches Signalspektrum Härtegrad Härteprüfautomat Härteprüfer Härteprüfgerät hartlöten (durch Roboter) Häufigkeit von Roboterfehlern Häufigkeitsfunktion Häufigkeitsverhältnis Häufigkeitswert Haupt[fertigungs]prozess Hauptachse Hauptalgorithmus Hauptanlage Hauptantrieb Hauptarbeitsraum eines IR Hauptbaugruppe feines Industrieroboters Hauptbewegungsachse Haupteinheit Hauptfertigungsprozess Hauptgerät Hauptgerät Hauptgruppe Hauptgruppensteuerung Hauptkomponente Hauptkontakt Hauptkopplung Hauptlaser Hauptleitstand Hauptleitstand Hauptleitstand Hauptleitstand Hauptleitung Hauptoption Hauptperiode Hauptprogramm für Montage Hauptprozess Hauptprozessor Hauptrechner Hauptregler Hauptresonanz[stelle] Hauptrückführung Hauptrückkopplung Hauptrücksetzsignal Hauptschalter Hauptschalter Hauptschalttafel Hauptschalttafel Hauptschalttafel Hauptschalttafel Hauptschleife Hauptspeicher Hauptstufe Hauptträgheitsachse Haupttrennfuge Hauptvergleicher Hauptvergleichereinheit harmonic drive harmonic drive system harmonics harmonic analysis harmonic balance harmonic motion laser harmonic harmonic components harmonic linearization harmonic components harmonic function of time Fourier analyzer harmonic analyzer harmonic action harmonic frequency converter harmonic frequency converter harmonic oscillator harmonic synthesizer harmonic filter harmonic spectrum of signal degree of hardness hardness‐testing automaton hardness tester hardness tester braze to, to hard‐solder (by robot) robot error rate, fault rate of robot frequency function abundance ratio frequency value main [fabrication] process principal axis master algorithm main plant main gear main working room of IR robot main group of parts, industrial robot main group of part main movement axis master unit main fabrication process, main process master device master main group intermediate control main component main contact main coupling main laser central control board central control desk master control panel main control board main line main option major cycle assembly main program, assembly master routine main fabrication process, main process main processor master computer (of robot drive) master controller main resonance major feedback major feedback master reset signal main line switch master controller central control board central control desk master control panel main control board major loop general store main stage principal axis of inertia main expansion joint main comparison unit main comparison unit stran 121 od 326 EN ‐DE: slovar avtomatizacije in robotike Hauptzyklus Havarieschutz eines Roboters heb‐ und senkbarer Arm Hebeeinrichtung Hebemagnet heben (Werkstück) Hebeverfahren Hebezeug Heimroboter Heißleiter Heizanlage Heizdrahtmanometer Heizenergiekreis Heizsystem Heizungsregler Heizungsregler Heizungsregler Heizungstechnik Heizwert Heizwert Helbleiterlaser mit schmalem Streifen Helium‐Neon‐Laser Helligkeitseinstellung Helligkeitseinstellung Helligkeitsregler Helligkeitssteuerung Herangehen herkömmliches lineares System hermetischer Verschluß elektronischer Apparaturen Herstellbarkeit Herstellen von Anfangsbedingungen Herstellen von Anfangsbedingungen Herstellungsgenauigkeit Herstellungstechnik Herstellungstechnologie Herstellungstechnologie Herstellungsverfahren hervorheben hervorheben hervorholen Herztaktgeber Heterodynsignal heterogenes Reaktormodell heteropolare Bindung heterostatische Schaltung heterostatisches Messgerät heuristische Eingabedaten pl heuristische Entwurfsmethode heuristische Lösungsmethode heuristische Methoden HF‐Generator HF‐Generator HF‐Generator HHO HHO‐Flachpalette HHO‐Strom Hierarchie Hierarchiesystem hierarchisch aufgebautes System hierarchisch strukturierter Entwurf hierarchische Struktur für Datenmanagements hierarchisches Mehrrechnersystem hierarchisches Mehrrechnersystem multiples hierarchisches Unterbrechungssystem high‐aktives Signal High‐Logikpegel Hilbert‐Transformation Hilfsalgorithmus Hilfsanlagenraum Hilfsarbeitsmittelsystem Hilfsausrüstung Hilfsbrücke Hilfsdampf[versorgungs]system Hilfseinrichtung Hilfsenergieregler Hilfsfertigungsprozess major cycle average protection of robot elevate and depress arm lift [ing] device lifting magnet lift to (work piece) lifting method hoist household robot thermistor heating plant Pirani gauge heater power circuit heating system heat controller heating controller thermoregulator heat engineering calorific value heating value narrow‐stripe semiconductor laser helium‐neon laser brightness control luminance control brightness controller brightness control approach conventional linear system hermetic sealing of electronic devices manufacturability initialization initializing accuracy of manufacture manufacturing technique production technology manufacturing technique fabricating technique accentuate v emphasize v pop up v pacemaker heterodyne signal heterogeneous reactor model heteropolar bond heterostatic circuit heterostatic instrument heuristic input data heuristic design method heuristic solution method heuristic methods high‐frequency generator HF‐generator radio‐frequency alternator handling object handling object flat pallet, HO‐flat pallet stream of handling objects hierarchy hierarchical system hierarchical system hierarchically structured design hierarchical structure for data managements hierarchical multi‐computer system hierarchical multicomputer system priority interrupt system high‐active signal logic high level Hilbert transform auxiliary algorithm auxiliary equipment compartment auxiliary fluid system auxiliary equipment auxiliary bridge auxiliary steam supply system auxiliary device indirect action controller auxiliary [fabrication] process stran 122 od 326 EN ‐DE: slovar avtomatizacije in robotike Hilfsfertigungsprozess Hilfsgenerator hilfsgesteuerter Regler Hilfsgröße Hilfskontakt für fotoelektrischen Sensor Hilfskorrektor Hilfskreislauf Hilfsluftregler Hilfsmittel hilfsmittelorientierte Daten pl Hilfsoperation Hilfsprozess Hilfsprozess Hilfsprozess Hilfsprozessor Hilfspumpe Hilfsregelgröße auxiliaire Hilfsregler Hilfsroboter Hilfsrückführung Hilfsselektor Hilfsspeicher Hilfsspeicherplatz eines IR Hilfssteuerfunktion Hilfssteuersystem Hilfssteuersystem Hilfsstromkreis eines Roboters Hilfsträgerfrequenz Hilfsverabeitungssystem hintere Impulsflanke Hintereinanderschaltung Hintereinanderschaltung Hintergrunddaten pl Hintergrundecho Hintergrundprozessor Hintergrundrauschpegel Hintergrundsignal Hintergrundstrahlungsmesser Hintergrundverarbeitung Hinweis Hinweisregister Hitzdrahtinstrument hitzebeständiges Greifwerkzeug Hitzmessstreifengerät Hl Temperatursensor hoch sensorisiertes Greifen Hochauflösungslidar hochdichte Schaltungstechnik Hochdruckanlage Hochdruckförderung Hochdruckprozess Hochdruckstoß Hochdrucktechnologie Hochdruckverfahren hochempfindlich hochempfindliches Laserdetektionssystem hochempfindliches Nachrichtensystem Hochfrequenz Hochfrequenz Hochfrequenzfernmeldeapparat Hochfrequenzfernmesssystem Hochfrequenzfilter Hochfrequenzgenerator Hochfrequenzgenerator Hochfrequenzgenerator Hochfrequenzinduktionsheizung Hochfrequenzintervall Hochfrequenzmesstechnik Hochfrequenznachrichtenkanal Hochfrequenzspektroskopie Hochfrequenzverstärker Hochfrequenzverzerrung Hochgeschwindigkeitslogik Hochgeschwindigkeitsroboter Hochgeschwindigkeitsschaltkreis Hochgeschwindigkeitsschaltung auxiliary fabrication process auxiliary generator pilot‐operated controller auxiliary quantity auxiliary contact for photoelectric sensor auxiliary corrector auxiliary circuit auxiliary air regulator tool aids‐oriented data auxiliary operation auxiliary [fabrication] process auxiliary fabrication process auxiliary process companion processor, coprocessor, auxiliary processor auxiliary pump objective variable auxiliary corrector auxiliary robot subsidiary feedback auxiliary selector auxiliary store auxiliary storage location of IR auxiliary control function auxiliary control system auxiliary control system, ACS auxiliary circuit of robot subcarrier frequency auxiliary processing system back pulse front cascade connection series connection background data background return background computer background‐noise level background signal background measurement radiometer background processing indication pointer register hot‐wire instrument heat‐resistant gripper tool hot‐strip instrument temperature sensor high‐sensorized grip high‐definition lidar high‐density circuit technique high‐pressure facility high‐pressure transport high‐pressure process high‐pressure pulse high‐pressure technology high‐pressure process high‐sensitivity high‐sensitive laser detection system supersensitive communication system radio frequency high frequency high‐frequency remote signalling apparatus high‐frequency telemetering system high‐frequency filter high‐frequency generator HF‐generator radio‐frequency alternator high‐frequency induction heating interval of high frequencies high‐frequency measuring technique high‐frequency communication channel high‐frequency spectroscopy high‐frequency amplifier high‐frequency distortion high‐speed logic high‐speed robot high‐speed circuit high‐speed circuit stran 123 od 326 EN ‐DE: slovar avtomatizacije in robotike Hochgewinnübergang Hochleistungslaser Hochleistungslaserstrahlung Hochleistungssystem hochohmiger Ausgang Hochpass Hochregal r Hochregallager hochselektiver Empfänger Hochspannungsbeschleuniger Höchstausschalter maximum höchste Intensität höchste Modulationsfrequenz Höchstlastanzeiger m Höchstleistung höchstmögliche Belastung Höchstwert Höchstwert Höchstwertoptimalregelung Hochvoltbeschleuniger hochwertiges Bauteil hohe Arbeitsgeschwindigkeit Höhe einer Zugehörigkeitsfunktion hohe Integration hohe Operationsgeschwindigkeit hohe Operationsgeschwindigkeit hohe Schaltgeschwindigkeit Höheneinstellung Höhenflossenverstellung Höhenmesser Höhenparallaxe parallel access 466 Höhenpegel Höhenregelung hoher Automatisierungsgrad hoher Flexibilitätsgrad höhere geometrische Programmiersprache höhere Harmonische höhere Harmonische höhere mathematische Routine höhere Programmiersprache höhere Roboteranforderung < höhere Roboterprogrammiersprache hohlkugelförmiger Arbeitsraum Hohlraummagnetron Hohlraumresonator Hohlraumwellenmesser homogene Differentialgleichung homogene Differentialgleichung I. Ordnung homogene Differentialgleichung II. Ordnung homogener Automat homogener Reaktor mit flüssigem Brennstoff homogenes Gleichungssystem homogenes System homomorphes Modell homomorphes System homöopolare Leistung Homostruktur Homostrukturlaser Hopkinsonscher Streufaktor Horizontalablenkverstärker horizontale Ablenkschaltung horizontale Ablenkschaltung horizontale Achse horizontale Polarisation horizontaler Greiferantrieb horizontaler Roboterknickarm Horizontalpolarisation Hörsignal Hörsignal Hubkraft Hubmagnet Hubverfahren Hubvermögen Huffman‐Caldwell‐Verfahren HURWITZ‐Kriterium hybride Arbeitsweise high‐gain transition high‐energy laser high‐power laser radiation high‐performance system high‐impedance output high‐pass filter high rack, high shelf store of high rack, store of high shelf single‐signal receiver high‐voltage accelerator maximum cut‐out peak intensity maximum modulation frequency maximum demand indicator maximum output ultimate load crest value peak value peak‐holding optimizing control high‐voltage accelerator high‐grade component high‐speed operating speed height of membership function large‐scale integration fast operation speed high‐speed of operation fast switching speed height adjustment tail plane adjustment height gauge parallax in altitude amplitude level height control high‐degree of automation high flexibility degree higher geometric programming language overtone higher harmonic higher mathematical routine high‐level programming language higher robot demand higher robot programming language working zone in form of not‐low sphere, hollow spherical wor cavity magnetron cavity resonator cavity wavemeter homogeneous differential equation first order homogeneous differential equation second order homogeneous differential equation homogeneous automaton liquid fuel homogeneous reactor homogeneous equation system homogeneous system homomorphic[al] model homomorphic system homopolar sequence power homostructure homostructure laser Hopkinson's leakage coefficient horizontal‐deflection amplifier horizontal‐deflection circuit horizontalscanning circuit horizontal axis horizontal polarization horizontal gripper drive horizontal buckling arm of robot horizontal polarization audio signal sound signal lifting force lifting magnet lifting method lifting force method of Huffman‐Caldwell (theory of automata) Hurwitz's stability criterion hybrid operation stran 124 od 326 EN ‐DE: slovar avtomatizacije in robotike hybride Modelle hybride Optimierung hybride Rechnerstruktur hybrider Umsetzer hybrides Mehrkörpersystem (eines IR) hybrides Programm hybrides Radar‐ und Infrarotdetektionssystem hybrides Rechnersystem Hybridrechner Hybridrechner mit Sensorsystem Hybridrechnerkonsole Hybridrechnerperipherie Hybridschaltkreis Hybridschaltkreis Hybridschaltung Hybridsystem (eines Industrieroboters) Hybridtechnik Hydratationsanlage Hydratationsvorgang Hydraulikzylinder hydraulisch angetrieben hydraulisch angetriebene Lineareinheit hydraulische Analogie hydraulische Digitalsteuerungen hydraulische Fernübertragung hydraulische Fühlersteuerung hydraulische Greiferzange hydraulische Integrieranlage hydraulische Logik hydraulische Regelsysteme hydraulische Regelung hydraulische Regelvorrichtung hydraulische Regelvorrichtung hydraulische Robotersteuerung (IR‐Steuerung) hydraulische Roboterversion (Roboterausführung) hydraulische Strahlrohrregelung hydraulischer Antrieb hydraulischer Antrieb hydraulischer Differentialanalysator hydraulischer Drehwinkelantrieb hydraulischer Drehwinkelantrieb rotation hydraulischer Industrieroboterantrieb (Roboterantrieb) hydraulischer Integrator hydraulischer Kreis hydraulischer Positionierungsservomechanismus m hydraulischer Regelkreis hydraulischer Regler hydraulischer Regler hydraulischer Regler hydraulischer Servomotor hydraulischer Stellantrieb hydraulischer Strahlstromregler hydraulischer Verstärker hydraulischer Wirkungsgrad hydraulischer Zahnstangenantrieb hydraulisches Antriebssystem hydraulisch‐pneumatische Greifereinrichtung hydraulisch‐pneumatischer Greifer Hydrierprozess hydrodynamischer Drehmomentwandler hydroelektronische Programmsteuerung hydropneumatisch Hydroraffinationsanlage hydrostatischer Antrieb hyperbolische Funktion hyperbolic navigation 312 hyperbolische Geschwindigkeit hyperbolische Navigation hypergeometrische Wahrscheinlichkeit Hypothese Hysterese Hysterese[schleifen]schreiber Hysteresecharakteristik Hystereseerscheinung Hysteresefehler Hysteresekonstante Hysteresemesser hybrid models hybrid optimization hybrid computer structure hybrid converter hybrid multi‐body system hybrid program hybrid radar‐infrared system hybrid computer hybrid computer hybrid computer with sensor system console of hybrid computer periphery of hybrid computer hybrid integrated circuit hybrid IC hybrid circuit hybrid system (of industrial robot) hybrid technique hydration plant hydration process hydraulic cylinder hydraulic‐driven hydraulic‐operated linear unit hydraulic analogy hydraulic digital controls hydraulic remote transmission hydraulic tracer control hydraulic gripper pincer hydraulic differential analyzer hydraulic logic fluid systems oil‐operated control hydraulic controller hydraulic regulator; hydraulic robot control, hydraulic IR control hydraulic robot version jet‐pipe oil‐operated control oil‐operated drive hydraulic drive hydraulic differential analyzer hydraulic drive of rotation angle hydraulic drive of rotation angle hydraulic industrial robot drive hydraulic integrator hydraulic circuit hydraulic positional servomechanism hydraulic servosystem hydraulic regulator hydraulic controller hydraulic regulator; oil‐operated power cylinder hydraulic actuator jet‐pipe oil‐operated controller hydraulic amplifier hydraulic efficiency hydraulic gear rack drive hydraulic drive system hydraulic‐pneumatic gripper (gripping device) hydraulic‐pneumatic gripper (gripping device) hydrogenation process hydrodynamic torque transformer hydroelectronic program control hydropneumatic hydrorefining plant hydrostatic drive hyperbolic function hyperbolic velocity hyperbolic navigation hypergeometric[al] probability hypothesis hysteresis hysteresigraph hysteresis characteristic hysteresis phenomenon hysteresis error hysteresis constant hysteresis meter stran 125 od 326 EN ‐DE: slovar avtomatizacije in robotike Hysteresemotor Hysteresemotor mit Selbstanlauf Hysteresenichtlinearität Hystereseverluste Hysteresismesser Hysteresisschleife ideal durchmischter Reaktor ideale Theorie Idealimpuls idealisiertes System Idealwert Identifikation Identifikation Identifikation Identifikation der Gerätetechnik Identifikationsblock Identifikationsprozedur identifizierbar identifizieren Identifizieren von Objekten durch Sensoren Identifizierer Identifizierer identifizierte Variable identifiziertes Bauelement identifiziertes Werkstück identifiziertes Werkstück Identifizierung von Regelstrecken Identifizierungskennzeichen Identifizierungskennzeichen Identifizierungsmaschine Identifizierungsmethode Identifizierungsprüfung Identifizierungsverfahren identische Gleichung identischer Geber identischer Sensor (Geber) Identität Identitätsblock idiostatische Schaltung idiostatischer Stromkreis I‐Element I‐Element I‐Glied Ignitronregelung imaginäre Polstellen imaginärer Frequenzgang Imaginärteil Immersionsgewinn Impedanz Impedanzanpassung Impedanzausgleichsglied Impedanzausgleichsglied Impedanzkomparator Impedanzkorrektor Impedanzmessung Impedanzschutz Impedanzsteuerung Impedanzübertragung Impedanzwandler Impedanzwandler imperativorientierte Sprache implementierte Robotersprache implementiertes Programmiersystem Implementierung einer IR‐Steuerung Implikation Implikation nach Mamdani Implikation nach Sugeno Implikationsoperator impliziert impliziert implizit implizit implizite Funktion implizites Differenzenverfahren Impuls Impuls hysteresis motor self‐starting hysteresis motor hysteresis non‐linearity hysteresis losses hysteresis meter hysteresis cycle perfectly mixed reactor ideal theory ideal pulse idealized system ideal value identification (of objects) estimation identification hardware identification identification block identification procedure identifiable identify v sensor object identification identifier identification label identified variable identified component identified identified work piece controlled plant identification identifier identification label recognizing machine identification method identification check identification process identical equation identical sensor identical sensor identity identity unit idiostatic circuit idiostatic circuit integral element integral‐element, I‐element integrating element ignitron control imaginary poles imaginary frequency response imaginary part immersion gain impedance impedance matching impedance balancing block impedance balancing unit impedance comparator impedance corrector impedance measurement impedance protection impedance control impedance transfer impedance converter impedance matching transformer imperative‐oriented language implemented robot language implemented programming system implementation of IR control implication Mamdani implication Sugeno implication implication operator implicit implied implicit implied implicit function implicit finite difference method impulse pulse stran 126 od 326 EN ‐DE: slovar avtomatizacije in robotike Impulsabschwächer Impulsabstand Impulsabtastung Impulsamplitudenanalyse Impulsamplitudenanalyse impulsamplitudenmodulierter Träger Impulsamplitudenprüfer Impulsannäherung Impulsanstiegszeit Impulsanstiegszeit Impulsantwort Impulsantwort Impulsaufbereitung Impulsauflösung Impulsausgangsverstärker Impulsbandbreite Impulsbasis Impulsbegrenzung Impulsbelastung Impulsbetrieb impulsion impulsbetriebener Lidar Impulsbreitenregelung Impulsbündel Impulsdach Impulsdämpfungsglied Impulsdauer Impulsdauer Impulsdiagramm Impulsdifferentialanalysator Impulsdifferenzzähler Impulsdiskriminatorkreis Impulselement Impulsemission Impulsentzerrer Impulserneuerung Impulsfernmesser Impulsfernmessgerät Impulsflanke Impulsfolge Impulsfolge mit positiven und negativen Impulsen Impulsfolgefrequenz Impulsfolgefrequenz Impulsfolgefrequenz Impulsform der Erregungsspannung Impulsformung Impulsfreigabe Impulsfrequenzfernmessung Impulsfunktion Impulsfunktion Impulsgabe Impulsgabe Impulsgabe Impulsgenerator Impulsgenerator mit gesteuerter Impulsverzögerung impulsgesteuert Impulsglied Impulshöhenanalyse Impulshöhenanalyse Impulskode Impulskode‐Fernmesssystem pulse‐controlled 518 Impulskorrektion Impulskorrektor Impulskorrektur Impulskurve Impulslaserschweißung Impulsleitung Impulslidar Impulsmessverfahren Impulsmodulator impulsmoduliertes Infrarotsystem Impulsmultiplikationsgerät Impulsperiode Impulsreflexionsprinzip Impulsregenerationsschaltung Impulsregler periodic duty 474 Impulsregler periodic duty 474 pulse attenuator pulse interval pulse sampling amplitude analysis pulse amplitude analyzing pulse‐amplitude‐modulated carrier pulse‐amplitude analyzer impulse approximation pulse rise time pulse build‐up time impulse response pulse response pulse refining linear momentum resolution impulse‐type output amplifier pulse bandwidth pulse base pulse clipping pulse loading pulsed operation pulsed lidar pulse‐width control pulse burst horizontal part of pulse pulse attenuator duration of the impulse impulse period pulse diagram pulse system differential analyzer impulse differential counter pulse discrimination circuit impulse element pulse emission pulse equalizer pulse restoration impulse telemeter pulse‐type telemeter impulse front impulse train bidirectional pulses impulse frequency pulse recurrence rate pulse‐recurrence frequence exciting voltage pulse shape pulse shaping pulse enable impulse‐frequency telemetering impulse function pulse function beat[ing] pulsing pulsation pulse generator controlled delay pulse generator pulse‐controlled impulse element amplitude analysis pulse amplitude analyzing impulse code pulse‐code telemetering system pulse correction impulse corrector pulse correction pulse curve pulsed laser welding pulse line pulsed lidar pulse telemetering method impulse‐type modulator infrared pulse modulation system impulse‐type multiplier (for analog systems) impulse period principle of impulse reflection pulse regeneration circuit periodic controller sampled‐data controller stran 127 od 326 EN ‐DE: slovar avtomatizacije in robotike Impulsschreiber impulse recorder Impulsschwellenenergie pulse threshold energy Impulssignal impulse signal Impulssignal pulse signal Impulssignalisieren impulse signalling Impulsspeicher impulse accumulator Impulsspeicher impulse store Impulsspektrograf pulse spectrograph Impulsspektrometrie pulse spectrometry peak pulse power Impulsspitzenleistung Impulsstabilisation pulse stabilization Impulsstabilisierung pulse stabilization Impulsstörung pulse disturbance Impulsstromkreis impulse circuit Impulssystem mit Extrapolatoren pulse system with extrapolators Impulssystem mit intermittierendem Signal der Regelabweicherror‐sampled control system Impulssystem mit Verzögerung pulse system with delay Impulssystem mit Verzögerung pulse system with lag time Impulssystem mit Verzögerung pulse system with retardation Impulsträger pulse carrier Impulsübergangsfunktion pulse step function pulse dividing circuit Impulsuntersetzerschaltung Impulsverschachtelung pulse interleaving Impulsverstärker pulse amplifier Impulsverzerrung pulse distortion Impulsvorwahl impulse preselection Impulswiederholer pulse repeater Impulswiederholer transponder Impulszeitmodulation pulse‐time modulation in Betrieb active, activated, ACT in Betrieb active in Betrieb activated in der richtigen Reihenfolge in sequence in flexibles Programm für Roboter flexible program for robot in Robotern) sensor inaktiver Zustand floating state inaktiver Zustand high‐impedance state Inäquivalenzgatter n EXCLUSIVE‐OR gate Inäquivalenzgatter n non‐equivalence gate Inäquivalenzgatter n modulo sum gate inbegriffen implicit inbegriffen implied Inbetriebnahme putting into operation Inbetriebnahme setting in operation Inbetriebnahmegerät starting device Indeterminiertheit indeterminacy Indexgrenzenpaar bound pair Indexregister base register Indexregister index accumulator Indikatordiagramm indicator diagram Indikatorstromkreis indicating circuit indirect control supervision index of quality indirect control supervision quality index indirekt arbeitendes Registriergerät indirect‐acting recording instrument indirekt wirkender Regler pilot‐operated controller indirekt wirkendes System indirect control system indirekt wirkendes System system with power amplification indirekte Bearbeitung offline operation indirekte Kraftbestimmung indirect force destination indirekte Steuerung indirect control indirekte Steuerung offline control indirekte Steuerungsüberwachung indirect control checking (supervision) indirekte Steuerungsüberwachung indirect control checking indirekte Steuerungsüberwachung indirect control supervision indirect visual supervision indirekte visuelle Überwachung indirekter Antrieb indirect drive indirekter Regler relay‐operated controller individuelle Robotik individual robotics inductosyn (Wegmesssystem) inductosyn Induktanzmessbrücke mit Servoregelung servo‐operated inductance bridge circuit Induktionsdehnungsmessstreifen induction inductance strain gauge Induktionsdrehzahlgeber induction tacho‐generator Induktionsdurchflussmesser induction flowmeter Induktionsheizungswechselstromfrequenz induction induction‐heating current frequency Induktionsmotor induction motor Induktionsspannungsregler induction voltage regulator stran 128 od 326 EN ‐DE: slovar avtomatizacije in robotike Induktionsspule Induktionswaage Induktionswächter des Flüssigkeitsdurchflusses induktive Implikation induktive Kopplung induktive Kopplung induktive Kopplung induktiver Abgriff induktiver Potentialteiler induktiver Sensor (eines Roboters) induktives Heizgerät Induktivität Induktivität induktivkapazitive Verzögerungslinie Induktosynmaßstab industriebereichsbezogene Robotereinrichtung Industrieforschung industriell nutzbare Stromquelle industriell nutzbarer Geber industriell nutzbarer Sensor industrielle Automatisierung industrielle Elektronik industrielle Fernsignalisierung industrielle Großserienrobotermontage industrielle Handhabetechnik industrielle Handhabung industrielle Interfacekarte industrielle Kleinserienrobotermontage industrielle Manipulatoranwendung industrielle Roboteranwendung industrielle Robotermontage industrielles Erfassungsterminal industrielles Fernmesssystem industrielles modulares Kontrollsystem industrielles Steuerungssystem Industriemanipulatorinstallierung Industriemesszentrale Industrienorm Industrienorm Industrieökologie Industrieproduktion Industrieprozesssteuerung Industrieroboter Industrieroboter Industrieroboter für Einlegeoperationen Industrieroboter für Lötarbeiten Industrieroboter für Montageoperationen Industrieroboter‐ Hardwarelösung Industrieroboter zum Nieten Industrieroboterantriebsart Industrieroboteranwender Industrieroboterbahnelemente Industrieroboterbaukasten Industrieroboterbaukasten zur Montagerealisierung Industrieroboterbefehl Industrierobotereinsatz Industrieroboterelement industrierobotergebundene Einrichtung industrierobotergebundenes Werkzeug Industrierobotergreifer Industrieroboterinstallation Industrieroboterinstallierung Industrieroboterkonstruktion Industrieroboterkoordinaten Industrierobotermarkt Industrierobotermontagekopf Industrieroboterregler Industrieroboterregler Industrierobotersteuerung r" Industrieroboterstudie Industrierobotertechnik Industrierobotertechnik Industrierobotertechnik Industrierobotertrajektorie Industrieroboterzentrum Industriestandard variable inductor induction balance induction guard of liquid flow inductive implication induction coupling inductive coupling magnetic coupling inductive pick‐off inductance potential divider inductive sensor (of robot) induction heater inductance inductor inductance‐capacitance delay line inductosyn scale robots installation related to industrial sector industrial research industrially usable power source industrially usable indicator industrially usable sensor industrial automation industrial electronics industrial remote signalling industrial large series robot assembly industrial handling technique industrial handling industrial interface card industrial small series robot assembly industrial application of manipulators industrial application of robots, industrial robot application industrial robot assembly industrial acquisition terminal industrial telemetering system industrial modular check system industrial control system installation of industrial manipulator industrial control centre industry specifications industry standard industrial ecology industrial production industrial process control [industrial] robot robot, industrial robot, IR loading robot, inserting robot soldering robot mounting robot, assemblage robot, industrial robot for mount [industrial] robot hardware solution rivet robot robot kind of drive, IR kind of drive robot user, industrial robot user path elements of industrial robot robot building‐block, industrial robot assembly unit robot assembly unit for assembly realization, industrial robot robot command, industrial robot command robots application, industrial robots application element of industrial robot robot‐attached device, industrial robot‐attached device robot‐attached tool, industrial robot attached tool robot gripper, industrial robot gripper robot installation, industrial robot installation installation of industrial robots robot construction, industrial robot construction robot coordinates, industrial robot coordinates robot market, industrial robot market, IR market assembly head of industrial robot [industrial] robot regulator robot regulator, industrial robot regulator robot control, industrial robot control robot study, industrial robot study robotics, industrial robot[s] technique robotics industrial robot[s] technique robot movement path, robot trajectory, industrial robot trajec robot centre, industrial robot centre industry specifications stran 129 od 326 EN ‐DE: slovar avtomatizacije in robotike Industriestandard induzierte Arbeit Inegraldarstellung Inertgasanlage Inertgaskreislauf Inertisierung infinit Information Information eines Roboterbildes Informations‐ und Steuerungssystem Informationsaufbau Informationsaufnahme Informationsaufzeichnung feines Industrieroboters Informationsaustausch Informationsauswahl Informationsbit Informationsbit Informationsdarstellung Informationsdarstellungslasersystem Informationsdichte Informationsdichte Informationselektronik Informationselektronik feines Roboters Informationserfassungsfläche Informationserfassungssensor Informationserschließung Informationsextraktion Informationsfangregister Informationsfluss Informationsfluss eines Industrieroboters Informationsformat Informationsgewinnung Informationsinhalt Informationskanal Informationskodierungsniveaus Informationskontrolle Informationskreis Informationsmanagementsystem Informationsmenge Informationsparameter Informationsquelle Informationssender Informationssignal Informationsspektrum Informationsstrom Informationssystem Informationssystemplanung Informationstechnik informationstechnische Kopplung eines Maschinensystems Informationstechnologie Informationsterminal Informationsträger Informationsträgerdiskette Informationsträgerkassette Informationsübertragung Informationsübertragung Informationsübertragung Informationsübertragungsgeschwindigkeit Informationsübertragungsroboter Informationsverarbeitung Informationsverarbeitung Informationsverarbeitung feines Industrieroboters Informationsverarbeitungssystem Informationsverarbeitungstheorie Informationsverlust Informationsverlust Informationswahrnehmungssystem Informationswahrnehmungssystem informations Informationszyklus informatisiertes Steuersystem Infrarotanlage infrarotempfindliches Element infraroter dispersionsloser Gasprüfer dispersion infrarotes Abbildungssystem infrarotes Abstandsmesssystem infrarotes Analysiergerät für Gase industry standard indicated work integral representation inert gas plant inert gas circuit rendering inert infinite information robot image information information and control system information build‐up information reception robot information recording information exchange information selection information unit information bit information representation laser information display system information density packing density robot information electronics robot information electronics information acquisition surface information acquisition sensor information retrieval information extraction latch register flow of information robot information flux, industrial robot information flux information format information winning information content information channel information coding levels information checking information circuit information management system information quantity information parameter message source information transmitter information signal information pattern information flow information system information system planning information engineering information‐technical coupling of machine system information technology information terminal information carrier information carrier disk, data carrier disk information carrier cartridge (casket), magnetic tape casket data transfering information transmission information transfer information transmission rate information transmission robot information processing robot information processing robot information processing, IR information processing information processing system information processing theory data dump information loss information perceptive system information perceptive system information cycle informatized control system infrared equipment infrared sensing element non‐dispersion infrared gas analyzer image‐forming infrared system range‐measurement infrared system infrared analyzer of gases stran 130 od 326 EN ‐DE: slovar avtomatizacije in robotike infrarotes Entfernungsmesssystem Infrarotgasanalysator Infrarotmodulation Infrarotsensor Infrarotsignalentropie Infrarotspektrometerdetektor infrarotspektroskopische Probenuntersuchung Infrarotstrahlenabtastgerät Infrarotstrahlendetektortechnik Infrarotstrahlennachlaufregistriergerät Infrarotstrahlennachlaufsystem Infrarotstrahlenüberwachungssystem Infrarotstrahlenverbindung Infrarotstrahlungsabsorption Infrarotstrahlungsauffindung Infrarotstrahlungserfassung Infrarotstrahlungsvermögen Infrarotsystem Infrarotziellenkung Infrarotzielsuchsystem Infraschallfrequenz ingenieurtechnische Arbeitsmethode inhaltsadressierbarer Datenspeicher inhaltsadressierbarer Speicher/n inhomogene Gleichung inhomogene Gleichung inhomogenes Magnetfeld inhomogenes Magnetfeld Initialisieren Initialisieren Initialisierung Initialisierung Initialprogrammierung Injektionsimpulslaser Injektionskontakt Inklusion Inklusion inkohärent Inkohärenz Inkompatibilität inkrementale digitale Steuerung inkrementaler Winkelsensor Inkrementalgeber Inkrementalgeber Inkrementalregelung inkrementelle digitale Steuerung inkrementeller Geber inkrementeller Winkelsensor Inkrementrechner Inkrementvektor Innenschleife Innenzustand innere Ausbeute innere Energie innere Kinetik innere Leerlaufzeit innere Regelung innere Roboterinformation innere Rückkopplung innerer Fotoeffekt innerer Fotoeffekt innerer lichtelektrischer Effekt innerer Manipulatorzustand innerer Stromkreis inneres Element des Systems inneres Modell Inphasedetektion Inphasedetektor Insruktionsfeld instabiler Gleichgewichtspunkt instabiler Knotenpunkt instabiler Zustand instabiler Zustand instabiles System instabiles System Instabilität range‐measurement infrared system infrared gas analyzer infrared modulation infrared sensor infrared signal entropy infrared spectrometer detector infrared spectroscopic examination of samples infrared scanning device optical detector technology recording infrared tracking instrument tracking infrared system infrared surveillance system infrared communication equipment absorption of infrared radiation infrared radiation detecting system infrared radiation detecting system infrared emissing ability infrared equipment infrared homing action infrared search system infrasonic frequency engineering working method contents addressable data store contents addressable memory, CAM heterogeneous equation inhomogeneous equation inhomogeneous magnetic field nonhomogeneous magnetic field initialization initializing initialization initializing initial programming pulsed injection laser injection contact inclusion inclusion relation incoherent incoherence incompatibility incremental digital control incremental angle sensor incremental indicator incremental sensor incremental control incremental digital control incremental indicator (sensor) incremental angle sensor incremental computer incremental vector inner loop internal state internal operating ratio internal energy intrinsic kinetics internal idle time internal control inner robot information inherent feedback internal photoelectric effect photoconductive effect photoconductive effect internal manipulator state internal circuit internal element of the system internal model inphase amplitude detection inphase detector instruction array unstable equilibrium point unstable nodal point instable state unstable state unstable system unstable system inconstancy stran 131 od 326 EN ‐DE: slovar avtomatizacije in robotike Instabilitätsbereich installation installieren installieren installierter Roboter Installierung instand halten Instandhaltungseinrichtungen Instandhaltungseinrichtungen Instandhaltungsfehler Instandhaltungsperiode Instandhaltungsprozess Instandhaltungszeit Instruktion Instruktion Instruktionsformierung Instrument Instrument mit gegenwirkendem Gewicht Instrument mit Nulleinstellung Instrument mit unmittelbarer Ablesung Instrumentenfehler Instrumententisch Instrumententisch Instrumententisch Instrumententisch Intaktheit Integralbeziehung integrale Bewertung integrales Qualitätskriterium Integralformel Integralgröße Integralkennlinie Integralkennwert der Güte Integralkomponente Integralmethode Integralnebenbedingung Integralregler Integralregler Integralregler Integralregler Integralrelais Integralrelais Integraltransformation Integralverfahren integralwirkende Regelung Integralwirkung Integralwirkung Integralwirkung Integralwirkungskoeffizient Integralwirkungsmaß Integration Integration von Bauelementen Integrationsbereich Integrations‐Differentiations‐Netzwerk Integrations‐Differentiations‐Netzwerk Integrationseingang Integrationsglied Integrationsgrad Integrationsgrenzen Integrationskonstante Integrationskonstante Integrationsregelung Integrationssatz Integrationsschritt Integrationsweg Integrator Integrator mit parametrischer Fehlerkompensation Integrierbeiwert integrieren integrierender Bestandteil integrierender Frequenzmesser integrierender Frequenzmesser integrierender Zählkreis integrierendes Verhalten Integrierer Integriergliedeinführung instability region auxiliary [electrical] system install v setup v installed robot installation maintain v maintenance equipment servicing equipment maintenance error maintenance period maintenance process maintenance time instruction command instruction forming tool gravity‐controlled instrument null instrument direct reading instrument instrumental error instrument table test stand test board test table sanity integral dependence integral estimation integral performance criterion integral formula reset component integral characteristic integral performance index floating component integral method integral constraint astatic controller integral controller floating‐action controller reset controller averaging relay integrating relay integral transformation integral method integral control floating action integral action I‐action integral action coefficient integral action rate integration component integration limits of integration integro‐differentiating network lead‐lag network integrating input integrating element degree of integration limits of integration integration constant constant of integration single‐speed floating control integration theorem integration step integration path integrator bootstrap integrator integration constant integrate v integrating part (of a system) integrating frequency meter master frequency meter integrating counter circuit integral action integrator integrating circuit introduction stran 132 od 326 EN ‐DE: slovar avtomatizacije in robotike Integriernetzwerk integrating network Integriernetzwerk integral circuit integrierte Automatisierung integrated automation integrierte Automatisierung complex automati[zati]on integrierte Datenverarbeitung integrated data processing integrierte Elektronik integrated electronics integrierte Mikrowellenschaltung microwave integrated circuit integrierte optische Schaltung integrated optical circuit integrierte optische Schaltung auf der Basis von Laserverstärklaser amplifier based integrated optical circuit integrierte Schaltung integrated circuit integrierte Schaltung IC integrierte Schaltung mit mehrfachen Funktionen multifunction integrated circuit integrierte Steuerung integrated control integrierter Baustein integrated component integrierter Berührungssensor integrated contact sensor integrierter Einchiprechner integrated single‐chip computer integrierter Ein‐Chip‐Rechner integrated single‐chip computer integrierter Industrieroboter integrated industrial robot integrierter Kraftsensor integrated force sensor integrierter Lagesensor integrated position sensor integrierter Manipulator integrated manipulator integrierter Näherungssensor integrated approximation sensor integrierter optischer Richtkoppler integrated optical directional coupler integrierter optischer Spektrumanalysator integrated optical spectrum analyzer integrierter Strom current‐time integral integrierter Teil integrating part (of a system) integriertes Abbildungssystem integrated image system integriertes Abbildunssystem integrated image system integriertes Bauteil integrated component integriertes Datenverarbeitungszentrum integrated data processing integriertes grafisches Mikrosystem integrated graphic micro system integriertes grafisches Mikrosystem integrated graphic microsystem integriertes Handhabungssystem integrated manipulation system integriertes Informationssystem integrated information system integriertes Programmiersystem integrated programming system integriertes Robotersystem integrated robot system integral time constant Integrierzeitkonstante integral time constant, constant of integrator Integrierzeitkonstante time constant of integrator Integrierzeitkonstante intelligente Kamera intelligent camera intelligente Robotersteuerung intelligent robot control intelligente Robotik (Robotertechnik) intelligent robotics intelligent sensorics intelligente Sensorik intelligente Sensorik (Sensortechnik) intelligent sensorics intelligent sensorics intelligente Sensortechnik intelligente Tastatur intelligent keyboard intelligenter Greifer intelligent gripper intelligenter Roboter intelligent robot intelligenter Sensor intelligent sensor intelligent device intelligentes Gerät intelligentes Laufzeitsystem eines Roboters intelligent transit time system of robot intelligentes Messsystem intelligent measuring system intelligentes Robotersystem intelligent robot system intelligentes Schweißen intelligent welding intelligentes Sensorsichtsystem intelligent sensor visual system Intelligenz feines Roboters robot intelligence Intensitätsfernmesssystem intensity telemetering system Intensitätsmaximum intensity maximum Intensitätsmodulation intensity modulation Intensitätsmodulator intensity modulator Intensitätsrückgang decrease of intensity interaktive grafische Technik interactive graphical technique interaktive Komponente interactive component interaktives Programm interactive program interaktives System interactive system interaktives Terminal interactive terminal Interface interface Interface eines Roboters robot interface Interfaceadapter für asynchrone Kommunikation asynchronous communications interface adapter, AC1A Interfaceadapter für asynchrone Kommunikation asynchronous communications interface adapter Interfaceadapter für asynchrone Kommunikation ACIA Interfacebedingung interface condition Interface‐Elektronik interface electronics Interfacekarte interface card Interface‐Signalfolge interface signal sequence Interface‐Standard interface standard stran 133 od 326 EN ‐DE: slovar avtomatizacije in robotike Interface‐Zeitteilung interferentielle Wellenlänge Interferenz Interferenzeffekt Interferenzkomparator Interferenzlinien zur Materialspannungsmessung Interferenzmikroskop Interferenzmuster im Fernfeld Interferenzrauschen Interferenzrefraktometer Interferenzwellenmesser Interferometrie interferometrische Kontrolle interferometrische Messung interferometrischer Modulator interferometrischer Sensor interferometrisches System intermittierend auftretende Störung interne Bildsteuerung interne Logik interne‐externe Charakteristik interner Bus interner Geber (Sensor) interner Programmspeicher interner Robotersensor interner Roboterzustand interner Steuerspeicher internes Umweltmodell Interpolation Interpolation der Roboterbahnsegmente Interpolationsparameter eines IR‐Programms Interpolationsverfahren Interpolationsverfahren für Raumbahn Interpolatiosfunktion Interpolator interpolieren interpolierte Robotertrajektorie interpoliertes geradliniges Bahnsegment Interpretationsmethode Interpreter Interpreter einer Robotersoftware Interpreter eines Roboterprogramms interpretieren interpretierende Simulation interpretierendes Organ interpretierendes Programm Interpretierungsniveau Interrupt Interrupt Interrupt Interruptanforderungs‐ Synchronisierungsregister Interruptanforderungs‐Rücksetzsignal Interruptauslösung Interruptbestätigengssignal interruptbetriebene Systemumgebung interruptgesteuerter Mikroprozessor interruptgesteuerter Mikroprozessor interruption interruptgesteuertes System Interruptkanal Interruptkennung Interruptprioritätsstaffelung durch Hardware Interruptquelle Interruptquellenblockierung Interruptserviceroutine Unterbrechungsserviceroutine Interruptsignal Interruptsignal Interruptsteuereinheit Interruptsteuerungsgerät Interruptvektor Interruptvektormodifikation Interruptvorrangsystem Intervall Intrittfallen invariabel invariant Invariantenbildung interface timing interference wavelength interference effect interference effect interference comparator interference lines for measuring material strain interference microscope far‐field interference pattern interference noise interference refractometer heterodyne wavemeter interferometry interferometric control interferometric measurement interferometric modulator interferometric sensor interferometric system intermittent fault internal picture control internal logic intern‐extern characteristic internal bus internal sensor internal program memory internal robot sensor internal robot state intern control memory (store) internal environmental model interpolation interpolation of robot path segments interpolation parameter of IR‐program interpolation procedure interpolation procedure for space path interpolating function interpolator interpolate v interpolated robot trajectory interpolated rectilinear path segment interpretation method interpreter interpreter of robot software program interpreter. interpreter of robot program interpret v interpretative simulation interpreter interpreting routine level of interpretation interruption break[ing] abort interrupt request synchronization register interrupt request reset signal interrupt tripping interrupt acknowledge signal interrupt‐driven environment interrupt‐controlled microprocessor interrupt‐controlled microprocessor interrupt‐driven system interrupt channel interrupt identification hardware priority interrupts interrupt source interrupt disarm interrupt service routine interrupt[ing] signal break signal interrupt control unit interrupt controller interrupt vector interrupt vector modification interrupt priority system interval coming into step invariable invariant concept formation stran 134 od 326 EN ‐DE: slovar avtomatizacije in robotike invariantes Regelsystem Invarianz Invarianzprinzip Inverse einer Matrix inverse Fourier‐Transformation inverse Funktion inverse LAPLACE‐Transformation inverse Roboterfunktion inverse Roboterproblemtechnik inverse Übertragungsfunktion inverse Übertragungsfunktion inverses Element inverses Element der Addition inverses Manipulatormodell inverses Robotermodell Inversion Inversionsmethode Inversionspegel Inversionsstruktur Invertentfernungsmesser Invertentfernungsmesser Inverterstufe invertibler Automat invertieren invertierende Schaltung Invertierung Ionenrelais Ionenrelais Ionenrelais IR IR‐Anschluss IR‐Ausgabekanal IR‐Basis IR‐Bussteuerung I‐Regelung I‐Regler IR‐Elektronik IR‐Fehlersignal IR‐Folgesteuerung IR‐Generation IR‐Greiferführung IR‐Greifertyp IR‐Hardware IR‐Hardwarelösung IR‐Kennzeichnung IR‐Komplexibilität IR‐Koordinaten IR‐Layout IR‐Objektmasse IR‐Operationskette IR‐Peripherie IR‐Positioniereinrichtung IR‐Programm IR‐Programmsystem IR‐Prozessinformation IR‐Rechnersteuerung irreduzibles System irregulär irreparabel irreparabel IR‐Schrittmotor IR‐Sensorsystem IR‐Software IR‐Speicher IR‐Speichereinrichtung IR‐Struktur IR‐Tragfähigkeit IR‐Typ IR‐Wartung IR‐Zyklus Isochromate Isochronbereich Isodromglied isoelektronische Reihe Isolationsmesser Isolationsprüfer invariant control system invariance invariance principe inverse matrix inverse Fourier transform inverse function inverse LAPLACE transform inverse robot function inverse problem technique of robot inverse transfer function return transfer function inverse element additive inverse inverse manipulator model inverse robot model inversion reversal method inversion level inverse structure inverse relation telemeter inversion telemeter inverter stage invertible automaton invert v inverting circuit inversion gas‐discharge relay gas‐filled relay ionic relay robot, industrial robot, IR robot connection, IR connection robot output channel, IR output channel robot base, IR base robot bus control, IR bus control integral control integral controller robot electronics, industrial robot electronics robot error signal, industrial robot error signal robot sequential control robot generation, industrial robot generation robot gripper guide, industrial robot gripper guide robot gripper type, industrial robot gripper type robot hardware, IR hardware robot hardware solution, industrial robot hardware solution robot marking, industrial robot marking robot complexibility, IR complexibiiity robot coordinates, industrial robot coordinates layout of an industrial robot robot object mass, industrial robot object mass robot operation chain, IR‐operation chain robot periphery, IR periphery robot positioning device, industrial robot positioning device robot program, industrial robot program robot program system, industrial robot program system robot process information, IR process information robot computer control irreducible system irregular irrecoverable unrecoverable robot stepping motor robot sensor system robot software, IR software robot memory, robot store, IR memory, IR store robot storage device, industrial robot storage device robot structure, industrial robot structure robot load‐carrying capacity, industrial robot load‐carrying ca robot type, industrial robot type robot servicing, robot maintenance, IR servicing, robots servic robot cycle, IR cycle isochromate isochrone region PI‐element isoelectronic row insulation meter insulation testing unit stran 135 od 326 EN ‐DE: slovar avtomatizacije in robotike isolieren isolieren Isoliermaterial Isomorphismus isoperimetrisches Problem Ist‐Bahn feines IR Ist‐Bewegungsbahn Ist‐Leistung Ist‐Menge Ist‐Muster [einer Objekterkennung] Ist‐Muster einer Objekterkennung Ist‐Position Istwert Istwert Istwert Istwert der Regelgröße Ist‐Wertgeber Ist‐Wertvergleich Istwert‐Vergleich IT‐Element Iteration Iterationsvariable Iterationsverfahren Iterationsverfahren Iterationsverfahren Iterationszyklus iterativ iterativ arbeitender Analogrechner iterativ arbeitender Analogrechner iterative Berechnung iterative Dekomposition iterative Entwurf iterative Greiferanalyse (Analyse eines Greifers) iterative Lösung iterative Simulation iterative Technik iteratives Addieren Iterator I‐Verhalten I‐Wirkung I‐Wirkung I‐Zustandsregelung I‐Zustandsregelung J japanischer Roboter japanische Standardelemente joborientiertes Terminal Job‐Scheduler Jobschritt Jobschrittaufgabe Jobstrom Jobverwaltung Jobverwaltung Joule‐Effekt Justageoperation Justageroboter Justiereinrichtung justieren justieren justieren justieren Justierschiene Justierung Justierung Justierungsanforderungen Kabelverteilsystem Käfigrelais kalibrieren kalibrieren kalorimetrischer Gasspurenanalysator Kälteextraktionsverfahren Kältefraktionierungsverfahren Kältekaskade Kaltverformung insulate v isolate v insulator material isomorphism (of automata) isoperimetric problem actual path of IR actual movement path actual output actual quantity actual design [of object identification] actual design of object identification actual position actual value real value desired value actual value of controlled variable actual value transmitter actual value comparison actual value comparison I‐element with first order lag, integral‐element with first order lag iteration iteration variable iteration method method of successive approximation iteration procedure iteration cycle iterative iterative analog computer iterative analogue computer iterative computation iterative decomposition iterative design iterative analysis of gripper iterative solution iterative simulation iterative technique iterative addition iterator integral action integral action I‐action I‐control with state feedback, integral‐control with state feedback I‐integral‐control with state feedback, integral‐control with state feedback Japanese robot Japanese standard elements job‐oriented terminal job scheduler job step job‐step task job stream job management job control Joulean effect adjusting operation adjustment robot adjuster adjust v align v tune v trim v aligner bar adjustment adjusting alignment requirements cable distribution system cage relay gauge v calibrate v calorimetric gas‐traces analyzer cryogenic extraction process cryogenic fractionation process cascade refrigeration system cold deformation stran 136 od 326 EN ‐DE: slovar avtomatizacije in robotike Kamerabild Kamerainformation Kamerainstallation Kammfilter Kanal Kanal für analoge Signale Kanalabstand Kanalabstand Kanaladapter Kanaladresse Kanaladress‐Register Kanaladresswort Kanalaktivität Kanalbefehlswort Kanalbildung Kanalbreite Kanalbyte Kanaldatenprüfung Kanal‐Eingabe‐Ausgabegerät Kanalfehlerroutine Kanalfehlerroutine Kanalfilter kanalgeführte Struktur Kanalkapazität Kanalkapazität Kanalkodierung Kanalkommandoeingabe Kanalkommandoregister Kanalkonstruktion Kanalsteuereinheit Kanalsteuereinheit Kanalsteuerroutine Kanalsteuerung Kanalübertragungskapazität Kanalwähler Kanalzuverlässigkeit kann nicht (Bewegung kanonische Form kanonische Gleichung kanonische Transformation kanonische Verteilung Kapazität Kapazität der Fernwirksysteme Kapazität eines Schwingkreises Kapazitätsänderung Kapazitätsasymmetrie Kapazitätsbelastungsfeinplanung Kapazitätsfaktor Kapazitätsfühler kapazitätsgesteuert Kapazitätsgrenze Kapazitätskopplung Kapazitätskopplung Kapazitätsmanometer capacity of an oscillating circuit 106 Kapazitätsmessbrücke Kapazitätsmesser Kapazitätsmikromanometer Kapazitätsrelais Kapazitätsübertrager Kapazitätsübertrager Kapazitätsumformer Kapazitätsumformer Kapazitätswert kapazitive Belastung kapazitive Dehnungsmessstreifen kapazitive Kopplung kapazitive Kopplung kapazitive Last kapazitive Messzelle kapazitiver Analog‐Digital‐Wandler kapazitiver Höhenmesser kapazitiver Niveaumesser kapazitiver Robotersensor kapazitiver Sensor kapazitives Altimeter Kapillardruck camera image camera information camera installation comb filter channel analog channel channel separation channel spacing channel adapter channel address channel address register channel address word, CAW channel activity channel command word channelling channel width channel byte channel data check[ing] channel input‐output device channel check handler channel error routine channel filter channel‐guide structure channel [transmission] capacity channel capacity channel coding channel command entry, CCE channel command register, CCR channel design channel control unit channel control unit, CCU channel control routine, CC R channel control channel [transmission] capacity pluggable telephone channel selector channel reliability unable to learn (ro move, to change, … etc.) canonical form canonical equation canonical transformation canonical distribution capacity capacity of remote‐control systems capacity of an oscillating circuit capacity change capacity unbalance capacity‐loading fine planning capacity factor capacity‐type sensing element capacitance‐operated capacity limit capacitive coupling capacity coupling capacity manometer capacity bridge capacitance meter capacity‐type micromanometer capacity relay capacitive transducer capacity pick‐up capacitive transducer capacity pick‐up capacity value capacitance load capacitance strain gauge capacitive coupling capacity coupling capacitance load capacitive measuring cell capacity‐type analog‐to‐digital converter capacity altimeter capacitive level gauge capacitive robot sensor capacitive sensor capacity altimeter capillary pressure stran 137 od 326 EN ‐DE: slovar avtomatizacije in robotike Kapillardurchflussmesser Kapillarelektrometer Kapillarsystem Kapillarviskosimeter Karnaugh‐Karte Karnaugh‐Plan Karte für Robotersteuerung Karte mit vokaler Ein‐ und Ausgabe Kartenfehler Kartenkode kartesische Roboter kartesischer Arbeitsraum kartesisches Standardkoordinatensystem Kaskaden kaskadenartig geschaltete Stufen Kaskadenbetrieb kaskadengeschaltete kaskadengeschaltete Kaskadenprozess Kaskadenregelsystem Kaskadenregelung Kaskadenregler Kaskadenrelais Kaskadenschaltung Kaskadensteuerung Kaskadensteuerung Kaskadenstruktur Kaskadensystem Kaskadenübertrag Kaskadenverstärker Kaskadenwäscher Kassettenbeschickung Kassetteneinrichtung katalytische Aktivität katalytischer Prozess Katodenfolger Katodengleichrichter Katodeninhibitor Katodenreaktion Katodenrückkopplung cathode Katodenrückkopplungskreis Katodenschirm Katodenstrahl Katodenstrahlfunktionsgenerator Katodenstrahlkodierer Katodenstrahloszillograf Katodenstrahloszilloskop Katodenstrahlröhre Katodenstrahlschalter Katodenverzögerer Katodenzerstäubung katodische Polarisation katodischer Schutz Kausalität Kausalitätsprinzip Kavitationserosion KB KB Kegeldreheinrichtung Kelvin‐Temperatur Kenndaten pl Kenndatenblatt elektrischer Parameter Kenndatenblatt mechanischer Parameter Kennkreisfrequenz Kennlinie Kennlinie Kennlinie eines taktilen Sensors Kennlinie eines Zangengreifers Kennlinienschar Kennliniensteilheit des Frequenzwandlers Kennlinienverfahren Kennsignal Kenntnis Kennungsimpuls Kennungskode Kennwert capillary flowmeter capillary electrometer capillary system capillary viscometer Karnaugh map diagram of Karnaugh card for robot control card with vocal input‐output card error, CE card code, CC Cartesian robots Cartesian working room Cartesian standard coordinate system cascade cascaded stages cascade operation cascade control concatenated control cascade process cascade control system cascade control cascade [action] controller cascade relay cascade coupling cascade control concatenated control cascade structure cascade system cascaded carry cascade amplifier cascade scrubber charging of cassettes device of cassette catalytic activity catalytic process cathode follower cathode detector cathodic inhibitor cathodic reaction cathode feedback cathode feedback circuit cathode screen cathode ray cathode‐ray function generator cathode‐ray coder cathode‐ray oscillograph cathode‐ray oscilloscope cathode‐ray tube cathode‐ray switch cathodic inhibitor cathode dispersion cathodic polarization cathodic protection causality principle of causality cavitational erosion kilobyte KB taper turning attachment absolute temperature characteristics electrical specifications mechanical specifications undamped natural angular frequency characteristic characteristic curve characteristic line of tactile sensor characteristic line of pincer gripper family of characteristics frequency converter characteristic slope characteristic method identifying signal knowledge identification pulse identification code characteristic value stran 138 od 326 EN ‐DE: slovar avtomatizacije in robotike Kennwertermittlung Kennwertermittlung kennzeichnen Keramikpressen Keramikpressmanipulator keramischer Sensor Kern Kernenergie Kernenergie Kernenergieanlage Kernkraftwerk Kernprozess Kernreaktor Kernreaktor Kernreaktorregler Kernreaktorsimulator Kernresonanz‐Magnetfeldmesser Kesselkontrolle Kesseluntersuchung Kesselwirkungsgrad Kette Kette Kettenantrieb Kettenantrieb Kettenbefehl Kettenbefehl Kettendämpfung Kettenelevatorüberwachung Kettenstruktur Kieinstroboterdynamik Kilobyte Kilobyte Kilobytes pro Sekunde Kilobytes pro Sekunde Kilohertz Kilohertz Kilohertz Kinematik eines Industrieroboters kinematische Abmessung kinematische Analyse kinematische Analyse (eines Greifergetriebes) kinematische Ausgabe kinematische Greiferabmessungen {Greiferdimensionen) kinematische Kette kinematische Kette (eines Zangengreifers) kinematische Manipulatorstruktur kinematische Roboterstruktur kinematischer Zustand kinematisches Schema kinematisches Schema kinematisches Schema kinetische Energie der Wärmebewegung kinetische Messdaten pl kinetischer Parameter kinetischer Scheinwiderstand kinetisches Regelungssystem Kippeinheit kippen Kippgenerator Kippgenerator Kippkreis Kippkreis Kippphase Kippschaltung Kippschaltung Kippschwinger Kippschwinger Kippschwingungen Klarkontrolle vor Arbeitsbeginn Klarschriftlesen Klarschriftleser Klarschriftleser Klartextanzeige Klasseneinteilung für Messgeräte klassieren Klassierer von zeitlich veränderlichen Bildern estimation identification feature v ceramic pressing ceramic pressing manipulator, ceramic pressing handler ceramic sensor core of membership function nuclear energy atomic energy nuclear power plant nuclear power plant nuclear reaction atomic pile nuclear reactor nuclear reactor controller nuclear reactor simulator nuclear resonance magnetic field meter boiler testing boiler testing boiler efficiency chain (of action) direct action circuit chain drive chained drive chain command chain command, CC iterative attenuation chain elevator monitoring series structure miniature robot dynamics kilobyte KB kilobyte per second KBPS kilohertz kHz kilocycles per second robot kinematics kinematic dimension kinematic analysis (of gripper gear) kinematic analysis (of gripper gear) kinematic output kinematic gripper dimensions kinematic chain kinematic chain (of pi nee gripper) kinematic manipulator structure kinematic robot structure kinematic state kinematic scheme, kinematic schedule kinematic scheme kinematic schedule kinetic energy of thermal motion kinetic measuring data kinetic parameter motional impedance kinetic regulation system time‐base unit toggle v relaxation [pulse] generator relaxation [pulse] oscillator relaxation circuit sweep circuit sweep phase multivibrator biased flip‐flop relaxation [pulse] generator relaxation [pulse] oscillator relaxation oscillations clearing control before commencing optical character recognition, OCR optical character reader optical reader clear text indication measuring instrument classification classify v classifier of time‐variable patterns stran 139 od 326 EN ‐DE: slovar avtomatizacije in robotike Klassifikationssystem Klassifizierautomat klassifizieren Klassifizierung der Manipulatorsteuerungen Klassifizierung von Montageoperationen klassische Theorie des Elektromagnetismus klassisches Informationsverarbeitungssystem klassisches Schaltelement Klauenbewegung kleben (durch Roboter) Klebespannung kleine Automatisierung kleine Greifmasse kleine Regelabweichung kleine Roboterbeschleunigung kleiner Parameter kleines Monitorprogramm Kleinindustrieroboter Kleinmanipulator Kleinroboter Kleinrobotereinsatz Kleinserienfertigung f(von Robotern) Kleinsignal Kleinsignalanalyse Kleinsignalkapazität Kleinsignalstromverstärkung Kleinsignalverstärker Kleinstörungsmethode Kleinstroboter Kleinstroboter (Miniroboter Kleinstroboterherstellung kleintechnische Ausrüstung Kleinteil Kleinteilefertigung Klemme Klemmprinzip Klemmschaltung Klemmvorrichtung Klimaanlage Klimaanlage klimatische Bedingungen Klimatisierung Klimatisierungsprozess Klinometer Klirrfaktor Klirrfaktor Klirrfaktormessbrücke Klirrfaktormessgerät Klirrverzerrung Knickarm Knickarm Knickarmroboter Knickbeanspruchung Knickbelastung Knickfestigkeit Knickpunkt Knickversuch Kniehebelgreifer Kniehebelkinematik Knoten Knoten Knoten Knoten Knotenprozessor Knotenpunkt Knotenpunkt Knotenpunkt Knotenpunkt Knotenpunktmethode Knowbot Knowbot Koaxialleitung Koaxialrelais Koaxialresonator Kode mit doppelter Fehlerkorrektur Kodealphabet classification system grading automatic sorter classify v classification of manipulator controls classification of assembly operations classical electromagnetic theory classical information processing system classical switching element movement off claw adhere to, to cement (by robot) sticking voltage small automatization small grip mass small control deviation small robot acceleration small parameter small monitor program miniature robot, miniature industrial robot, minirobot miniature manipulator miniature robot, miniature industrial robot, minirobot miniature robot application small‐scale series production (of robots) small signal small signal analysis small signal capacitance small signal current gain low‐level amplifier small perturbation method miniature robot, miniature industrial robot, minirobot microrobot with five degrees of freedom manufacture of micro robots bench‐scale equipment miniature part manufacturing of miniature parts, miniature parts manufactur terminal clamping principle clamping circuit clamping device air‐conditioning plant air‐conditioning system climatic conditions air‐conditioning air‐conditioning process clinometer distortion coefficient distortion factor distortion bridge harmonic distortion measuring set non‐linear distortion buckling arm folding arm buckling arm robot buckling stress buckling load buckling strength buckling point buckling test toggle lever gripper toggle lever kinematics node centre junction intersection node processor node centre junction intersection nodal analysis knowledge robot knowbot coaxial line coaxial relay coaxial resonator double error‐correcting code code alphabet stran 140 od 326 EN ‐DE: slovar avtomatizacije in robotike Kodeaufbau Kodebasis Kodebezeichnung Kodediskriminator Kodeelement Kodeimpulsfolge Kodekombination Kodeprüfung Kodeprüfzeit Kodepunkt Koderegeneration Kodermarkierung Kodesicherung Kodesteuerungssystem Kodestruktur Kodeumsetzer Kodeumsetzer Kodeumsetzer Kodeumsetzung Kodeumsetzung Kodewandler Kodewandler Kodewandler Kodewort Kodewortabstand Kodeziffer Kodiereinrichtung Kodiereinrichtung Kodiereinrichtung kodieren kodieren Kodierer Kodierer Kodierer kodierte Befehlsreihe kodierte Befehlszeile kodierte Bezeichnung kodierte dezimale Schreibweise kodierte Dezimaltziffer kodierte Impulsfolge kodierte Kennung kodierter Befehl kodierter Lichtstrahl kodiertes Nachrichtenübertragungssystem kodiertes Programm kodiertes Robotersignal kodiertes Signal Kodierung Kodierung eines Programms in Assemblersprache Kodierung feines Roboterprogramms Kodierungsbschnitt Kodierungshypothese Kodierungskreis Kodierungsrelais Koeffizient der Binomialreihe Koeffizienten‐Einstellpotentiometer kohärente Demodulation kohärente elektromagnetische Schwingungen kohärente Quelle kohärente Strahlung kohärente Trägerwelle kohärente Übertragung cohesive energy density 128 kohärenter Träger kohärentes Lasersignal Kohärent‐Infrarotstrahlenradar Kohärenzzeit Koinzidenz‐Antikoinzidenz‐Zählanordnung Koinzidenzauflösungsvermögen Koinzidenzberichtigung Koinzidenzbetrieb Koinzidenzelement Koinzidenzentfernungsmesser Koinzidenzfehler Koinzidenzflusselement Koinzidenzgatter Koinzidenzgatter code structure base of code coded identification code discriminator code element code pulse train code combination code check code checking time code point code regeneration label coding code protection code control system code structure code converter code translator transcoder code conversion code translation code converter code translator transcoder code word code‐word distance code digit coder encoder code equipment encipher v encode v coder encoder code equipment coded instruction range coding line coded identification coded decimal notation coded decimal digit code pulse train identification code coded instruction coded light ray coded communication system coded program coded robot signal coded signal coding assembler language coding, ALC robot program coding coding section coding hypothesis coding circuit coding relay binomial coefficient coefficient‐setting potentiometer coherent detection coherent electromagnetic oscillations coherent source coherent radiation coherent carrier coherent transmission coherent carrier coherent laser signal coherent infrared radar coherence time coincidence and anticoincidence pulse counting assembly coincidence resolving power coincidence correction coincidence mode coincidence element coincidence range finder coincidence error coincident flux device coincidence gate coincidence circuit stran 141 od 326 EN ‐DE: slovar avtomatizacije in robotike Koinzidenzgatter Koinzidenzgatter Koinzidenzkurve Koinzidenzmethode Koinzidenzregister Koinzidenzregister Koinzidenzregister Koinzidenzregister Koinzidenzschaltung Koinzidenzschaltung Koinzidenzschaltung Koinzidenzschaltung Koinzidenzselektor Koinzidenzsignal Koinzidenzspektroskopie Koinzidenzstrom‐Auswahlsystem Koinzidenzstromspeicher Koinzidenzverfahren Koinzidenzverlust Koinzidenzverstärker Koinzidenzzähler Kollektorelektrode Kollektorelektrode Kollektorklemme Kollektorpol Kollektorschaltung Kollektorspannung Kollektorstrom Kollektorstromkreis Kollektorübergang Kollektorverlustleistung Kollisionsermittlung Kollisionsphase Kollisionsschutz Kollisionssicherung Kollisionssicherung eines Industrieroboters Kolonnenschalter Kolorimeter Kombination Kombination von Regelelementen Kombinator kombinierte Aufgaben kombinierte Automatensysteme kombinierte Automatensysteme kombinierte Bewegungsachse kombinierte elektrochemische und Ultraschallbearbeitung kombinierte Nichtlinearität kombinierte Steuerung kombinierter Arbeitsablauf kombinierter Datenadressbus kombinierter Daten‐Adress‐Bus kombinierter Effektor kombinierter Fügemechanismus kombinierter Regler kombinierter Servomechanismus kombiniertes Antriebsglied kombiniertes Dosimetersystem kombiniertes Programm eines Manipulators kombiniertes Rechensystem kombiniertes Regelungssystem Kommando eines Bedienprogramms Kommandoanweisung Kommandogerät Kommandohauptroutine Kommandoraum Kommandoraum Kommandosignale mit Tonfrequenz Kommandozahl Kommunikation Kommunikation mit dem Roboter Kommunikation zwischen Manipulator und Menschen Kommunikation zwischen Roboter und Rechner Kommunikationsbefehl Kommunikationseinheit Kommunikationsmodul Kommunikationsmodus gate [circuit] gating circuit coincidence curve coincidence method coincidence gate coincidence circuit gate [circuit] gating circuit coincidence circuit coincidence gate gate [circuit] gating circuit coincidence selector coincidence signal coincidence spectroscopy coincident current selection system coincident current store coincidence method coincidence loss coincidence amplifier coincidence counter collecting electrode collector electrode collector terminal collector terminal collector circuit collector voltage collector current collector circuit collector junction collector dissipation collision detection, CD collision phase collision protection collision protection robot collision protection, industrial robot collision protection column shift unit colorimeter combination combination of control loop elements combiner combined tasks combined system of automatons combined systems of automatons combined movement axis combined electrochemical and ultrasonic machining combined non‐linearity combination control combined cycle combined data and address bus combined data and address bus combination actuator combined joint mechanism combined controller mixed servomechanism combination actuator combined dosimetric system combined program of manipulator combined computing system mixed control system service program command command statement instruction machine master command routine central control station control centre command signals with audio frequency number of command communication communication with the robot communication between manipulator and man communication between robot and computer access instructions communication unit communication module communication mode stran 142 od 326 EN ‐DE: slovar avtomatizacije in robotike Kommunikationsnetz Kommunikationsnetzwerkprozessor Kommunikationsnetzwerkprozessor Kommunikationsrechner Kommunikationssignal Kommunikationssteuerung Kommunikationssteuerung Kommunikationstheorie Kommutationsfähigkeit von Relaiskontakten kommutative Algebra kommutativer Automat kommutatives Gesetz kommutiertes Fehlersignal Kompaktabschirmung Kompaktbauweise Kompaktbauweise kompakte Abschirmung kompakte Baueinheit kompaktes Recheninstrument Kompaktgreifer Kompaktheit Kompaktoszilloskop Kompaktroboter Kompaktsystem Komparation kompatibel Kompatibilität Kompatibilität eines Roboterprogramms kompatible Baugruppe kompatibler Befehlssatz auf kompatibles System Kompensation Kompensation Kompensation Kompensation Kompensationsdruckgeber Kompensationsdruckgeber Kompensationseinstellung compensateur Kompensationselement Kompensationsferngeber Kompensationsgrad Kompensationskreis Kompensationsleitung Kompensationsleitung Kompensationsmessmethode Kompensationsmessmethode Kompensationspolarimeter Kompensationsregler Kompensationsrückkopplung Kompensationsschaltung Kompensationsschaltung Kompensationsschreibgerät Kompensationssignal Kompensationssignal Kompensationsspannung Kompensationssynchronisation Kompensationsverhältnis Kompensationsvorkopplung Kompensationswicklung Kompensationswiderstand kompensatorischer ODER‐Operator kompensatorischer Operator kompensatorischer UND‐Operator kompensierte Regelung kompensierter Messwandler Kompensograf Kompilationsmethode kompilierende Simulation Komplement komplementäre Nichtlinearität komplementäres Ereignis Komplementärfunktion Komplementärkode Komplementärkode Komplementbildung (Modifikator) Komplementdarstellung communication network communication network processor communication network processor, CNP communication computer, CC communication signal communication control communication control, CC communication theory breaking capacity of relay contacts commutative algebra commutative automaton commutative law commutated error signal bulk shielding compact construction compact design bulk shielding compact construction unit compact computing instrument compact gripper compactness compact oscilloscope compact robot compact system comparison compatible compatibility compatibility of robot program compatible subassembly machine‐code compatible instruction set compatible system dynamic compensation equalization balancing compensation compensating‐pressure transducer force‐balance pressure gauge compensation adjustment compensation element compensation transmitter compensation factor null circuit compensating line compensation lead compensation measuring method null point method of measurement compensating polarimeter compensating controller compensating feedback compensating circuit compensating network compensating selfrecording instrument compensating action compensation signal compensation voltage flywheel synchronization compensation ratio compensating feedforward compensation winding compensating resistor compensatory OR compensatory operator compensatory AND balanced control compensated instrument transformer compensograph compiling method compiling simulation complement complementary non‐linearity complementary event complementary function complementary code additional code complement complement representation stran 143 od 326 EN ‐DE: slovar avtomatizacije in robotike Komplementimpuls Komplement‐Operator Komplettsystem komplex Komplexamplitude komplexe Automatisierung komplexe Automatisierung komplexe Bauelementedimensionierung composants komplexe Daten pl komplexe Datenübertragung komplexe Datenverarbeitung komplexe Ebene komplexe elektronische Baugruppe komplexe Information komplexe Informationsverarbeitung komplexe Leistung komplexe logische Operation komplexe Montageaufgabe komplexe Permeabilität komplexe Produktionsanlage komplexe Roboteraufgabe komplexe Roboterszene komplexe Struktur komplexe System komplexe Übertragungsfunktion komplexe Umwelterfassung komplexe Variable komplexe Verknüpfungsvorschrift komplexe Wurzel komplexer Faktor komplexer Handhabungsvorgang komplexer Kraftsensor komplexer Montageablauf komplexer Montageroboter komplexer Regler komplexer Robotersensor komplexer Schaltkreis komplexer Scheinleitwert komplexer Scheinwiderstand komplexes elektronisches Gerät komplexes Regelungssystem komplexes Roboterprogramm komplexes Umweltmodell Komplexgruppe Komplexmechanisierung Komplexmechanisierung Komplexmechanisierung Komplexverfahren nach Box komplizierte Beschickungsaufgabe komplizierter Sensoraufbau kompliziertes Montageobjekt Kompliziertheit des Regelvorganges Komponente Komponente der Armlage Komponentendatei komportable Verteilungsfunktion komportable Verteilungsfunktion Komposition Kompositionspotentiometer Kompositionsregel der Inferenz Kompoundregler Kondensatorelektrometer Kondensatormesszelle Kondensatorspeicher konditionierender Prozess konduktive Kopplung direct konduktometrische Analysenmethode Konfigurations[kontroll]einheit konfigurierbar Kongruenzverhältnis konische Abtastung konjugierte Funktion konjugierte komplexe Zahl konjugierte Wurzel konjugierter komplexer Wert Konjunktionsoperation complement pulse fuzzy NOT complete system complex complex amplitude integrated automation complex automati[zati]on complex component parts proportioning complex data complex data transposition complex data processing complex plane complex electronic subassembly complex information complex information processing complex power complex logical operation complex assembly task complex permeability complex production plant complex robot task complex robot scene complex structure complex system complex transfer function complex environmental coverage, complex environmental acq complex variable complex connection instruction complex root complex factor complex handling process complex force sensor complex assembly sequence complex assembly robot complex controller complex robot sensor complex circuit complex admittance complex impedance complex electronic equipment complex control system complex robot program complex environmental model complex group complete mechanization full mechanization complex mechanizing Box's complex method complicated feeding task complicated sensor structure complicated assembly object complexity of the control process component component of arm position component file compatible distribution function congruent distribution function composition composition potentiometer compositional rule of inference compound controller capacitor electrometer capacitor‐type measuring cell capacitor store conditioning process conductive coupling conductometric method of analysis configuration unit configurable congruence relation conical scanning adjoint function conjugate complex number conjugate root conjugate complex value conjunction operation stran 144 od 326 EN ‐DE: slovar avtomatizacije in robotike konjunktive Normalform conjuctive normal form konjunktives Aufsuchen conjunctive search Konklusion conclusion Konnektivität connectivity konservatives System conservative system konservierte Information conserved information Konsistenzsteuerung consistence control Konsole (eines Schweißroboters) console (of welding robot) Konsolenabfrageeinheit console inquiry unit Konsolenkommandoprozessor console command processor, CCP Konsol‐Handler console handler knee process unit, console process unit Konsolverfahrenseinheit Konsolverfahrenseinheit knee process unit Konsolverfahrenseinheit console process unit Konstante des Frequenzauflösungsvermögens frequency resolution constant konstante Greifkraft constant grip force konstante Komponente constant component konstante Periode fixed period konstante Strahlung constant radiation konstante Verzögerung constant time lag konstanter Algorithmus constant algorithm konstanter Bereich constant area konstanter Druckabfall constant‐pressure drop konstanter Faktor constant factor konstanter Faktor constant coefficient konstantes Zeitverzögerungsrelais independent time‐lag relay Konstanthaltungsprinzip invariance principe Konstantspannungsquelle constant source Konstantspannungsquelle constant supply Konstantspannungsregler constant‐voltage regulator Konstantspannungsregler voltage stabilizer Konstantstromquelle constant‐current source Konstantstromregler constant‐current regulator Konstantwiderstand constant resistance Konstruction construction konstruieren design v konstruieren construct v konstruierte Montageeinheit constructed assembly unit Konstrukteurarbeitsplatz engineering working station, engineering workplace, construc Konstruktion technischer Erzeugnisse engineering product design Konstruktionsalgorithmus (Auslegungsalgorithmus) eines Gredesign algorithm of gripper Konstruktionsarbeitsplatz engineering working station, engineering workplace, construc Konstruktionsfehler error of construction Konstruktionsmerkmale von Robotern design characteristics of robots Konstruktionsprinzip engineering concept Konstruktionsregeln root‐locus, construction rules Konstruktionsroboter construction robot Konstruktionsstand engineering level Konstruktionsteile npi construction parts Konstruktionsteile construction parts Konstruktionsverfahren n design method Konstruktionswesen engineering konstruktive Antriebsgestaltung constructive drive design constructive gripper construction konstruktive Greiferausführung konstruktive Interfacebedingung constructive interface condition konstruktive Manipulatorgestaltung constructive manipulator shaping konstruktive Strukturvariante constructive structure variant konstruktive Veränderung der Montageeinheit constructive change of assembly unit konstruktiver Roboteraufbau constructive robot building konstruktives Fließbild machinery diagram Kontakt contact Kontaktabfragepunkt contact sense point Kontaktabnahme contact pick‐off Kontaktabstand contact gap Kontaktanordnung contact arrangement Kontaktapparat catalytic reactor Kontaktdruck contact pressure Kontaktelement contact element, contact piece Kontaktelement contact member Kontaktelement contact element Kontaktelement contact piece Kontaktfeder contact spring Kontaktfläche contact surface Kontaktfühler contact sensor Kontaktgeber contactor Kontaktgeräusch contact noise stran 145 od 326 EN ‐DE: slovar avtomatizacije in robotike Kontaktglied Kontaktglied Kontaktglied Kontaktkraft kontaktlos arbeitender Fühler kontaktlose Einrichtung kontaktlose Messung kontaktlose Schaltung kontaktlose Steuerung kontaktlose Zentralsteuerung kontaktloser Aufnehmer kontaktloser Aufnehmer kontaktloser Aufnehmer kontaktloser Drehmelder kontaktloser Endschalter kontaktloser fernwirktechnischer Vorwähler kontaktloser Geber kontaktloser Geber kontaktloser Geber kontaktloser Impulsgeber kontaktloser Schalter kontaktloses magnetisches Verzögerungsglied kontaktloses Relaiselement kontaktloses System Kontaktlücke Kontaktmesssystemanwendung Kontaktmess‐Systemanwendung Kontaktprofil Kontaktpyramide Kontaktpyramide Kontaktsatz Kontaktsensor Kontaktspannung Kontaktstrecke Kontaktstrom Kontaktstück Kontaktstück Kontaktstück Kontaktstück Kontaktthermometer Kontaktunterbrecher Kontaktunterbrecher Kontaktvoltmeter Kontaminationsmonitor kontinuierlich arbeitender Luftmonitor kontinuierlich arbeitendes kontinuierlich wirkendes Optimisierungssystem kontinuierliche kontinuierliche Abhängigkeit kontinuierliche Abtastung kontinuierliche Anzeige kontinuierliche Betriebseise kontinuierliche Fahrweise kontinuierliche Fahrweise kontinuierliche Gasmengenmessung kontinuierliche Herstellung kontinuierliche Herstellung kontinuierliche Korrektion kontinuierliche Phase kontinuierliche Reglerwirkung kontinuierliche Schweißkopfbewegung (Roboter) kontinuierliche Schwingungen kontinuierliche Stabilisierung kontinuierliche Struktur kontinuierliche Variable kontinuierliche Verteilung kontinuierliche Wirkung kontinuierliche Wirkung kontinuierlicher Modus kontinuierlicher Prozess kontinuierlicher Regler kontinuierlicher Verschiebungsarbeitsgang kontinuierlicher Verschiebungsarbeitsgang . kontinuierliches Frequenzspektrum kontinuierliches Signal kontinuierliches Steuersystemmodell contact member contact element contact piece contact force contactless active sensor contactless device contactless measurement contactless circuit contactless control central contactless control contactless pick‐up non‐contact feeler device non‐contacting sensor contactless selsyn contactless limit switch contactless distributor in remote control contactless pick‐up non‐contact feeler device non‐contacting sensor contactless impulse generator contactless switch contactless magnetic delay member non‐contact relay element contactless system contact gap application of contact measuring system application of contact measuring system contact profile relay pyramid contact pyramid contact set contact sensor contact‐potential difference contact travel contact current contact element, contact piece contact member contact element contact piece contact thermometer contact breaker contact breaker, CB contact voltmeter contamination monitor continuous air monitor continuous air monitor continuous‐action optimization system continuous curve distance‐time protection continuous dependence continuous reading continuous display continuous [operation] mode long‐term continuous duty long‐term continuous operation continuous gas quantity measurement continuous fabrication continuous manufacture continuous correction continuous phase continuous controller action continuous welding head movement continuous oscillations continuous stabilization continuous structure continuous variable continuous distribution continuous action continuous operation continuous [operation] mode continuous process continuous‐action controller continuous displacement operation continuous displacement operation continuous frequency spectrum continuous signal control system continuous simulator stran 146 od 326 EN ‐DE: slovar avtomatizacije in robotike kontinuierliches Zoomen Kontinuität Kontinuitätsbedingungen Kontinuitätsbeziehungen Kontinuitätsgleichung Kontrast‐Intensivierung (Modifikator) Kontrast‐Intensivierung (Modifikator) Kontrast‐Intensivierung (Modifikator) Kontroll‐ und Überwachungsgeräte Kontroll‐ und Überwachungsgeräte Kontroll‐ und Überwachungsgeräte Kontrollabtastung Kontrollabtastung Kontrollautomat Kontrollbit Kontrollbit Kontrollbit Kontrollblock Kontrollbus Kontrolle Kontrolle Kontrolle Kontrolle Kontrolle der Greifkraft Kontrolle des Aufgabenkomplexes Kontrolle des Werkzeugbruchs Kontrolle eines Industrieroboters Kontrolle eines Montagevorgangs Kontrolle feines Montagevorgangs Kontrolleinheit Kontrolleinrichtung Kontrolleinrichtung Kontroller Kontroller Kontroller Kontrollfunktion einer Greifkraft Kontrollfunktion einer Greif‐kraft Kontrollgerät Kontrollgerät kontrollieren kontrollierendes Unterprogramm kontrolliertes Bauteil Kontrolllösung Kontrollmeldung Kontrollmodulation Kontrollösung Kontrollproblem Kontrollrechner Kontrollrechnungen Kontrollschaltung Kontrollschirm Kontrollschirm Kontrollschirm eines Industrieroboters Kontrollsignal Kontrollstelle Kontroll‐Steuerungssystem von Robotern Kontrollstromkreis Kontrollsummierung Kontrolltätigkeit Kontrolltermin Kontrolltheorie Kontrollvorrichtung Kontrollwarte Kontrollwert Kontrollwert Kontrollzeichen Kontrollzeit der Anzeigen Kontrollziffer Kontrollzustand des Roboters Kontur Kontur Konturen der Vorlage Konturenauswertung Konturenregelungssystem Konturinstrumentverschiebung Konvektionsstrom continuous zooming continuity continuity conditions continuity equations equation of continuity contrast intensification intensification intensification, contrast intensification process instrumentation monitoring instrumentation monitoring equipment test reading control sensing check automaton check digit check bit test bit control block checking bus control monitoring verification supervision checking of grip force problem formulation check tool fracture checking, tool rupture checking robot checking], industrial robot check[ing] checking of assembly process checking of assembly process checking unit verifying device monitor controller control device control unit checking function of grip force checking function of grip force testing instrument check instrument control v checking subroutine checked component check solution check message check modulation check solution check problem computer for testing check computations check circuit check[ing] screen checking screen, check screen checking screen of industrial robot, check screen of industrial test signal control station robot checking control system pilot circuit check addition control activity control date control theory controlling device control station value of the check check value check digit checking time of indications check digit robot checking state contour outline pattern contours contour analysis contour control system outline instrument displacement convection current stran 147 od 326 EN ‐DE: slovar avtomatizacije in robotike Konvektron Konvention konventioneller Montageablauf konventionelles Bauelement konvergente Regelung Konvergenz Konvergenzalgorithmus Konvergenzbeschleunigung Konvergenzeinstellung Konvergenzelement Konvergenzgebiet Konvergenzgeschwindigkeit Konvergenzgrad Konvergenzkriterium Konvergenzmesser Konvergenzradius Konvergenzregelung Konvergenzschreiber Konversionsgenauigkeit Konversionskoeffizient Konversionsverlust Konverter Konverter Konverter Konverterverfahren Konverterverfahren konvertieren Konvertiersystem Konvertierung Konvertierung Konvertierung Konvertierung Konvexität von Fuzzy‐Mengen Konzentration (Modifikator) Konzentration von Roboteroperationen Konzentrationsregler Konzentrationsüberspannung Konzentrator auf Rechnerbasis Konzentratorsystem konzentrierte Charakteristik konzentrierte Kapazität konzentrierter Parameter konzentrische Übertragungsleitung konzentrischer Tubenarm (Röhrenarm) konzentrisches Röhrenarmsystem konzentrisches Tubenarmsystem Konzept eines Rechners operations s 10090 Konzeptbildung Konzeptkoordinierung Konzolen‐Zusatzadapter Kooperationsroboter kooperative Struktur kooperativer Geber kooperativer Mehrachsensensor kooperativer Mehrachsensensor kooperativer Sensor Koordinaten eines Arbeitsraums Koordinaten läge Koordinatendaten pl Koordinateneinstellung Koordinatenlage Koordinatenorientierung Koordinatenschalter Koordinatenschreiber Koordinatenschreiber Koordinatenspeicher Koordinatensystem Koordinatensystem eines Getriebegliedes Koordinatensystemursprung Koordinatentransformation Koordinatentransformation Koordinatentransformation einer Raumbahn Koordinatenverschiebung Koordinatenwähler für Messzentralen Koordinatenwerte Koordinatenwerte der Bewegungspunkte convectron convention conventional assembly sequence conventional component convergent control convergence convergence algorithm convergence acceleration convergence adjustment convergent component convergence domain rate of convergence convergence degree convergence attribute convergence indicator radius of convergence convergence control convergence recorder conversion accuracy conversion coefficient conversion loss converter transducer transductor blast process converter process convert v converting system conversion converting transformation transforming convexity of fuzzy set (membership function) concentration concentration of robot operations concentration controller concentration overvoltage computer‐based concentrator, CBS concentrator system lumped characteristic lumped capacity lumped parameter coaxial transmission line concentric tube arm, concentric tubular arm concentric tube arm system concentric tube arm system concentric tube arm system concentric tube arm system concept of computer concept formation concept‐coordination console auxiliary adapter cooperation robot cooperative structure cooperative sensor cooperative multiaxis sensor cooperative multi‐axis sensor cooperative sensor working space coordinates coordinate position coordinate values coordinate setting coordinate position coordinate orientation cross‐bar switch coordinate recorder variable recorder coordinate store coordinate system coordinate system of gear element coordinate system origin coordinate trasformation coordinate transformation coordinate transformation of space path coordinate displacement coordinate selector for data logging coordinate values coordinate values of movement points stran 148 od 326 EN ‐DE: slovar avtomatizacije in robotike Koordinatenwerte der Bewegungspunkte mouvement Koordinatenzuordnung koordinierbare Bewegung der Roboterglieder koordiniert geführter Roboter koordinierte Bewegung der Glieder koordiniertes Steuerungssystem Koordinierung nach Konzept Koordinierungsglied Koordinierungsrechner koorrigiertes Stellsignal Kopierfräsen Kopierfräsmaschine Kopiergerät Kopierlauf Kopierprogramm Koppelleitung Koppelplan einer Steuerung Koppler Kopplungsanordnung Kopplungseffekt Kopplungseinstellung Kopplungsfaktor Kopplungsfunktion Kopplungskette Kopplungskomponente Kopplungsreihenfolge Kopplungswiderstand Kopplungswiderstand körperbeschreibendes Element Korrektionsfarbfilter Korrektionsfilter Korrektionsglied Korrektionstabelle Korrektur der dynamischen Eigenschaften Korrektur der Kennlinie Korrektur dynamischer Eigenschaften Korrektur von Nichtlinearitäten Korrekturbereich Korrekturbewegung Korrekturbewegung Korrekturbewegung Korrekturbewegung feines Roboters Korrekturblock Korrekturfaktor Korrekturfaktor Korrekturfunktion Korrekturglied Korrekturglied Korrekturglied Korrekturglied Korrekturimpuls Korrekturkreis Korrekturmethode Korrekturprogramm Korrekturregelung Korrekturregelung correction Korrekturregelung correction Korrektursteuerung Korrektursteuerung Korrektursystem Korrekturverögerung Korrekturverögerung Korrekturwert Korrekturzustand Korrelation Korrelationsabhängigkeit Korrelationsbahnverfolgung Korrelationsbahnverfolgungssystem Korrelationselektronik Korrelationsfunktion Korrelationsfunktionsmessung Korrelationsgrad Korrelationskoeffizientenmatrix Korrelationskompensation Korrelationsmesser Korrelationsmethode coordinate values of movement points coordinate assignment coordinable movement of robot elements coordinated guided robot coordinated movement of elements coordinated control system concept‐coordination coordinating element coordinating computer corrected actuating signal copy milling copy milling machine copy[ing] device copy run duplicate routine interconnection line coupling diagram of control connective order of connexion coupling effect coupling adjustment coupling factor coupling function coupling circuit coupling component order of connexion coupling resistance coupling resistor (US) body‐descriptive element colour correction filter correcting filter correction member correction table dynamic properties correction characteristic correction correction of dynamic properties non‐linearities correction correcting range correction movement, correction motion correction movement correction motion correction movement of robot correcting unit correction factor corrective factor correcting function correcting element equalizer correction element correction term correcting pulse correcting circuit method of correction correction program correction adjusting correcting control correction adjusting correcting control correction adjusting correction system correction lag corrective lag correcting condition correcting condition correlation correlation dependence correlation tracking correlation tracking system correlation electronics correlation function measuring of the correlation functions correlation degree correlation coefficient matrix correlative compensation correlation meter correlation method stran 149 od 326 EN ‐DE: slovar avtomatizacije in robotike Korrelationsrechner Korrelationsregler Korrelationstechnik Korrelationstheorie Korrelationstriangulation Korrelationsverfahren korrelierte Regler korrespondierender Wert korrigieren korrigierender korrigierendes Element korrigierendes Element korrigierendes Element korrigierte Gelenkregelung korrigierter Montagevorgang korrigiertes Programm korrigiertes Stellsignal Korrosionsbeständigkeit Korrosionsschutzmittel Kosinuswelle Kosten pl für Roboteranschaffung kovariantes Element Kovarianz Kraft feine Softgreifers kraftabhängige Bewegungsbegrenzung Kraftadaption Kraftanschlussart Kraftaufnehmer Kraftaufnehmer eines taktilen Sensors Kraftbedarf Kraftbedarf kraftbetätigte Spannvorrichtung kraftbetätigtes Spannmittel Kräfteausgleich an Robotern Kräfteausgleichpotentiometer Kräftebestimmung (Antrieb) Kräftebezugspunkt Kräftegleichgewichtgeber Kräfteüberwachung Kraftgeber kraftgesteuertes Fügen Kraftkennlinie (einer Zangengreifeinheit) Kraftmaschinensteuerung Kraftmaschinensteuerung Kraftmesseinrichtung Kraftmesseinrichtung Kraftmesseinrichtung Kraftmessung (Robotergelenk) Kraftrückführung kraftsensibilisierter Greifer Kraftsensor Kraftsensor eines Industrieroboters Kraftsensor für eine Manipulatorhand Kraftsensorsystem Kraftstrom Kraftvektorsensor Kraftverbrauch Kraftverbrauch Kräftvergleichsregler Kraftverlauf im Gelenk Kreis Kreis für Abweichungsfeststellung Kreis für Abweichungskorrektur Kreis mit einseitiger Richtwirkung Kreisabtastung Kreisdiagramm Kreiselkompaßregelung kreisförmige Roboterarmbewegung Kreisfrequenz Kreisgüte Kreisinterpolation Kreiskriterium Kreislauf Kreislauf Kreislauf Kreislaufkühlung correlation computer correlated controllers correlation technique correlation theory correlation triangulation correlation technique correlated controllers corresponding value correct v corrective action correcting element correction element correction term corrected joint regulation corrected assembly process corrected program corrected actuating signal corrosion resistance corrosion inhibitor cosine wave robot prime cost covariant element covariance Soft gripper force, force of soft gripper power‐dependent motion limitation power adaptation mode of power supply connection receiver of force force receiver of tactile sensor power consumption power demand power‐operated holding tool power‐operated holding tool force compensation on robots force‐balanced potentiometer force destination (drive) reference point of forces force‐balance transducer survey of forces force sensor force‐controlled joint(ing) power characteristic line (of pincer grip unit) motor control engine control force measurement device (installation) force measurement device force measurement installation force measurement (robot joint) force feedback force‐sensibilized gripper force sensor force sensor of industrial robot power sensor for manipulator hand force sensor system power current force vector sensor power consumption power demand force‐balance regulator behaviour of force in the joint loop error‐indicating circuit error‐correction circuit unidirectional circuit circular scanning circle diagram gyro‐control circular robot arm (lever) movement angular frequency quality factor circuit circular interpolation circle criterion cycle cyclic process circulation closed‐cycle cooling stran 150 od 326 EN ‐DE: slovar avtomatizacije in robotike Kreislaufprinzip Kreislaufschaltung Kreislaufverhältnis Kreisliste Kreisprozess Kreisprozess Kreisprozess Kreisschaltung Kreisschiebung eines Greiforgans KreisStruktur Kreisverstärkung Kreisverstärkung Kreisverstärkung Kreiswirkungsgrad Kreuzgelenk Kreuzkopplung Kreuzkorrelation Kreuzkorrelationsfunktion Kreuzmodulation Kreuzspektraldichte Kreuzungspunkt Kreuzungspunkt Kreuzverzerrung Kriechfall) Kriechstrecke Kriechweg Kriogenik kristallische Struktur Kristallstruktur Kriterium Kriterium der optimalen Steuerung Kriterium der Verlustmittelwerte Kriterium des optimalen Moduls Kriterium für das Übergangsverhalten kritisch kritisch gedämpftes System (PT2‐Element mit D = 1) kritisch machen kritische Anpassung kritische Dämpfung kritische Dämpfung (D = 1 eines PT2‐Elements kritische Dichte kritische Entfernung kritische Frequenz kritische Frequenz kritische Gitterspannung kritische Haltung kritische Induktion kritische Konstante kritische Spannungsdifferenz kritische Stellung kritische Temperatur kritische Verstärkung kritische Wellenlänge kritischer Druck kritischer Gitterstrom kritischer Punkt kritischer Verstimmungswinkel kritischer Wert kritischer Widerstand kritischer Zustand kritisches Potential kritisches Volumen Kryogengerät Kryogenik‐Datenverarbeitungsanlage Kryogenspeicher Kryogensystem kubische Gleichung kugelförmiger Arbeitsraum Kugelspindelantrieb Kugelventil Kühlaggregat Kühlluftschacht Kühlmittelkreislauf Kühlsystem mit Zwangsbelüftung Kühlungsleistung kumulative Ausfallzeit cycle principle circulation system cycle ratio circular list cycle cyclic process circulation closed‐loop circuit circular displacement of grip organ loop structure closed loop gain closed‐loop gain loop gain circuit efficiency swivel joint cross coupling cross correlation cross‐correlation function cross modulation cross‐spectral density cross point intercept point cross distortion overdamped system leakage path leakage path cryogenics crystal structure crystal structure criterion optimal control criterion criterion of middle losses criterion of optimal modulus performance index critical critically damped system make critical v critical matching critical damping critical damping critical density critical distance cut‐off frequency critical frequency critical grid voltage critical attitude critical induction critical constant critical voltage difference critical attitude critical temperature critical gain critical wavelength critical pressure critical grid current critical point critical error angle critical value critical resistance critical state critical potential critical volume cryogenic equipment cryogenic data processor cryogenic store cryogenic system cubical equation globular working zone ball spindle drive ball valve cooling aggregate air cooling channel cooling agent cycle forced‐air cooling system cooling capacity cumulative down‐time stran 151 od 326 EN ‐DE: slovar avtomatizacije in robotike kumulative Betriebszeit kumulative spektrale Dichte Kundendienst im Einsatzbereich Kundeninformationssteuersystem Kundeninformationssteuersystem Kunden‐Interface Kunden‐Interface Kundenschaltkreis künstliche Haut künstliche Intelligenz künstliche Roboterintelligenz (Intelligenz feines Roboters) künstliche Sprache künstlicher Übertrag künstliches Dielektrikum kuppeln Kupplungsmontageroboter Kupplungsroboter Kupplungssteuerung Kurbelschleife Kursberichtigung Kurtzstreckensystem Kurvenabtaster Kurvenabtastgerät Kurvenanalysator Kurvenbild Kurvendarstellung Kurveninstrumentenverschiebung Kurvenpunkt Kurvenschar Kurvenschreiber Kurvenschreiber Kurvenschreiber Kurvenverfolgungslogik kurz kurze Auswertezeit (von Roboterbildern) kurze Erholzeit kurzer Laserimpuls kurzer optischer Impuls kurzgeschlossene Leitung Kurzschlußschutz Kurzschlußstromspitzenwert Kurzschlußsucher Kurzstrecken‐Dopplerverfahren kurzwellige Infrarotstrahlung Kurzzeitbetrieb kurzzeitige Abtastung von Messsignalen kurzzeitige Programmierbarkeit kurzzeitige Störung kurzzeitige Umprogrammierbarkeit kurzzeitige Umprogrammierbarkeit Roboterschultergelenk Kurzzeitmessgerät Kurzzeitphasenstabilität Kurzzeitspeicher Kybernetik Kybernetik der Elektroenergiversorgungssysteme Kybernetik in der Ökonomie kybernetische Darstellung kybernetische Führung kybernetische Führung kybernetische Leitung kybernetische Leitung kybernetische Regelung kybernetische Regelung kybernetische Struktur kybernetischer Automat kybernetisches Modell kybernetisches Modell kybernetisches System Laboratoriumsautomat Laboratoriumsmessgeräte Laboreinrichtung Laboreinsatz Labor‐Logikprüfung Labormaßstabsausrüstung Labormodell Laborprüfung der Logik cumulative operating time cumulative spectral density field service customer information control system customer information control system, CICS custom interface customer interface custom integrated circuit artificial skin artificial intelligence artificial robot intelligence artificial language artificial carry artificial dielectric gang v coupling assembly robot coupling robot clutch control crank‐guide, Scotch yoke course correction short‐distance system curve scanner curve scanner curve analyzer plot of the function curve tracing curve instrument displacement curve point set of curves graph plotter plotter curve plotter curve follower logic short abbreviated evaluation time (of robot images) short recovery time fast laser pulse short optical pulse short‐circuited line short‐circuit protection short‐circuit current peak value short‐circuit detector short‐range Doppler short infrared short‐time duty short scanning of measuring signals short‐time programmability momentary disturbance short‐time re‐programmability short‐time reprogrammability shoulder joint of robot short‐time measuring apparatus short‐term phase stability short‐time memory cybernetics electric power system cybernetics economical cybernetics cybernetic representation cybernetic control cybernetic direction cybernetic control cybernetic direction cybernetic control cybernetic direction cybernetic structure cybernetic automaton cybernetic simulator cybernetic model cybernetic system laboratory automat laboratory measuring instruments laboratory equipment laboratory use laboratory logic testing bench‐scale equipment laboratory model laboratory logic testing stran 152 od 326 EN ‐DE: slovar avtomatizacije in robotike Laborversuch Lade‐ und Ablesegerät Lade‐ und Entladesystem (für Roboter) Ladedruckregler Ladeeinrichtung Ladekammer Laden mit absoluten Adressen Ladeprogrammaufbautechnik chargeur Ladepunkt Lader Lade‐und‐Start‐Assembler Ladungsemissionsdetektor Lageabweichung Lageausgleich Lagebestimmung f(von Werk stücken) Lagebestimmungsgerät Lageerkennung Lageerkennungsprozedur Lagefixierung Lagefixierung Lagefixierung Lageinformation Lageinformation 'durch Sensor Lagerbestand Lageregelung Lageregelung Lageregelung Lageregler lagern Lagerung feines Greiforgans Lagerung feines Roboterarmes Lagesensor Lagesensorsystem Lagesicherung Lagesicherungselement Lagrangesche Funktion Lagrangesche Multiplikatorenmethode LAMA Lamelle eines Greiforgans Laminarbetriebszustand Lampensignalisierung Landedruckmesser Länge der Montagebewegung Längenbelastung langkettig langkettige Verzweigung langsame Geschwindigkeitsänderung Längsbewegung längsgerichtete Schützeinrichtung Längsmehrpunktsensor Längsmehrpunktsensor multipoint longitudinal Längsstabilität Langzeitstabilität Langzeittest Langzeittest Langzeitwirkung Laplace Laplace Variable Laplace‐Operator Laplace‐Rücktransformation Laplacesche Transformation Laplacesche Umformung Laplace‐Transformationspaar Laplace‐Transformierte LAPLACE‐Übertragungsfunktion Laplace‐Übertragungsfunktion Laplace‐Variable Lärmemission Lärmschutz Laser für kurze Impulse Laser für lange Impulse Laserabrunden Laserabtastradar Laseranordnung Laseranreicherung Laseranwendung laboratory test charger reader device charging‐discharging system (for robots) boost‐pressure controller loading device load chamber absolute loading bootstrapping (of program) load point loading device load‐and‐go assembler charge emission detector position deviation position balance position determination (of s) position finder position identification, position perception (recognition) position recognition procedure position fixing, position fixage position fixing position fixage position information sensor position information stock position control position control system regulation of position position[ing] controller store v support of grip organ, grip organ bearing bearing of robot lever (arm) position sensor position sensor system position protection, protection of position element of position protection Lagrangian function Lagrangian multiplier method LAMA, language for automatic mechanical assembly lamina of grip organ streamline regime lamp signalling boost‐pressure gauge assembly movement length linear heat rate long‐chain long‐chain branching long‐term speed variation longitudinal movement longitudinal differential protection longitudinal multipoint sensor longitudinal multipoint sensor longitudinal stability long‐term stability long‐run test long‐time test long‐term effect Laplace Laplace‐operator Laplace operator inverse Laplace transformation Laplace transformation Laplace transformation Laplace‐transform pair Laplace‐transform continuous‐time transfer function Laplace continuous‐time transfer function Laplace operator noise emission noise protection short‐pulse laser long‐pulse laser laser rounding scanning laser radar laser arrangement laser enrichment laser application stran 153 od 326 EN ‐DE: slovar avtomatizacije in robotike Laseranzielen Laserapertur Laseraufklärungsgerät Laserausgangscharakteristik Laserausgangsleistung Laserausgangsspektrum Laserausstrahlung Laserbeschleunigungsmesser Laserbestrahlung Laserbetrieb Laserbetriebsintervall Laserbetriebszeit Laserbildschirm Laserdarstellungssystem Laserdatendarstellungsgerät Laser‐Datenübertragungsleitung Laserdatenverarbeitungsanlage Laserdetektionssystem mit großer Ansprechgeschwindigkeit Laserdrucker Laserdruckmesser Laserdurchflussmesser Laserdurchschlagsvermögen Lasereffekt Lasereinstellung Lasereinstrahlung Laseremission Laserempfängerstation Laser‐Emulsionsspeicher Laserenergie Laserenergiequelle Laserentfernungsmesser Laserentfernungsmesser Laserentfernungsmesser Laserentfernungsmesser Lasererfassungssystem Lasererregung Laserfernmeldeausrüstung Laserfernmeldeeinrichtung f Laserfokus Laserfrequenz Laserfrequenzstabilität Lasergenerator Lasergerät Lasergewinn Lasergyroskop Laserhöhenmesser Laserhöhenmesser Laserimpulskompression Laserimpulssteuerung Laserinformationsdarstellungssystem Laserinfrarotstrahlung laserinterferometrische Justierung Laserkanalkapazität Laserkanalübertragungsfähigkeit Laserkaskadenverbindung Laserkreis Laserleistungsschwankungen Laserlenkung Laserlesegerät Laserlicht Laserlicht Laserlinienbreite Lasermaschine Lasermikrospektroanalysator Lasermodulation Lasernachlaufangaben Lasernachlaufdaten pl Lasernachrichtentechnik Laser‐Nachrichtenübertragungssystem Laserniveau Laseröffnung laseroptische Methode Laseroszillator Laserpegel Laserradartechnik Laser‐Raman‐System laser aiming laser aperture laser search apparatus laser output characteristic laser output laser output spectrum laser emission laser accelerometer laser irradiation laser operation lasing time lasing time laser[‐scan] display laser display system laser data display equipment laser data transmission line laser data processing equipment fast‐response laser detection system laser[‐beam] printer laser pressure gauge laser flowmeter laser piercing power laser effect laser alignment laser irradiation laser emission laser receving station laser‐emulsion storage laser energy laser power source laser rangefinder ranging laser laser ranging device laser ranging equipment laser detection system laser excitation laser communication equipment laser communication equipment laser focus laser frequency laser frequency stability laser generator laser arrangement laser gain laser gyroscope laser altimeter laser altitude gauge laser pulse compression laser pulse control laser information display system infrared laser radiation laser interferometric alignment laser channel capacity laser channel capacity laser cascade connection laser circuit laser fluctuations laser aiming laser scanner laser light laser radiation laser linewidth laser machine laser microspectroanalyzer laser modulation laser tracking data laser tracking data laser communication engineering laser communication system laser level laser aperture laser‐optical method laser oscillator laser level laser radar technique laser Raman system stran 154 od 326 EN ‐DE: slovar avtomatizacije in robotike Laserrastermokroskop Laserrückstrahl Laserscanner Laserschalter Laserschnitt Laserschwelle Laserschwingungsdetektor Laserschwingungserzeugung Laserschwingzustand Lasersendestation Lasersendestation Lasersignal Laserspektroskopie Laserstrahlablenkschaltung Laserstrahlbearbeitungsmaschine Laserstrahlbündelung Laserstrahlendurchgriff Laserstrahlerhitzung Laserstrahlerwärmung Laserstrahlfokussierung Laserstrahlgefahr Laserstrahlkohärenz Laserstrahlmodulator Laserstrahlschweißen laser Laserstrahlsensor Laserstrahlsensor Laserstrahlung Laserstrahlung Lasersuchgerät Lasersystem hoher Leistung Lasertätigkeit Lasertechnik Laserüberlagerungsempfänger Laserüberwachung Laserverbindung Laserverstärker Laserverstärker mit aktivem Interferenzfilter Laserverstärkerbandbreite Laserweitverkehrsverbindung Last‐ und Dehnungsmessung Lastarm Lastarmmanipulator Lastaufnahme Lastaufnahmegerät Lastbegrenzer Lasthebeeinrichtung Lasthebeeinrichtung Lastspannung Lastteilverfahren Lastwechsel Latchregister latente Reaktion Latenzzeit laufender Modus Laufsimulation Laufwerkplatte Laufzeitcharakteristik Laufzeitentzerrungsschaltung Laufzeitkette Laufzeitspeicher Laufzeitsystem Laufzeitverzerrung Laufzeitverzerrung Laugenbeständigkeit Layout Layout einer Montagestation Layout eines Montageplatzes Layout eines Montagesystems Lebensdauer Lebensdauer bei Belastung Lebensdauerkurve Lebensdauerprüfung Lebensdauerprüfung bei konstanter Belastung lecksichere Verkappung Lecksicherheit Leckstromeffekt laser scanning microscope return laser beam laser scanner laser switch laser cut laser threshold vibration‐detecting laser apparatus laser generation oscillatory laser state laser transmitting station laser sending station laser signal laser spectroscopy laser‐beam deflecting circuit laser‐beam machining device laser‐beam focusing laser penetration laser‐induced heating laser‐induced heating laser‐beam focusing laser‐beam danger laser coherence laser‐beam modulator laser‐beam welding laser beam sensor laser‐beam sensor laser light laser radiation laser search apparatus high‐power laser system laser activity laser technology laser superheterodyne receiver laser surveillance laser communication laser amplifier active interference filter laser amplifier laser amplifier bandwidth long‐range laser communication measurement of load and extension weight arm weight arm manipulator load bearing capacity load take‐up device load limiter load lifting device manipulator load lift device, manipulator load lifting device, load voltage load sharing mode load change latch register hidden response latency time current mode simulation of movement motor board delay‐time characteristic delay correction network delayed‐line network chain delay‐line memory system of flight time, system of transit time phase distortion delay distortion alkali resistance layout assembly station layout layout of erection site assembly system layout operating life load life life curve life test constant‐stress life test leak‐tight encapsulation leak tightness current leakage effect stran 155 od 326 EN ‐DE: slovar avtomatizacije in robotike Leckstrommesser electric leakage tester leer empty Leerbefehl blank instruction leerer Zustand idle state Leergang blank cycle Leergang idle cycle Leergang null cycle Leerkontrolle emptiness check[ing] blank cycle Leerlauf idle cycle Leerlauf null cycle Leerlauf Leerlauf‐Abschaltautomatik vide idling switching‐off automatic unit Leerlaufarbeit no‐load working Leerlaufausgangskonduktanz open circuit output conductance idle mode Leerlaufbetriebsart no‐load characteristic Leerlaufcharakteristik unloaded characteristic Leerlaufcharakteristik Leerlaufeinrichtung vide idling appliance idle speed adjustment Leerlaufeinstellung Leerlaufgang idling cycle Leerlaufgeschwindigkeitseinstellung idle speed adjustment Leerlaufkennlinie no‐load characteristic Leerlaufkennlinie unloaded characteristic Leerlaufkontrolle no‐load control open‐circuit voltage Leerlaufspannung Leerlaufspannungsrückwirkungsfaktor open circuit voltage transfer ratio Leerlaufstrom idle current Leerlaufzustand vide idling conditions Leerspaltensucher blank column detection device Leerzustand idle state legieren (durch Roboter) alloy to (by robot) lehrender Automat teaching automaton lehrender Automat teaching machine initial value theorem Lehrsatz vom Anfangswert linearity theorem Lehrsatz von der Linearität lag theorem Lehrsatz von der Phasennacheilung leise laufender Gleichstrommotor (für Roboteranwendung) slight‐running DC‐motor (for robots application) Leistung performance Leistung aufnehmen absorb power v Leistung eines Rechners computer performance Leistung zero power Leistung verbrauchen absorb power v Leistungsabfall eines Roboters decrease in power of robot Leistungsanforderung performance requirement Leistungsanpassung eines Roboters power matching of robot, power adaptation of robot performance evaluation Leistungsauswertung capacity demand Leistungsbedarf demand power Leistungsbedarf Leistungsbegrenzung eines Roboters power limiting of robot Leistungsbegrenzungsschutz overpower protection Leistungsberechnung feines Roboters capacity rating of robot, capacity computation of robot Leistungsbereich eines Roboters capacity range of robot, robot power range performance characteristics Leistungscharakteristik Leistungsdetektor power detector Leistungsdiagramm rating chart Leistungsdichte power density Leistungselektronik"eines Roboters robot power electronics efficient pulse transmission leistungsfähige Impulsübertragung leistungsfähiger Sensor high‐capacity sensor leistungsfähiger Sensor < high‐capacity sensor capacity Leistungsfähigkeit Leistungsfähigkeit eines Manipulators manipulator performance Leistungsfaktor eines Elektroantriebes electric drives blockin electric drive power coefficient Leistungsfluss eines Industrieroboters robot power flux, industrial robot power flux Leistungsformel power formula Leistungsgrenze limit of capacity Leistungsgrenze eines Roboters power limit of robot Leistungskennlinie power of performance curve Leistungskennwerte performance characteristics Leistungskreis power circuit Leistungskriterium criterion of performance Leistungsmodulation intensity modulation Leistungsniveau level of capacity Leistungsreferenz performance reference Leistungsregler capacity controller Leistungsschalter power switch stran 156 od 326 EN ‐DE: slovar avtomatizacije in robotike Leistungsschalter mit Schnellwiedereinschaltung Leistungsschütz Leistungsstabilisierung Leistungsteiler Leistungstransformator Leistungstransiente Leistungstreiber Leistungsverbrauch im Bereitschaftszustand Leistungsverlust power of performance curve 496 Leistungsvermögen Leistungsverstärker Leistungsverstärkung Leitelement Leiterplattenroboter Leiterzug Leiterzug Leitfähigkeit Leitfähigkeitsgeber Leitfähigkeitsmessbrücke Leitfähigkeitsregler Leitfunktion Leitstation Leitstrahlsteuerung Leitstromkreis Leitung Leitungen des Unterbrechungsbusses Leitungsadapter Leitungsanpassung Leitungsanpassungsteil Leitungsanwahl Leitungsband Leitungseinrichtung Leitungsimpedanz Leitungskonzentrator Leitungsrauschen Leitungsrelais Leitungsschema Leitungssignal Leitungssteuerung Leitungsstrom Leitungstakt Leitungsteilnehmersystem Leitungsteilungssystem Leitungstreiber Leitungsvermittlungssystem Leitungunterbrechungsschutz Leitweganzeiger Leitwegkode Leitwegtabelle Leitwerk Leitwerk Leitwerk Leitwert Leitwertfunktion Leitwertmatrix Leitzahlenberechnung lenkbar lenken Lenkung Lenkung Lenkung einer Robotermontage Lenkungsphase Lenkungsprogramm Lenkungsrechner lernender Automat lernender Automat lernender Rechenautomat lernender Rechenautomat lernendes Klassifikationssystem Lernmaschine Lernmaschine Lernmodell Lernphase Lernprogramm Lernroboter Lernsystem recloser power contactor power stabilization power divider power transformer power transient power driver standby consumption power loss capacity power amplifier power amplification pilot cell circuit board robot conducting path conductor line, conducting path conductivity conductivity transmitter conductivity measuring bridge conductivity controller steering function control station command guidance pilot circuit management lines of interruption bus line adapter line adaption line adapter line dialling conduction band line equipment line impedance line concentrator line noise line relay connection diagram line signal line control conduction current line clock [pulse] line‐sharing system line‐sharing system line driver circuit switching system open‐phase protection routing indicator routing code routing table controller control device control unit conductance admittance function admittance matrix guide numbers calculation controllable drive v guidance guide steering of robot assembly guidance phase control program guidance computer learning machine learning automaton learning machine learning automaton learning classification system learning machine learning automaton learning model learning phase learning program learning robot self‐learning system stran 157 od 326 EN ‐DE: slovar avtomatizacije in robotike Lesebetrieb Lesedaten pl Lesegerät Lesegerät Leseimpuls Leseoperation Leser Leser Lese‐Schreib‐Zyklus Lesestrom‐Schreibstrom‐Quelle Leuchtdichteeinstellung Leuchtdichteeinstellung Leuchtsignal Leuchtsignal Leuchtsignal lichtabhängiges Steuerglied Lichtanlage Lichtbogenautomatenschweißen Lichtbogenschweißautomat Lichtbogenschweißautomat Lichtbogenschweißmanipulator Lichtbogenschweißroboter Lichtbogenschweißung durch Roboter Lichtdetektor lichtelektrisch leitend lichtelektrische Emission lichtelektrische Emission lichtelektrische Steueranlagen lichtelektrische Zelle lichtelektrische Zelle lichtelektrische Zelle lichtelektrischer Abtaster lichtelektrischer Impulsgeber lichtelektrischer Verschiebungsgeber lichtelektrisches Polarimeter lichtelektronische Anlage Lichtelement Lichtelement Lichtelement Lichtgriffel Lichtgriffel Lichtgriffel Lichtgriffel Lichtimpuls Lichtleiteranwendung Lichtleiteranwendung Lichtleitertechnik Lichtleitertechnologie Lichtleitertechnologie Lichtleitertechnologie Lichtleiterverbindungskarte (für Bus) Lichtleitsensor Lichtmessungsrechner Lichtrelais Lichtschrankenkontrolle Lichtschrankensensor Lichtsignal Lichtsignal Lichtsignal Lichtspaltprüfeinrichtung Lichtspaltregler Lichtstift Lichtstift Lichtstift Lichtstift Lichtstiftanzeige Lichtstiftempfindlichkeit lichtstiftgesteuertes Programm Lichtverlust (eines optischen Sensors) Lichtwellengerät Lichtwellenlängemaßeinheit Lichtwellenleiter‐Messtechnik Lichtwellenleiter‐Rechner‐Interface Lichtwellenleitersystem Lichtwellenleiter‐Übertragungsfunktion Lidar mit hohem Auflösungsvermögen read[ing] operation read data reading device reader reading pulse read[ing] operation reading device reader read‐write cycle read‐write current source brightness control luminance control light signal, luminous signal light signal luminous signal light‐dependent control element lighting installation automatic arc welding automatic arc welding equipment automatic arc welding machine arc welding manipulator arc welding robot arc welding by robot light detector photoconductive photoelectric emission photoemission photoelectric control equipments photoelectric cell photocell photoelement photoelectric scanner photoelectric pulse maker photoelectric displacement transmitter photoelectric polarimeter photoelectronic installation photoelectric cell photocell photoelement light pen light stylos beam pen electronic pen light impulse fibre optics application fibre optics application, fiber optics application (US) fibre optics technique, fiber optics technique (US) light conductor technology, optical fibres technology (US: opti light conductor technology optical fibres technology light line connecting card (for bus) light conducting sensor photometric computer light relay light barrier checking light barrier sensor light signal, luminous signal light signal luminous signal light‐gap testing equipment light‐gap regulator light pen light stylos beam pen electronic pen light pen display light pen sensitivity light‐pen‐controlled program light loss (of optical sensor) light‐wave device light‐wave measuring unit optical fiber measurements fiber optic computer interface optical fiber system optical fiber transfer function high‐definition lidar stran 158 od 326 EN ‐DE: slovar avtomatizacije in robotike linear ansteigendes Signal linear geführtes Bauelement linear unabhängig linear wachsende Funktion Linearabmessung Linearantrieb Linearbeschleuniger Lineardämpfung Lineardispersion lineare (einreihige) Anordnung lineare Abhängigkeit lineare Abmessung lineare algebraische Gleichung lineare Annäherung lineare Backenbewegung lineare Bahninterpolation lineare Beschränkungen lineare Dämpfung lineare Dichte lineare Dispersion lineare Einstellgenauigkeit lineare Extrapolation lineare Extrapolationslänge lineare Funktion lineare Gleichrichtung lineare Interpolation lineare Koordinatenumformung lineare Nenngeschwindigkeit lineare Polarisation lineare Programmierung lineare Regelung lineare Roboterbewegungsgleichung lineare Skale lineare Stellungsregelung lineare Systemanteile mpi lineare Systemanteile lineare Systemtheorie lineare Übertragungsfunktion lineare Unabhängigkeit lineare Verschiebung lineare Verschiebungsgeschwindigkeit (Roboter) lineare Verzerrung lineare Wärmebelastung lineare Zerlegung Lineareinheit Lineareinheitenaufbau linear‐elastische Bruchmechanik linearer Akteur linearer Akteur linearer Akteur linearer Arbeitsbereich linearer Automat linearer Bereich linearer Effektor linearer Empfänger linearer Extrapolationsabstand linearer Fehler linearer Grad linearer Impulsverstärker linearer Kode linearer Robotermodul linearer Schaltkreis linearer Stellantrieb linearer Wandler linearer Wärmeausdehnungskoeffizient lineares lineares Bewegungsglied lineares Bewegungsglied lineares Bewegungsglied lineares diskretes System lineares einschleifiges Regelungssystem lineares Einstellen lineares Entkopplungsglied lineares Filter lineares Gleichungssystem lineares Glied linear rising signal linear‐guided component linearly independent ramp function linear dimension linear drive linear accelerator linear damping linear dispersion in‐line array linear dependence linear dimension linear algebraic equation linear approximation linear jaw movement linear trajectory interpolation linear constraints linear attenuation linear density linear dispersion linear adjusting accuracy linear extrapolation linear extrapolation distance linear function linear detection linear interpolation linear transformation of coordinates rated linear speed linear polarization linear programming linear control linear robot motion equation linear scale linear position control linear system parts linear system parts linear system theory linear transfer function linear independence linear displacement linear displacement speed linear distortion linear heat rate line[ar] scanning linear unit linear unit structure linear‐elastic fracture mechanics linear joint, linear acting element linear joint linear acting element linear‐mode region linear automaton linear range linear actuator linear receiver linear extrapolation distance linear error linear degree linear pulse amplifier linear code linear robot module, linear module of robot linear switching circuit linear control electromechanism linear transducer coefficient of linear thermal expansion linear linear joint, linear acting element linear joint linear acting element linear discrete‐time system linear single‐loop control system linear adjusting linear decoupling joint linear filter linear equation system linear element stran 159 od 326 EN ‐DE: slovar avtomatizacije in robotike lineares Glied lineares Integralkriterium lineares Modell lineares Optimierungsprogramm lineares Regelungssystem lineares Robotermodell lineares Robotersystem lineares stationäres System lineares System lineares System mit variablen Koeffizienten lineares System mit variablen Koeffizienten lineares Tastsystem lineares Übertragungsglied lineares zeitinvariantes Regelungssystem Linearfilter Linearfrequenzspektrum Linearfunktion Lineargeschwindigkeit eines Roboters linearisieren linearisiertes Systemmodell Linearisierung Linearisierung der Abtastung Linearisierung der Relaissysteme Linearisierung der Roboterbewegung Linearisierung durch die Methode kleiner Schwingungen Linearisierung durch kleine Abweichungen Linearisierung feiner Roboterregelung Linearisierungsbereich Linearität Linearität von kapazitiven Mikrometern Linearität von Strahlungsempfängern Linearitätsbereich Linearitätsbereich Linearitätsfehler Linearitätsprinzip Linearitätsregelung Linearkanal linear‐logarithmischer Umsetzer Linearmotor Linearoptimierung Linearpotentiometer Linearregelung Linearspeicher Linearstromkreis Linearstromkreis Linearsystem mit variablen Parametern linearte Optimalsysteme linearveränderlicher Widerstand Linearverschiebung Linearverstärker Linearwiderstandsdurchflussmesser Linearzeitablenkgenerator linguistische Regel linguistische Variable linguistischer Bezeichner linguistischer Bezeichner linguistischer Modifikator linguistischer Modifikator linguistischer Wertname linguistischer Wertname linguistischer Wertname Linie konstanter Phase Linienaktivität Linienaufzeichnung linienbeschreibendes Element Liniendichte Linieninterface Linienrelais Linienrelais Linienrelais Linienschreiber Linienspektrum Linienstruktur linke s‐Halbebene Links‐Max‐Methode Lipschitz‐Bedingung linear block integral linear estimation linear model linear optimization program linear control system linear robot model linear robot system stationary linear system linear system variable coefficient system [linear] system of variable coefficients linear discrete‐time system linear transfer circuit linear time‐invariant (LTI) control system linear filter linear frequency spectrum linear function linear speed of robot linearize v linearized system model linearization scanning linearization linearization of relay systems linearization of robot movement linearization by method of small oscillations small deflection method linearization linearization of robot regulation linearization range linearity linearity of capacitive micrometers linearity of radiation receivers zone of linearity range of linearity linearity error principle of linearity linearity control linear channel linear‐to‐log converter linear motor linear optimization linear potentiometer linear control linear store linear circuit linear network linear system with variable parameters linear optimal systems linear variable resistor linear displacement linear amplifier linear resistance flowmeter linear sweep generator linguistic rule linguistic variable linguistic descriptor linguistic label linguistic hedge linguistic modifier linguistic label linguistic term linguistic value phase contour linear activity continuous record line‐descriptive element linear density line interface line relay calling relay ringing relay recorder with linear recording line spectrum line pattern left half s‐plane (LHP) first of maxima (FOM) defuzzification Lipschitz condition stran 160 od 326 EN ‐DE: slovar avtomatizacije in robotike Liste aktiver Aufgaben Liste aktiver Aufgaben Liste der Positionskoordinaten Liste der Verweisadressen Listendatei Listenkapitel Listennamenerklärung r Listenprogramm Listenprogrammsystem Ljapunow‐Funktion Lochgreifer logarithmische Additivität logarithmische Amplitudencharakteristik logarithmische Amplitudenfrequenzcharakteristik logarithmischer Rechenstromkreis logarithmischer Verstärker logarithmisches Arbeitsprinzip logarithmisches Dämpfungsglied logarithmisches Register logarithmisches Suchverfahren Logik Logik im Nanosekundenbereich Logikanalysator Logikanalyse Logikanalyse Logikbauteil Logikentwurf einer Rechenmaschine Logikschalter Logiksimulation Logiktabelle Logiktester logische Analyse logische Analyse logische Datenverarbeitung logische Entscheidungsfunktion logische Folgesteuerung logische Führung logische Funktion logische Funktion logische Grundfunktion logische Grundschaltung logische Implikation logische Interfacebedingung logische Kombinationsfunktion logische Komponente logische Leitung logische Multiplikation logische NICHT‐Schaltung logische ODER‐Schaltung logische Operation logische Operation des Steuersystems logische Operationsschaltung logische UND‐Schaltung logische Verknüpfung logische Verschiebung logischer Adder logischer Ausdruck logischer Automat logischer Befehl logischer Block logischer Entwurf logischer Entwurf von Schaltkreisen logischer Fehler logischer Impuls logischer Kanal logischer Vergleich logischer Vorgang logisches Anzeigesystem logisches Diagramm logisches Element logisches Element logisches Element der Analogrechenmaschine logisches Gatter logisches Glied logisches Grundelement logisches Kombinationselement active task list active task list, ATL list of position coordinates list of look‐up addresses report file report section report description entry list program list program system Liapunov function hole gripper logarithmic additivity logarithmic amplitude characteristic decibel‐log‐frequency logarithmic computing circuit logarithmic amplifier logarithmic work principle logarithmic attenuator logarithmic register logarithmic search method logic nanosecond logic logic[‐state] analyzer logic analysis, logical analysis logic[al] analysis logic device machine logic design logic switch logic simulation truth table logic tester logic analysis, logical analysis logic[al] analysis logical data processing logical decision function logic sequential control logical direction binary function logic function basic logic function logic base circuit logic implication logical interface condition combination logic function logical component logical direction logical multiplication logical NOT circuit logical OR circuit logic operation logical operation of control system operational logical circuit logical AND circuit logical connection logical shift logical adder logical expression logical automaton logic instruction logical block logical design logical design of switching circuits logical error logic pulse logical channel logical comparison logic operation logic display system logical diagram decision element logical element analog computer logical element logical gate element logical component basic logic element combinational logic element stran 161 od 326 EN ‐DE: slovar avtomatizacije in robotike logisches Luftstrahlelement logisches Netz logisches Programmschema logisches Rauschen logisches Schaltelement logisches Signal logisches Steuersignal logisches System logisches Zeitelement Logistik lokale Betriebsweise lokale Buserweiterung lokale Datenerfassung lokale Einheit lokale Managementschnittstelle lokale Nebenanlage lokale Roboterzeile lokale Rückführung lokale Stabilität lokale Stabilität lokale Steuerung lokale Struktur lokale Verarbeitung lokaler Iterationsblock lokaler Kondensator lokales Management‐Interface lokales Netz Lokalisation eines Fügelochs lokalisieren lokalisierter Roboterfehler lokalisiertes Bauelement Lokalisierung Lokalisierungssystem lokomotorische Roboterfunktion Lokutor Longitudinaldifferentialabschirmung Lösbarkeit löschbarer programmierbarer Festspeicher löschbarer Speicher Löschen der Information Löschen eines Roboterprogramms Löschimpuls Löschimpuls Löschkreis Löschkreis Löschschalter Löschtreiber Löschwiderstand Lose Lose Lösen einer Bondverbindung Lösung im eingeschwungenen Zustand Lösung von Anfangswertproblemen Lösungsfehler löten (durch Roboter) Lötpistole Lötpistoleneffektor Lötroboter Low‐High‐Übergang Low‐Logikpegel Low‐Power‐System Low‐Zustand Luenenburger‐Beobachter luftangetrieben Luftaufbereiter Luftaufbereitungsanlage Luftaufbereitungssystem Luftbehälter Luftbremsdynamometer Luftdämpfung Luftdrosselklappe Luftdruckprüfung Luftdruckregler Lufteintritt Lufteintritt Lufteintritt logical element of air jet logical net logical program scheme logical noise logical switching element logical signal logical control signal logical system timing logic element logistics local mode local bus extension local data collection local unit local management interface local extension plant local robot cell local feedback stability in the small local stability local control local structure local processing local iteration block local capacitor local management interface local network jointing hole localization localize v localized robot error localized component localization localization system locomotoric robot function locutor longitudinal differential protection solvability erasable programmable read‐only memory, EPROM erasable store erasure of information clearing of robot program extinction pulse reset pulse blanking circuit quenching circuit eraser switch erase driver quenching resistance backlash nonlinearity system with play bond failure periodic solution solution of initial value problems solution error solder to (by robot) soldering pistol effector of soldering pistol soldering robot low[‐to]‐high transition logic low level low‐power system low state Luenenburger observer air‐powered air handler air handling plant air‐processing system air chamber air‐brake dynamometer air damping air throttling damper air‐pressure test air‐pressure regulator air entry access of air air inlet stran 162 od 326 EN ‐DE: slovar avtomatizacije in robotike Luftfeuchtigkeitsanzeiger Luftführungssystem luftgekühlter Reaktor Luftkammer Luftkontaminationsanzeiger Luftkontaminationsmesser Luftkontaminationsmessgerät Luftkreislauf Luftkreislauf Luftkühlsystem Luftkühlung Luftparameter Luftprobenehmer Luftprobensammler Luftregler Luftregler Luftregulierungsventil Luftregulierungsventil Luftreinigungsanlage Luftschütz Luftspaltmethode Luftstrahlelement Lufttrennungsanlage Lufttrennungsanlage Lufttrocknungsanlage Luftturbulenz Luftüberwachungsgerät Lüftungsanlage Lüftungsanlage Luftzerlegungsanlage Luftzerlegungsanlage Luftzirkulation Luftzirkulation Luftzuführung Luftzuführung Luftzuführung Luftzuleitung Luftzuleitung Luftzuleitung Luftzutritt Luftzutritt Luftzutritt Lyapunow‐Funktion m automatisiertes digitales Ein‐und Ausgabesystem m Computerinterface eines IR m eines Handhabungsgerätes m einfache Montageoperation m einfacher Sensor m horizontale Verschiebung eines Roboterarms m integrierte Steuerung m konstruktives Robotermerkmal m koordinierte Industrieroboter m korrigierter Informationsträger m mechanische Greifereinrichtung m mechanische vollautomatische Produktion m Robotertechniker m s. 124 m s. C 373 m s. H 110 Maclaurinsche Reihenentwicklung Magazin eines Industrieroboters Magazinierplatz Magaziniersystem Magazinierungstechnik Magnetanalysator Magnetaufzeichnungstechnik Magnetband Magnetbandeinheit Magnetbandeinheit Magnetbandeinheit Magnetbandgerät Magnetbandgerät Magnetbandgerät Magnetbandkassette r* Magnetbandmodus magnetbandorientiertes Programmsystem hygroscope air duct circuit air‐cooled reactor air chamber air contamination indicator air contamination meter air contamination meter air circulation air cycle air cooling system air cooling air conditions air sampler air sampler anemostat air regulator air regulating valve air regulating valve air cleaning plant air‐break contactor air‐gap method element of air jet air separator air separation plant air drying plant air turbulence air monitor air ventilation system fan system air separator air separation plant air circulation air cycle air entry access of air air inlet air entry access of air air inlet air entry access of air air inlet Lyapunov function automatic digital input‐output system, ADIOS computer interface of IR of handling device simple assembly operation simple sensor horizontal shifting] of robot arm integrated control constructive robot feature coordinated industrial robots corrected information carrier mechanical gripper equipment mechanical full‐automatic production robot technician flexible production element contact piece hydraulic IR control Maclaurin expansion robot magazine, magazine of industrial robot storage place, storing place storage system storing technique magnetic analyzer magnetic recording technique mag[netic] tape magnetic tape device tape device tape unit magnetic tape device tape device tape unit information carrier cartridge (casket), magnetic tape casket [magnetic] tape mode magnetic tape‐oriented program system stran 163 od 326 EN ‐DE: slovar avtomatizacije in robotike Magnetblasenspeicher‐Einheit magnetempfindlicher Sensor Magnetfeldsensor Magnetfeldstabilisierung Magnetflussdichte Magnetflussmesser Magnetflussstabilisator Magnetgreifeinheit Magnetgreifer Magnethalter magnetisch abgeschirmtes Instrument magnetisch aufgezeichnetes Programm magnetische Ablenkung magnetische Anziehungskraft magnetische Anziehungskraft Magnetblasenspeicher magnetische Dämpfung magnetische Demodulation magnetische Eigenschaften magnetische Feldstärke magnetische Hysterese magnetische Hysterese magnetische Induktion magnetische Kernresonanzspektrometrie magnetische Kopplung magnetische Kopplung magnetische Kopplung magnetische Mikropulsation magnetische Nuklearresonanz magnetische Permeabilität magnetische Polarisation magnetische Sättigung magnetische Schirmung magnetische Schnellauslösung magnetische Steuereinrichtung magnetische Störung magnetische Streuung magnetische Verluste magnetische Verzögerungsleitung magnetischer Abschwächer magnetischer Analog‐Digital‐Umsetzer magnetischer Analysator magnetischer Drucksensor magnetischer Feldstärkenmesser magnetischer Fluss magnetischer Gasanalysator magnetischer Kreis magnetischer Schwimmerniveaugeber magnetischer Sensor magnetischer Spannungsregler magnetischer Spektrograf magnetischer Träger magnetischer Verstärker mit Selbstsättigung magnetisches Elektronenspektrometer magnetisches Laufzeitglied magnetisches Momentanrelais magnetisches Objekt magnetisches Potential magnetisches Schalten magnetisches Thermorelais magnetisches Variometer magnetisches Ventil magnetisches Verknüpfungsglied magnetisches Zeitrelais Magnetisierungskurve Magnetisierungsrichtung Magnetisierungsvektor Magnetisierungswicklung magnetoakustische Verzögerungsleitung magnetoelektrischer Sensor magnetoelektrischer Wandler Magnetohydrodynamik magnetomechanische Dämpfung magnetomechanischer Gasanalysator Magnetometer mit sättigungsfähigem Kern magnetooptische Anzeige magnetooptischer Effekt bubble memory device, BMD, magnetic bubble memory unit magnetic‐sensitive sensor magnetic field sensor magnetic field stabilization magnetic flux density magnetic fluxmeter magnetic flux stabilizer magnetic grip unit magnetic gripper magnetic pick‐up instrument with magnetic screening magnetically recorded program magnetic deflection magnetic attractive force magnetic attractive force magnetic damping magnetic demodulation magnetic characteristics magnetic field intensity magnetic hysteresis magnetic lag magnetic induction magnetic nuclear resonance spectrometry induction coupling inductive coupling magnetic coupling magnetic micropulsation magnetic nuclear resonance magnetic permeability magnetic polarization magnetic saturation magnetic shield instantaneous magnetic relay magnetic controlling equipment magnetic perturbation magnetic leakage magnetic loss magnetic delay line magnetic attenuator magnetic analog‐digital converter magnetic analyzer magnetic pressure sensor magnetic field strength meter magnetic current magnetic gas analyzer magnetic circuit magnetic float‐type level transmitter magnetic sensor magnetic voltage controller magnetic spectrograph magnetic carrier self‐saturated magnetic amplifier magnetic electron spectrometer magnetic delay line instantaneous magnetic relay magnetic object magnetic potential magnetic switching magnetic thermal relay magnetic variometer magnetic valve magnetic logical element magnetic time relay magnetization curve direction of magnetization magnetization vector excitation winding magnetoacoustic delay line magnetoelectric sensor magnetoelectric transducer magneto‐fluid dynamics magnetomechanical damping magnetomechanical gas analyzer saturable magnetometer magnetooptical diplay magnetooptical effect stran 164 od 326 EN ‐DE: slovar avtomatizacije in robotike Magnetostriktion magnetostriction Magnetostriktionsfilter magnetostrictive filter Magnetostriktionsgenerator magnetostriction oscillator Magnetostriktionsgenerator magnetostrictor Magnetostriktionsregelung magnetostriction control magnetostriktive Verzögerungsleitung magnetostriction delay line magnetostriktive Verzögerungsleitung magnetostrictive delay line magnetostriktiver Oszillator magnetostriction oscillator magnetostriktiver Oszillator magnetostrictor magnetic tester Magnetprüfgerät Magnetrotorbunker magnetic rotor bunker Magnetventil solenoid valve Magnetverstärkersteuerung elektrischer Getriebe magnetic amplifier electric drive control Magnistor magnistor Majorante majorant Majoritätselement majority element Majoritätsfunktion majority function Makbus mak bus Makrobefehl macroinstruction Makrobefehl macrocommand Makrobefehl macrocode Makrobefehl macro[s] Makrobewegung feines Industrieroboters robot macro‐movement, macro‐movement of industrial robot Makrobibliothek Macro library Makroblock macroblock Makrodefinition macrodefinition Makroeinrichtung macrofacility Makrogenerator macrogenerating program Makrogenerator macrogenerator Makrogenerierprogramm macrogenerating program Makrogenerierprogramm macrogenerator Makroinstruktion macroinstruction Makroinstruktion macrocommand Makroinstruktion macrocode Makroinstruktion macro[s] Makrooperation macrooperation Makrooperationsspezifikation macrodefinition Makroprogrammierung macroprogramming Makroprozessor macroprocessor Makros macroinstruction Makros macrocommand Makros macrocode Makros macro[s] Mamdani implication Mamdani Implikation MA‐Modell MA model MA‐Modell moving‐average model Management management Management‐Informationsbasis management information base Managementlehre management science Manipulator manipulator, handler Manipulator für Arbeitsmittelbewegungen (manipulator), handler for working medium movement Manipulator für Druckgießen pressure cast[ing] manipulator, pressure moulding handler Manipulator für Keramikpressen ceramic pressing manipulator Manipulator für Keramikpressen ceramic pressing manipulator, ceramic pressing handler Manipulator für Keramikpressen ceramic pressing handler Manipulator für Nahtschweißen seam welding handler (manipulator) Manipulator für Punktschweißen spot welding manipulator Manipulator für Spritzgießen (von Plasten) manipulator for moulding by injection (of plastic material), US Manipulator für Transport‐Operationen manipulator for transport operations Manipulator für Umladeoperationen manipulator of transshipment operations tool manipulator, manipulator for toot movement Manipulator für Werkzeugbewegung Manipulator klasse manipulator class Manipulator mit amerikanischen Normen manipulator with American standard Manipulator mit drei Freiheitsgraden manipulator with three degrees of freedom Manipulator mit europäischen Normen manipulator with European standards Manipulator mit kartesischem Arbeitsraum manipulator with Cartesian working room Manipulator mit numerischer Struktur manipulator with numerical structure Manipulator mit Positionsregelung positionnement manipulator with position control Manipulator mit Positionsregelung positionnement position controlled manipulator Manipulator mit sechs Freiheitsgraden manipulator with six degrees of freedom Manipulator mit zentraler Führungssäule manipulator with central guide column Manipulator mit zylindrischem Arbeitsraum manipulator with cylindrical working room Manipulator zur automatischen Handhabung von Bauelement automatic component handler Manipulatorabsolutposition absolute position of manipulator Manipulatoranalyse analysis of manipulator Manipulatoranordnung manipulator arrangement stran 165 od 326 EN ‐DE: slovar avtomatizacije in robotike Manipulatoranordnungsvariante Manipulatoranpassung Manipulatorantrieb Manipulatorantriebsvariante Manipulatorarbeitsebene Manipulatorarbeitsplatz Manipulatorarm Manipulatorarmgenauigkeit Manipulatorausfallzeit Manipulatorauslastung Manipulatorbahn Manipulatorbahnsteuerung Manipulatorbasiskoordinate Manipulatorbaueinheit Manipulatorbaueinheit Manipulatorbaukastensystem Manipulatorbefehl Manipulatorberechnung Manipulatorbereich Manipulatorbereich Manipulatorbeweglichkeit Manipulatorbewegungsbefehl Manipulatorbewegungsgleichung Manipulatorbewegungszyklus Manipulatordaten pl Manipulatordaten pl Manipulatordaten pl Manipulatordefektanalyse Manipulatordefektauswirkung Manipulatordimensionierung Manipulatordreheinheit Manipulatordynamik Manipulatoreinheit Manipulatoreinrichtung Manipulatoreinsatz Manipulatoreinsatzbedingung Manipulatorelement Manipulatorendpunkt Manipulatorendpunktlage Manipulatorendschalter Manipulatorenergie Manipulatorentwicklungsplan Manipulatorentwicklungsprojekt Manipulatorfeinpositionierung Manipulatorfreiheitsgrad Manipulatorführung Manipulatorführungsschiene Manipulatorgelenkeinheit Manipulatorgelenkkoordinaten Manipulatorgeneration Manipulatorgeschwindigkeit Manipulatorgestaltung Manipulatorgestell Manipulatorgestellelement Manipulatorgestellsystematik Manipulatorgrobposition Manipulatorgröße Manipulatorgrundausstattung Manipulatorgrundbaugruppe Manipulatorgrundplatte Manipulatorhand Manipulatorhaupttechnologien Manipulatorinstallation Manipulatorinstallation Manipulatorkennzeichnung Manipulatorkontaktelement Manipulatorkontrolle Manipulatorkontrolle Manipulatorkontrolle Manipulatorkoordinatenbasis Manipulatorlasthebeeinrichtung Manipulatorleistungsfähigkeit Manipulator‐Maschine‐Zuordnung Manipulatormodell Manipulatorobjektbewegung Manipulatorobjektmasse manipulator arrangement variant manipulator adaptation manipulator drive manipulator drive variant manipulator working plane manipulator operator position, handler operator position, man manipulator arm accuracy of manipulator arm manipulator downtime manipulator utilization manipulator track manipulator track control manipulator base coordinate construction unit of manipulator construction unit of manipulator, manipulator construction un manipulator building‐block system manipulator instruction manipulator calculation range of manipulateur range of manipulator manipulator mobility, mobility of manipulator manipulator movement instruction manipulator motion equation manipulator movement cycle, handler movement cycle manipulator parameters, manipulator data manipulator parameters manipulator data manipulator defect analysis manipulator defect effect manipulator dimensioning manipulator rotation unit manipulator dynamics manipulator unit manipulator equipment manipulator use, manipulator application manipulator application condition manipulator element manipulator end point manipulator end point position limit switch of manipulator manipulator energy manipulator development plan manipulator development project manipulator fine position degree of freedom of manipulator manipulator guide manipulator guide rail manipulator joint unit manipulator joint coordinates manipulator generation manipulator speed manipulator shaping manipulator frame manipulator frame element manipulator frame systematic coarse position of manipulator manipulator size manipulator basic equipment manipulator basic unit manipulator base plate manipulator hand, handler hand main technologies of manipulators instalation of manipulator installation of manipulator manipulator marking manipulator contact element manipulator checking, handler checking manipulator checking handler checking manipulator coordinate base manipulator load lift device, manipulator load lifting device, manipulator performance manipulator‐machine coordination manipulator model manipulator object movement manipulator object mass stran 166 od 326 EN ‐DE: slovar avtomatizacije in robotike Manipulatorparameter Manipulatorparameter Manipulatorparameter Manipulator‐Pedipulator‐System Manipulatorplatzbedarf Manipulatorportalwagen Manipulatorposition Manipulatorpositionierung Manipulatorpositionsdaten pl Manipulatorpräzision Manipulatorpunktsteuerung Manipulatorrechnersteuerung Manipulatorregelstrecke Manipulatorregelungssystem Manipulatorreglerstrecke Manipulatorroboter Manipulatorschlitten Manipulatorschritt Manipulatorsequenz Manipulator‐Soft‐Greifer Manipulatorspeicher Manipulatorspeicher Manipulatorspeicherebene Manipulatorsprache Manipulatorstellung Manipulatorsteuerhebel Manipulatorsteuerimpuls Manipulatorsteuersystem Manipulatorsteuerung Manipulatorsteuerungsdaten Manipulatorsteuerungsdaten pl Manipulatorstruktur Manipulatorsystem Manipulatortechnik Manipulatortechnik Manipulatortisch Manipulatorträger Manipulatortragfähigkeit Manipulatortyp Manipulatorübergabepunkt Manipulatorüberwachung Manipulatorwartung Manipulatorwiederholgenauigkeit Manipulatorzusatzeinrichtung Manipulatorzustand Manipulatorzustand Manipulatorzustand Manipulatorzustandsfolge manipulieren manipulieren manipulierte Roboterdaten pl manipuliertes Objekt Mannigfaltigkeit Manometerprüfpresse manuell geführter Effektor manuell gesteuerter Manipulator manuelle Montage manuelle Programmierung manuelle Roboterprogrammierung manuelle Robotersteuerung manuelles Auswechseln der Greiforgane manuelles Entgraten Markierimpuls Markierungsschaltung Markowscher Prozess Marktposition maschinelle Bearbeitung maschinelle Datenerfassung maschinelle Datenerfassung maschinelle Programmierung maschinelle Rechentechnik maschinenabhängige Robotertechnik Maschinenanordnung Maschinenausfall Maschinenauslastung Maschinenauslastung manipulator parameters, manipulator data manipulator parameters manipulator data manipulator‐pedipulator system manipulator floor space required manipulator portal car manipulator position manipulator positioning position data of manipulator manipulator precision manipulator point control manipulator computer control controlled system of manipulator manipulator control system manipulator regulator distance manipulator robot manipulator carriage manipulator step, handler step manipulator sequence manipulator soft gripper manipulator memory manipulator memory (store) manipulator memory (store) plane manipulator language, ML position of manipulator manipulator control lever manipulator control impulsion manipulator control system manipulator control, handler control data of manipulator control data of manipulator control manipulator structure manipulator system manipulator technique manipulator technique' manipulator table manipulator support manipulator load‐carrying capacity manipulator type manipulator transfer point manipulator monitoring manipulator servicing, manipulator maintenance manipulator repetition precision manipulator additional device manipulator state, manipulator condition manipulator state manipulator condition manipulator state sequence handle v manipulate v manipulated robot data manipulated object variety manometer test press manual guided effector Hand‐controlled manipulator, manual‐controlled manipulator manual assembly manual programming manual robot programming manual robot control manual interchange of grip organs manual trimming marker impulse marking circuit Markovian process market place machining mechanical data acquisition mechanical data collection computer‐assisted programming machine‐computing technique machine‐dependent robotics (robots technique) machine arrangement machine failure machine utilization, assembly machine utilization machine load stran 167 od 326 EN ‐DE: slovar avtomatizacije in robotike Maschinenautomatisierung Maschinenbedingung Maschinenbefehl Maschinenbelastung Maschinenbeschickung Maschinendarstellung Maschinendefektanalyse Maschinendefektauswirkung Maschinenfunktionsschaltung Maschinengestell Maschinengleichung Maschinengleichung maschinenintegrierte Gerätetechnik maschinenintegrierte Gerätetechnik machine maschinenintegrierter Manipulator maschinenintegrierter Roboter maschineninterne Darstellung maschinenkodekompatibler Befehlssatz Maschinenkonfiguration Maschinenkoordinatensystem Maschinenlogik Maschinenlogikentwurf Maschinennullpunkt Maschinenoperation Maschinenordnung maschinenorientiert maschinenorientierte Geometriesprache maschinenorientierte Geometriesprache machine maschinenorientiertes Testhilfsprogramm maschinenorientiertes Testhilfsprogramm mashine Maschinenperiode Maschinenprogramm Maschinenprogramm Maschinenprogramm Maschinenprogrammierung Maschinenrüstzeit Maschinensignal Maschinenspeicherplatz Maschinensprache Maschinenstillstandszeit Maschinensystem Maschinentoleranz maschinentypunabhängige Schnittstelle maschinenunabhängiges Interface Maschinenversion Maschinenwirkzeit Maschinenwort Maschinenwort Maschinenzeit Maschinenzeit Maschineprüfung maskierbare Unterbrechung Masseänderung Masseausgleich der Armglieder Massenabtastung Massendatenverarbeitung Massendatenverarbeitung Massenkraft Massenkraft Massenspeicher für Fertigung Massenspektrografie mit Lasersonde Massenspektrometer mit Vakuumschleuse massenspektrometrische Analyse Massenverarbeitung Maßnahme bei Fehlerbedingung Maßstab Maßstabänderung Masterarm Mastergerät Mastergerät Masterrechner (eines Roboterantriebs) Masterroboterarm Master‐Slave‐Betrieb Master‐Slave‐Manipulator Master‐Slave‐Manipulatorsystem Master‐Slave‐Programmierung machine automation machine condition machine instruction machine load machine loading machine representation machine defect analysis machine defect effect functional circuit of machine machine rack, machine frame machine equation computer equation machine‐integrated field of instrumentation machine‐integrated field of instrumentation integrated machine manipulator integrated machine robot machine representation machine‐code compatible instruction set machine configuration machine coordinate system machine logic machine logic design machine zero point machine operation machine order machine‐oriented machine‐oriented geometry language machine‐oriented geometry language machine‐oriented testing service program machine‐oriented testing service program machine cycle computer routine machine program machine routine macroprogramming machine set‐up time machine signal auxiliary storage location of IR machine language machine down‐time machine system machine allowance machine‐independent interface machine‐independent interface machine version machine‐available time computer word machine word computer time machine time machine check maskable interrupt change of mass mass compensation of arm elements mass scanning bulk data processing bulk data processing, BDP mass force force of inertia manufacturing mass memory laser probe mass spectrography mass spectrometer with vacuum lock mass spectrometric analysis bulk processing action in error condition scale scaling master robot arm master device master master computer (of robot drive) master robot arm master‐slave mode master‐slave manipulator master‐slave manipulator system master‐slave programming stran 168 od 326 EN ‐DE: slovar avtomatizacije in robotike Master‐Slave‐System Master‐Slice‐Entwurf Mastersynchronimpuls Matchbytespezifizierung Materialabführung Materialhandhabung Materialzuführungskontrolle Materialzuführungsroboter mathematische Annäherung mathematische Approximation mathematische Berechnungen mathematische Erwartung mathematische Grundlage mathematische Logik mathematische Maschine mathematische Modellbildung mathematische Modellierung mathematische Operation mit pneumatischen Signalen mathematische Statistik mathematische Struktur mathematische Subroutinen mathematische Teilprogramme mathematischer Algorithmus mathematisches Manipulatormodell mathematisches Modell mathematisches Robotermodell Matrix Matrixanalysis Matrixanordnung Matrixarithmetik Matrixdarstellung Matrixdarstellung Matrix‐e‐Funktion Matrixelement Matrixentzifferer Matrixkodierschaltung Matrixmethode Matrixschreibweise Matrixschreibweise Matrixsensor Matrixspeicher Matrixspeicher Matrixtransformation Matrixzenfermesssystem Matrizenauswertung Matrizenexponentialfunktion Matrizenmultiplikation Matrizenschreibweise Matrizenschreibweise der Effektorbewegung MAX‐Average‐Produkt (arithmetischer Mittelwert) maximal zulässige Bestrahlungswerte Maximalausschalter maximale Achsgeschwindigkeit maximale Armverschiebung maximale Ausgangsleistung maximale Beschickungsmenge maximale Fehlerdiagnostik maximale Fügezeit eines Roboters maximale Höhe maximale Kommandozahl maximale Lastaufnahme maximale Permeabilität maximale spektrale Empfindlichkeit maximale Verschiebegeschwindigkeit maximale Zählgeschwindigkeit maximaler Ausgangsstrom maximaler Einstellstrom des Einschaltrelais Maximalprinzip Maximalprinzip Maximalskalenwert maximieren Maximum Maximum auf dem Rande eines Intervalls Maximum‐Mittelwert‐Methode Maximum‐Mittelwert‐Methode Maximum‐Mittelwert‐Methode master‐slave system master‐slice design master synchronizing pulse match byte specification material unloading material manipulation, material handling material feeding checking] material feeding robot mathematical approximation mathematical approximation mathematical calculations mathematical expectation mathematical fundamental mathematical logic mathematical machine mathematical modeling mathematical simulation mathematical operation with pneumatic signals mathematical statistics mathematical structure mathematical subroutines mathematical subroutines mathematical algorithm mathematical manipulator model mathematical model mathematical robot model matrix matrix analysis matrix arrangement matrix arithmetic matrix representation matrix notation matrix exponential matrix element matrix decoder matrix encoder matrix method matrix representation matrix notation matrix sensor (transmitter) matrix memory matrix store matrix transformation matrix telemetering system matrix evaluation matrix exponential function multiplication of matrix notation of matrix matrix notation of effector movement max‐average composition maximum permissible exposure values maximum cut‐out maximum axle speed maximum arm shifting, maximum arm shift maximum output maximum load capacity maximum error diagnostic maximum joint time of robot, maximum jointing time of robot height defuzzification maximum number of command maximum load bearing capacity maximum permeability peak spectral [threshpld] sensitivity maximum shifting speed maximum counting speed maximum output current maximum current setting of starting relay maximum principle Pontrjagin maximum principle maximum scale value maximize v maximum boundary maximum mean of maximum (MOM) mean of maximum (MOM) defuzzification middle of maxima defuzzification stran 169 od 326 EN ‐DE: slovar avtomatizacije in robotike Maximum‐Operation maximum function Maximumverbrauchszähler maximum demand indicator MAX‐MIN‐Inferenz Mamdani inference MAX‐MIN‐Inferenz max‐min inference max‐min composition MAX‐MIN‐Komposition (‐Produkt,‐Verkettung) aggregation operator MAX‐oder SUM‐Operator aggregator MAX‐oder SUM‐Operator MAX‐PROD Verkettung) max‐prod composition MAX‐PROD‐Inferenz max‐dot inference MAX‐PROD‐Inferenz max‐prod inference max‐dot composition MAX‐PROD‐Komposition max‐prod composition MAX‐PROD‐Komposition max‐prod composition MAX‐PROD‐Komposition (MAX‐PROD‐Produkt MAX‐PROD‐Produkt max‐dot composition MAX‐PROD‐Produkt max‐prod composition max‐dot composition MAX‐PROD‐Verkettung max‐prod composition MAX‐PROD‐Verkettung Maxwell‐Körper Maxwell element Maxwellsche Gleichung Maxwell equation Maxwell element Maxwellsches Element MB megabyte MB MB Mechanik Newtonian fluid mechanics Mechanik der Energieübertragung energy transfer mechanics mechanisch gekoppelt mechanically coupled mechanische Abweichung des Manipulatorarms mechanical deviation of manipulator arm mechanische Baugruppe mechanical assembly mechanische Baugruppen eines Roboters mechanical subassemblies of robot mechanical movement unit, mechanical motion unit mechanische Bewegungseinheit mechanical movement unit mechanische Bewegungseinheit mechanical motion unit mechanische Bewegungseinheit mechanische Elektromotorenkennlinien electric motor mechanical characteristics mechanische Endlagensicherung mechanical limit fuse mechanische Fernlenkung mechanical remote control mechanical remote control mechanische Fernsteuerung mechanische Festigkeit mechanical strength mechanical gripper flexibility mechanische Greiferflexibilität mechanische IR‐Steuerung mechanical robot control, mechanical IR control mechanische Manipulatorenergie mechanical manipulator energy mechanische Manipulatorenergie (Energie eines Manipulatorsmechanical manipulator energy mechanische Messung mechanical measurement mechanische Montage mechanical assembly mechanische Nulleinstellung mechanical zero setting mechanische Produktionstechnik mechanical production engineering mechanische Prüfung mechanical check[ing] mechanische Roboterkupplung mechanical robot coupling mechanische Robotermontage mechanical robot assembly mechanische Robotersteuerung mechanical robot control, mechanical IR control mechanische Schalteranordnung mechanical switch arrangement mechanische Sperrung mechanical interlocking mechanische Spezifikation mechanical specifications mechanische Teile mechanical components mechanische Teilebearbeitung mechanical parts machining mechanische Verriegelung mechanical interlocking mechanische vollautomatische Produktion mechanical full‐automatic production mechanisch‐elektrischer Sensor (Wandler) mechanical‐electrical sensor mechanisch‐elektrischer Wandler mechanical‐electrical sensor mechanischer Analysator mechanical analyzer mechanischer Antrieb mechanical drive mechanischer Aufbau mechanical design mechanischer Außengreifer mechanical external gripper mechanischer Fingergreifer mechanical finger gripper mechanischer Greiferaufwand mechanical gripper expense mechanischer Greiferfinger mechanical grip finger mechanischer Greiferparameter mechanical gripper parameter mechanischer optischer Schalter mechanical optical switch mechanischer Programmierer mechanical programmer mechanischer Roboterentwurf mechanical robot design mechanischer Roboterfinger mechanical robot finger mechanischer Sensor mechanical sensor mechanical overload protection mechanischer Überlastschutz mechanischer Verstärker mechanical amplifier mechanischer Wirkungsgrad mechanical efficiency mechanisches Digitaluhranzeigesystem mechanical digital clock display system mechanisches Folgesystem mechanical servosystem mechanisches Montagewerkzeug mechanical assembly tool stran 170 od 326 EN ‐DE: slovar avtomatizacije in robotike mechanisches Netzwerk mechanical network mechanisches Ordnungsprinzip mechanical order principle mechanisches Ordnungsprinzip mechanical order principle mechanisches Robotergetriebe mechanical robot gear mechanisches Robotermodell mechanical robot model mechanisierte Kassettenbeschickung mechanized charging of cassettes mechanisierte Leitung mechanized direction mechanisierte Verwaltung mechanized direction Mechanisierung mechanization Mechanisierungsgrad order of mechanization, automatization Mechanisierungsgrad der Montage mechanization order of assembly Mechanismus laser‐linewidth determining mechanism mechanism of pincer Mechanismus der Zangengreifeinheit Mechanismusstruktur mechanism structure mechanochemische Einwirkung mechanochemical effect mechanochemischer Effekt mechanochemical effect mechatronischer Roboter mecatronical robot, mecatronic = mechatronisch medizinische Robotertechnik medical robot technique, medical robotics Megabit megabit Megabyte megabyte Megabyte MB Mehgruppentheorie multigroupe multigroup theory Mehrachsenbahnsteuerung multiaxis path control Multi‐axis path control Mehrachsenbahnsteuerung Mehrachsensensor Multi‐axis sensor mehrachsige Bahnbewegung multi‐axle orbital motion Mehradressbefehl multiaddress instruction Mehradresskode multiaddress code mehrdeutige Funktion ambiguous function mehrdeutige Koordinatentransformation ambiguous coordinate transformation Mehrdeutigkeit der Relaiskennlinie ambiguity of relay characteristic Mehrdeutigkeitsdiagramm ambiguity diagram mehrdimensional multidimensional mehrdimensional nachgiebiges Werkzeug n. Compliance‐Wer Multi‐dimensional elastic tool, compliance tool mehrdimensionale multiparameter analysis mehrdimensionale multidimensional analysis mehrdimensionales aktives Robotergelenk multidimensional active robot joint mehrdimensionales Bewertungssystem dimensions multidimensional evaluation system mehrdimensionales Maximierungsproblem multidimensional maximization problem mehrdimensionales Optimierungsproblem multidimensional maximization problem multiple‐plane interrupt control Mehrebenen‐ Unterbrechersteuerung Mehrebenen‐ Unterbrechungen multi[ple‐]level interrupts Mehrebenen‐Interrupts multi[ple‐]level interrupts multiple‐plane interrupt control Mehrebeneninterruptsteuerung multiple‐plane interrupt control Mehrebenen‐Interruptsteuerung Mehrebenenoptimierung multilevel optimization Mehrelementdetektor multielement detector Mehrelementlaser many‐element laser multiplexing Mehrfachausnutzung Mehrfachbedingung compound condition Mehrfachbindung multiple bound mehrfache Ableitung multiple derivative mehrfache Ablenkung multiple deflection multiple precision mehrfache Genauigkeit mehrfache Resonanz multiple resonance multiple input selection logic Mehrfacheingabeauswahllogik Mehrfachelektrodenautomat automatic multiple‐electrode machine mehrfacher Regelkreis multiple‐loop servomechanism mehrfacher Regelkreis control of many‐variable system Mehrfacherregung multiple excitation mehrfaches Roboterfügen (Fügen mittels Industrieroboters) multiple robot jointing Mehrfachgreifer multiple gripper (gripping device) Mehrfachimpulsregler multipulse controller Mehrfachkoppler multiplexer Mehrfachkreis multiple circuit Mehrfachpegel‐Fernmeldesystem multiples multilevel communication system Mehrfachpositionsschalter multiposition switch Mehrfachprogrammierung multiprogrammation multiprogramming Mehrfachquelle multiple source Mehrfachresonanz multiple resonance Mehrfachsensor multisensor multicontroller Mehrfachsteuereinheit Mehrfachverarbeitung multiprocessing Mehrfachverdampfer multiple effect evaporator mehrfachwirkender Regler multiple‐action controller Mehrfachzugriff‐Online‐System multiaccess online system stran 171 od 326 EN ‐DE: slovar avtomatizacije in robotike Mehrfachzugriff‐Online‐System Mehrfingergreifer Mehrfunktionsgreifer mehrgelenkiger Roboterfinger mehrgliedriger Dreifinger Mehrgrößenregelungssystem Mehrgrößensystem Mehrgrößensystem Mehrgruppenapproximation Mehrgruppenmodell Mehrheitslogik Mehrkanal‐Datenerfassungsgerät multiples Mehrkanaldekodierer Mehrkanalgerät Mehrkanalkommunikationssystem multiples Mehrkanalmessverstärker multiples Mehrkanalregler Mehrkanalstreuung Mehrkanalverstärker Mehrkapazitätsregelsystem multiples Mehrkoordinaten‐Ausrüstung Mehrkoordinaten‐Ausrüstung Mehrkoordinaten‐Manipulator Mehrkoordinaten‐Manipulator Mehrkörperkraft Mehrkörperproblem Mehrkörpersystem Mehrkreisregelungssystem mehrkriterielle Optimierung Mehrlagenf multicouche Mehrlaufregelung Mehrlaufregler Mehrleitungf multiligne Mehrleitungsterminal Mehrmaschinenbeschickung Mehrmodenverhalten Mehrmodusbetrieb Mehrniveauanalyse Mehrparameteranalyse Mehrparameteranalyse Mehrparameterregelkreis Mehrperiodenbetriebszustand mehrperiodischer Betriebszustand Mehrphasenstrom Mehrphasentrenneinrichtung mehrpolige Schaltverbindung von Relaiskreisen Mehrprozessor Mehrprozessoreinsatz Mehrprozessorsteuersystem Mehrprozessorsystem Mehrpunktgeber Mehrpunktglied Mehrpunktregler Mehrpunktregler Mehrpunktregler Mehrpunktsignal Mehrpunktverhalten Mehrpunktverhalten Mehrrechnersystem Mehrrechnersystem Mehrrobotereinsatz Mehrrobotersystem Mehrschicht‐ Mehrschichteninterferenzfilter mehrschichtig Mehrschichtkoppler Mehrschichtstruktur Mehrschleifenimpulssystem Mehrschleifensystem mehrschleifiger Regelkreis mehrschleifiger Regelkreis mehrschleifiges Folgesystem Mehrstationenmaschinen Mehrstellenmessgerät Mehrstrahloszilloskop Mehrstrahlquelle Multi‐access on‐line system, MAOS Multi‐finger gripper multifunction gripper multi‐jointed robot finger multi‐linked trifinger multidimensional system multiple‐input multiple‐output system,, MIMO‐System multivariable system multigroup approximation multigroup model majority logic multiple‐channel data asquisition device all‐channel decoder multiplexing equipment multichannel communication system multichannel measuring point amplifier multichannel controller multichannel scattering multichannel amplifier multicapacity control system multicoordinate equipment multi‐coordinate equipment multicoordinate manipulator multi‐coordinate manipulator multi‐body force multi‐body problem multi‐body system [of robot] multiloop control system polyoptimization multilayer multispeed floating control multispeed controller multiline multiline terminal multi‐machine loading multimode behaviour multimode operation multilevel analysis multiparameter analysis multidimensional analysis multiparameter control circuit multiperiodic regime multiperiodic regime polyphase current multiphase contactor multipole relay circuit connection multiprocessor multiprocessor application multiprocessor control system multiprocessor system multipoint sensor multiposition element multilevel controller multiposition controller multistep controller (US) multiposition signal multilevel action multistep action (US) multicomputer system multi‐computer system multi‐robot application multi‐robot system multilayer multilayer interference filter multilayer multilayer[ed] coupler multilayer[ed] structure multiloop pulse system multiloop system multiple‐loop servomechanism control of many‐variable system multiloop servosystem multiple‐station machines multipoint measuring instrument multibeam oscilloscope multi[ple ]beam source stran 172 od 326 EN ‐DE: slovar avtomatizacije in robotike Mehrstufenzylinder multistage cylinder mehrstufig multistage mehrstufige Programmunterbrechung multilevel interrupt mehrstufige Robotermontage multistage robot assembly multistage separation mehrstufige Trennung mehrstufiger Entscheidungsprozess multistage allocation process mehrstufiger Servomechanismus multicascade servomechanism mehrstufiger Speicher multilevel storage mehrstufiger Verstärker cascade amplifier mehrteilig complex Mehrvariablensystem many‐variable system Mehrwegübertragung multipath transmission mehrwertig many‐valued mehrwertige Logik multiple‐valued logic mehrwertige Logik many‐valued logic Mehrwortbefehl multiple‐word instruction Mehrzweckanlage multiple‐purpose plant Mehrzweckanlage multipurpose plant Mehrzweckautomat multipurpose automatic device Mehrzweckautomat universal automaton Mehrzweckautomat [für Montage] general‐purpose automatic machine [for assembly] Mehrzweckautomat [für Montage] general‐purpose automatic machine [for assembly], general‐p multifunction unit Mehrzweckeinheit Mehrzweckforschungsreaktor multipurpose research reactor Mehrzweckmesser all‐purpose meter Mehrzweckmesser multimeter Mehrzweckradar general‐purpose radar Mehrzweckroboter general‐purpose robot Melderelais annunciator relay Melderelais indicating relay Melderelais indicator relay Meldung message Meldung notice Member member Member element Membranantrieb diaphragm actuator Membranantrieb diaphragm drive Membrane diaphragm Membrangreifer membrane gripper Membranlagerung membrane support Membranstellmotor diaphragm servomotor Membranventil membrane valve Memistor memistor set Menge Menge von Zeichen alphabet Mengenfließbild quantity flow‐sheet Mengenfließschema mass flow‐sheet Mengenmesser mass flowmeter set operator Mengenoperator Mengenregelung quantity control Mengenregler quantity controller menschliche Objektfixierung Hybridrechner human object fixing Mensch‐Maschine‐Kommunikation man‐machine communication, MMC Mensch‐Maschine‐Kommunikation fin der Robotertechnik (Roman‐machine communication in robotics Mensch‐Maschine‐Schnittstelle man‐machine interface Mensch‐Maschine‐System man‐machine system Mensch‐Roboter‐Dialog man robot dialogue Merkmal feature Merkmalsextraktion extraction of mark Merkmalsraum zone of flag Messanlage measuring installation measuring instrument Messapparat Messapparat measuring means measuring apparatus Messapparat measuring equipment Messausrüstung messbar measurable messbare Roboterkraft measurable robot force Messbarkeit measurability Messbedingungen conditions of measurement Messbereich instrument range Messbereich measuring range Messblende measuring diaphragm Messblende orifice plate measuring block Messblock Messbrücke measuring bridge Messbrückenrückkopplung bridge feedback stran 173 od 326 EN ‐DE: slovar avtomatizacije in robotike Messdrahtregler Messeinrichtung Messen der Phasenwinkelschwankungen Messen des Luftdurchflusses messender Sensor Messfehler Messfühler Messgenauigkeit Messgenauigkeit Messgenauigkeit Messgenauigkeit Messgenauigkeit Messgerät mit digitaler Anzeige Messgerät mit mehreren Messbereichen Messgeräteausstattung Messgerätekonstante Messgerätekorrektur Messgeräteprogrammierbarkeit Messgerätgüte Messgrenze Messgröße Messgrößenerfassung Messimpuls Messinstrument Messinstrument Messinstrument Messkreis Messminizentrale Messminizentrale Messorgan Messorgan Messorgan Messplatte Messplatz Messposition eines Roboters Messpotentiometer Messpumpe Messpunkt Messroboter Messsicherheit Messsignal Messsignal Messstelle Messstelle Messsystem Messsystemanwendung Messsystemanwendung Messsystemanwendung Messsystemnutzung Messsystemnutzung Messsystemnutzung Messtafel Messtafel Messtafel Messtafel Messtafel für Prüfanlagen Messtechnik Messtisch Messtisch Messtisch Messtisch Messumformer Messumformer Messumformer für Gasanalysatoren Messung Messung der mechanischen Beanspruchung Messung des Phasengangs Messung dynamischer Dehnungsvorgänge Messung mit Mittennullpunkt Messung mittels Sensors Messverfahren Messvorrichtung Messvorrichtung Messvorrichtung Messwähler Messwandler pilot wire regulator measuring device measuring of the phase angle changes air‐flow measurement measuring sensor measuring error detecting element measurement precision measuring accuracy, measuring precision measuring precision measuring accuracy accuracy of measurement measuring instrument with digital indication multirange instrument measuring equipment measuring apparatus constant instrumentation correcting instrument programmability meter quality limit of measurement measured quantity measuring magnitude acquisition measuring impulse measuring instrument measuring means measuring apparatus measuring circuit measuring mini central measuring minicentral measuring instrument measuring means measuring apparatus measuring place measurement setup measuring position of robot measuring potentiometer metering pump measuring point measurement robot measuring safety measured signal measuring signal point of measurement measuring point measuring system application of measuring system, use of measuring system application of measuring system use of measuring system application of measuring system, use of measuring system application of measuring system use of measuring system instrument table test stand test board test table measuring panel for testing installations measuring technique instrument table test stand test board test table measuring transducer measuring transmitter measuring transducer for gas analyzers measurement measurement of mechanical stress phase response measurement dynamic extension measurement centre zero measurement sensor measurement measuring procedure measuring instrument measuring means measuring apparatus test selector instrument transformer stran 174 od 326 EN ‐DE: slovar avtomatizacije in robotike Messwandler Messwandler Messwandler geometrischer Größen Messwerkzeug Messwerkzeugführung Messwert Messwertausgabe Messwerteingabe Messwerterfassung Messwerterfassung Messwerterfassung Messwerterfassung Messwerterfassung Messwerterfassungsgerät Messwertfehler Messwertgeber Messwertgeber mit Digitalausgang Messwertübertragungssystem Messwertverarbeitung Metallamelle Methode Methode der Beschreibungsfunktion Methode der Beschreibungsfunktion Methode der Defuzzifizierungsverfahren Methode der ersten Annäherung Methode der Funktionsbeschreibung Methode der Funktionsbeschreibung Methode der kleinsten Quadrate Methode der kleinsten Quadrate Methode der kleinsten Quadrate Methode der langsam veränderlichen Funktionen Methode der maximalen Höhe Methode der Phasenebene Methode der Phasenebene Methode der Pseudozufallszahlen Methode der Punkttransformation Methode der schrittweisen Annäherung Methode der Störungen Methode der sukzessiven Approximation Methode der Variation der Konstanten Methode der verzögerten Koinzidenz Methode der vollständigen Induktion Methode des energetischen Gleichgewichts Methode des energetischen Gleichgewichts Methode des energetischen Gleichgewichts Methode des kleinen Parameters Methode des kleinen Parameters Methode des steilsten Abstiegs Methode des zusätzlichen Halbschrittes Methode mit alternierender Richtung Methode trapezförmiger Frequenzcharakteristiken Methode von Kochenburger Methode zur Abgrenzung der Stabilitätsbereiche Methode zur logischen Analyse Methoden der Analyse Metrik metrische Information metrischer Raum metrisches System Michailovsches Kriterium Mietleitung Mikrobaueinheit Mikrobefehl Mikrobefehlsregister Mikrobefehlsspeicher Mikrobibliothek Mikroblockbauweise Mikrodiskette Mikroelektronik Mikroelektronikblock Mikroelektronikblock einer Mikroelektronikeinsatz für Roboter mikroelektronischer Digitalisierroboter mikroelektronisches Bauteil mikroelektronisches Sensorprinzip Mikrofertigung measuring transducer transducer electromechanical dimension tranducer measuring instrument measuring instrument guide measuring value output of measured value input of measured value measured value acquisition measuring value acquisition data acquisition data collection measured value logging logger datum error detecting element digital output transducer measuring values transmission system processing of measured data metal lamina method describing function analysis describing function method height defuzzification first approximation method describing function method harmonic balance method least squares method least squares method, LS LS slow‐changing function method max‐height defuzzification phase plane analysis phase plane method pseudorandom number method point mapping method method of successive approximation perturbation method method of successive approximation method of variation of constants delay coincidence method principle of finite induction energetic balance method method of energetic balance power balance method method of small parameter small parameter method method of steepest descent supplementary half‐step method alternating direction method method of trapezoidal frequency responses method of Kochenburger method of determination of stability domains logical method for the analysis analysis procedures metric metric information metric space metric system Michailov criterion leased line microassembly microinstruction microinstruction register microinstruction memory micro‐library microblock design microdiskette microelectronics block of microelectronics block of microelectronics of application of microelectronics for robots microelectronic digitizing robot microelectronic component microelectronic sensor principle microfabrication stran 175 od 326 EN ‐DE: slovar avtomatizacije in robotike Mikrofunktionsbus Mikroherstellung Mikroinformatik Mikroinformatik mikroinformatische Werkzeuge mikroinformatische Werkzeuge Mikrokontrolle Mikrokontrolle Mikrologik Mikrologikschaltung Mikrolotung Mikromanipulator Mikromanipulator‐Roboter Mikrominiaturisierung Mikromodul Mikromodultechnik Mikromontagetechnik Mikromontagetechnik microassemblage Mikromontagetechnik microassemblage Mikrooperation Mikroprogramm Mikroprogrammauswahl Mikroprogrammemulation mikroprogrammgesteuertes Automatiksystem mikroprogrammgesteuertes Robotersystem Mikroprogrammierbarkeit mikroprogrammierte Emulation Mikroprogrammiertechniken Mikroprogrammierung Mikroprogrammlogik Mikroprogrammspeicheradresse Mikroprogrammsteuereinheit Mikroprogrammsteuereinheit microprogrammes Mikroprogramm‐Steueroperation microprogramme Mikroprogrammsteuerschaltkreis Mikroprogrammsteuerschaltkreis Mikroprogramm‐Steuerspeicher Mikroprogrammsteuerung Mikroprogrammsteuerung Mikroprogrammsteuerwerk Mikroprozessor Mikroprozessor eines Industrieroboters Mikroprozessor‐Analysator Mikroprozessoranwendung Mikroprozessor‐Ausbildungssystem mikroprozessorbestückte Steuerung mikroprozessorbestücktes Produkt Mikroprozessor‐Entwicklungssystem microprocesseur Mikroprozessorentwurf Mikroprozessorfunktion mikroprozessorgesteuerte Messtechnik mikroprozessorgesteuerte Messtechnik microprocesseurs mikroprozessorgesteuerter Bohrroboter (für Leiterplatten) mikroprozessorgesteuerter Feinmanipulator mikroprozessorgesteuerter Manipulator mikroprozessorgesteuerter Roboter mikroprozessorgesteuertes Europakartensystem mikroprozessorgesteuertes Modem mikroprozessorgesteuertes System mikroprozessorgesteuertes Terminal Mikroprozessor‐Hardware Mikroprozessornachbildner Mikroprozessornetz Mikroprozessorsimulator Mikroprozessorsoftware Mikroprozessorsteckeinheitensystem Mikroprozessorsteuersystem Mikroprozessorsteuerung eines IR Mikroprozessorsystem mit Mikroprozessorsystem mit verteilter Intelligenz Mikroprozessortechnik Mikroprozessortechnologie Mikrorechner mikrorechnergesteuerte Fehlermessung mikrorechnergesteuerte Feinpositionierung mikrorechnergesteuerte Fügebewegung micro‐function bus microfabrication microinformatics Microinformatics, micro informatics microinformatic tools microinformatic tools, micro informatic microchecking micro‐checking micrologic micrologic circuit micro sounding micromanipulator Micro‐handler robot microminiaturization micromodule micromodule technique micro‐mounting technique, micro‐assemblage technique micro‐mounting technique microassemblage technique microoperation microprogram microprogram selection microprogram emulation microprogram‐controlled automatic system microprogram‐controlled robot system microprogrammability microprogram emulation microprogramming techniques microprogramming microprogram logic microprogram memory (store) address microprogram control unit microprogram control unit microprogram control operation microprogram control circuit microprogram control circuit, microprogram control switchin microprogram control memory microprogram control microprogrammed control microprogram control unit microprocessor microprocessor of [industrial] robot microprocessor analyzer microprocessor application microprocessor education system microprocessor‐based control microprocessor‐based product microprocessor development system microprocessor design microprocessor function microprocessor‐controlled measuring technique microprocessor‐controlled measuring technique microprocessor‐controlled drill robot (for printed‐circuit boar microprocessor‐controlled fine manipulator microprocessor‐controlled manipulator microprocessor‐controlled robot microprocessor‐controlled European card system microcontrolled modem microprocessor‐piloted system microprocessor‐controlled terminal microprocessor hardware microprocessor simulator microprocessor net microprocessor simulator microprocessor software microprocessor card system microprocessor control system microprocessor control of industrial robot microprocessor card system distributed‐intelligence microprocessor system microprocessor engineering microprocessor technology microcomputer microcomputer‐controlled error measurement microcomputer‐controlled fine positioning microcomputer‐controlled joint movement stran 176 od 326 EN ‐DE: slovar avtomatizacije in robotike mikrorechnergesteuerte Fügebewegung mikrorechnergesteuerte Greifkraftbegrenzung mikrorechnergesteuerte Messeinrichtung mikrorechnergesteuerter Digitalisierroboter mikrorechnergesteuerter Industrieroboter mikrorechnergesteuerter Kleinmanipulator mikrorechnergesteuerter Manipulator mikrorechnergesteuerter Montagekopf mikrorechnergesteuerter Roboter mikrorechnergestützte Roboterkoordinatenberechnung mikrorechnergestützte Robotermatrizenauswertung mikrorechnerorientierte Automatisierung mikrorechnerorientierte Prozesseinrichtung Mikrorechnerprogrammentwicklung Mikrorechnersoftware Mikrorechnersoftware für Roboter Mikrorechnersoftwareprojekt Mikrorechnersteuerung Mikrorechnersteuerung eines Montagekopfes Mikroroboter Mikroroboter) mit fünf Freiheitsgraden Mikroschaltung Mikroschaltungstechnik Mikroschaltungstechnik Mikrosekunde Mikrosteuergerät Mikrosynchronisation Mikroverarbeitung Mikroverformung Mikroverstellvorrichtung Mikrowellenrefraktometer Mikrowellenspektroskopie Mikrowellenübertragung Milieu Milieu Minderung der Übertragungsgüte durch Verzerrung Mindestabstand Mindestbelastung Mindestbelastung Mindestleistung Mindestspannung Mindeststabilität Mindestwertpunkt Mindestzeit Mindestzündenergie miniaturisierte Automation Miniaturisierung Miniaturisierung Miniaturlaser Miniaturschalter Minim[is]ierung Minim[is]ierung Minimalabweichung Minimalausrüstung minimale Abweichung minimale Einfangzeit minimale Freiheitsgradezahl minimale Temperaturdifferenz minimales feststellbares Signal Minimalglied einer logischen Funktion Minimalisierung Minimalisierung Minimalphasensystem Minimalphasenverschiebungssystem n Minimaxverfahren minimieren Minimierung des Greiferwechsels Minimisierung des mittleren Fehlerquadrats Minimisierungsmethode Minimontagetechnik Minimontagetechnik miniassemblage Minimontagetechnik miniassemblage Minimum Minimum auf dem Rande eines Intervalls Minimum des mittleren quadratischen Fehlers Minimum‐Operation microcomputer‐controlled joint[ing] movement microcomputer‐controlled limitation of grip power microcomputer‐controlled measuring device microcomputer‐controlled digitizing robot microcomputer‐controlled industrial robot microcomputer‐controlled miniature manipulator microcomputer‐controlled manipulator microcomputer‐controlled assembly head microcomputer‐controlled robot microcomputer‐aided robot coordinate calculation microcomputer‐aided matrix evaluation of robot microcomputer‐oriented automation microcomputer‐oriented process device microcomputer program development microcomputer software microcomputer software for robots software project of microcomputer microcomputer control microcomputer control of assembly head microrobot microrobot with five degrees of freedom microcircuit microcircuit technique microcircuit engineering microsecond microcontroller microsynchronization microprocessing microdeformation microadjuster microwave refractometer microwave spectroscopy microwave transmission environment environs distortion transmission impairment minimum distance minimum capacity minimum charge minimum efficiency minimum voltage minimum stability minimum point minimum time minimum ignition energy miniaturized automation miniaturization miniaturizing miniature laser microswitch minimization minimizing minimum deviation minimum configuration minimum deviation minimum time to capture minimal degree of freedom number minimum temperature difference minimum detectable signal logical function minimal member minimization minimizing minimum‐phase system minimum phase‐shift system minimax strategy minimize v gripper change minimizing minimization of integral squared error minimizing method mini mounting technique, miniassemblage technique minimounting technique miniassemblage technique minimum boundary minimum mean square error minimum minimum function stran 177 od 326 EN ‐DE: slovar avtomatizacije in robotike Minirechner mit 32‐bit‐Wortlänge Miniroboter Miniroboterherstellung MIN‐MAX‐Komposition Minorität mischen mischen mischen Mischen von elektrischen Analogsignalen Mischer Mischgaslinse Mischkreis Mischsteilheit Mischstufe Mischtechnik Mischungsanalysator mit aktiver Kopplung mit ODER verknüpfte Regeln mit phasenstarrer Kopplung mit Rauschen mit Servomotor miteinbegriffen miteinbegriffen mitgeschleppter Fehler mitlaufend mitlaufende Diagnose mitlaufende Testung Mitnahmebedingungen Mitnahmefrequenz Mitnehmerband Mitnehmerfunktionskriterien Mitphasensystemrelais positive de la phase Mitte eines Greifbackens Mitteilung Mitteilung Mitteilungstransfersystem Mittelabweichung Mittelerwartungswert mittelnder Operator Mittelpunktstemperatur Mittelrauschen mittelschnelle Datenübertragung mittelschnelle Leitung Mittelstellung Mittelverstärker Mittelwert Mittelwert Mittelwert des Rauschens Mittelwertanzeiger Mittelwertanzeiger Mittelwert‐Operator Mittelwertspannungsmesser Mittelwertvoltmeter mittlere Abweichung mittlere Abweichung variation mittlere Anregungsenergie mittlere Ausführungszeit mittlere Impulsleistung mittlere Ist‐Bahn eines IR mittlere Komplexität mittlere Leistung mittlere Leistung mittlere Operation mittlere optische Leistung mittlere quadratische Abweichung mittlere quadratische Abweichung mittlere Rechengeschwindigkeit mittlere Reparaturzeit mittlere Robotergeschwindigkeit mittlere spezifische Leistung mittlere spezifische Leistung mittlere spezifische Leistung mittlere spezifische Leistung mittlere spezifische Leistung mittlere störungsfreie Zeit mittlere störungsfreie Zeit minicomputer of 32‐bit word length miniature robot, miniature industrial robot, minirobot manufacture of micro robots min‐max composition minority blend v mix v mingle v mixing of electric analog signals mixer gas mixture lens mixing circuit conversion transconductance mixing stage merged technology mixture analyzer actively coupled disjunctive rules phase‐locked noisy servo‐driven implicit implied inherited error online online diagnostics concurrent testing capture conditions pull‐in frequency band of entrainment driver function criteria positive‐phase sequence relay centre of grip jaw message notice message transfer system average deviation expected average value averaging operator central temperature average noise medium‐speed data transmission medium‐speed line intermediate position intermediate amplifier average average value average noise average value pulse indicator mean‐pulse indicator averaging operator average voltmeter average voltmeter average deviation mean deviation average excitation energy average execution time average impulse power mean actual path of IR medium complexity mean power average power average operation average optical power mean square deviation standard deviation average calculating speed mean repair time mean robot speed average fuel rating average intensity angle‐integrated intensity mean fuel rating average specific power mean time between failures mean time between failures, MTBF stran 178 od 326 EN ‐DE: slovar avtomatizacije in robotike mittlere Stromaufnahme mittlere Trägheitsachse mittlere Übertragungsgeschwindigkeit mittlere Wahrscheinlichkeit mittlere Wartezeit mittlere Wartungszeit mittlere Winkelgeschwindigkeit mittlere Zugriffszeit mittlerer mittlerer Ausfallabstand mittlerer Ausfallabstand mittlerer Fehler mittlerer quadratischer Fehler mittlerer Verstärkungskoeffizient mittleres Infrarot mittleres Quadrat der Intensitätsschwankung mittleres quadratisches Fehlermoment Mitziehfrequenz ML (von IBM) Mnemokode Mnemonik Mnemonikplan mnemonische Abkürzung mnemonischer Befehlskode mnemonischer Kode mobiler Manipulator mobiles (bewegliches) Objekt mobiles Hindernis (im Roboterarbeitsraum) mobiles Manipulatorgestell Modell Modell eines Nachrichtenübertragungsprozesses Modell mit gleitendender Mittelwertbildung Modell mit gleitender Mittelwertbildung Modell mit gleitender Mittelwertbildung Modellanlage Modellanlage Modellblockspeicher Modellentwicklung Modellerkennung Modellermittlung Modellermittlung Modellexperiment Modellexperiment Modellierung Modellierung der Verfahrenssteuerung Modellierung eines Industrieroboters Modellierung kontinuierlicher Mehrfachsysteme Modellierung logischer Operationen Modellierung von Impulssystemen Modellmaßstab Modellparameter Modellprojektierung Modelltheorie Modellvereinfachung Modellversuch Modellversuch Modem Modem Modem‐Steuerung Modenberechnung moderne Datenorganisation moderne Datenorganisation moderne Informationsverarbeitung moderne Kommunikationstechnik moderne Kommunikationstechnik moderne Mikrobausteine moderne Mikrobausteine pl moderne virtuelle Maschine moderner abhängiger Prozessor moderner Nebenprozessor m. moderner Zusatzprozessor" moderner Slave‐Prozessor modernes Betriebssystem modernes Betriebssystem modernes Datenübertragungssteuerverfahren modernes Fernverarbeitungssystem modernes flexibles Fertigungssystem average supply current mean axis of inertia average transfer rate mean probability average waiting time mean time to maintain mean angular velocity average access time average logarithmic energy decrement mean time between failures mean time between failures, MTBF average error mean square error average gain coefficient medium infrared mean square of intensity fluctuation mean square error moment pull‐in frequency manipulator language, ML mnemonic code mnemonic mnemoscheme mnemonic mnemonic code mnemonic code mobile manipulator mobile object mobile obstacle (in operating space of robot) mobile manipulator frame model model of a communication process MA model, moving‐average model MA model moving‐average model pilot plant experimental unit model block memory model development model recognition estimation identification model experiment model test simulation process control simulation robot modeling simulation of continuous multiloop control system simulation of logical operations pulse system simulation model scale model parameter model design model theory model simplification model experiment model test modem modulator‐demodulator modem control calculation of modes advanced data organization advanced data organization, ADO modern information processing advanced communication technology advanced communication technology, ACT advanced micro devices advanced micro devices advanced virtual machine, AVM advanced support processor, ASP, advanced slave processor advanced support processor, ASP, advanced slave processor advanced support processor, ASP, advanced slave processor advanced operating system, AOS advanced operating system advanced data‐communications control procedure advanced teleprocessing system, ATS advanced flexible manufacturing system stran 179 od 326 EN ‐DE: slovar avtomatizacije in robotike modernes Leitungssystem modernes lineares Programmsystem modernes lineares Programmsystem modernes Programmsystem zur linearen Optimierung modernes Programmsystem zur linearen Optimierung modernes Textverwaltungssystem modernes Verwaltungssystem modernisierte Montagestraße Modifikation Modifikation des Steuerprogramms Modifikator Modifikatorregister Modifizierung Modul modular modular aufgebauter Mikroprozessor modulare Bauweise modulare Erweiterung modulare Montagemaschine modulare Programmierung modulare Roboterhardware modulare Robotersoftware modulare Struktur modulare taktile Greifereinheit modulare Verbindungstechnik modularer Entwurf modularer programmierbarer Automat modulares Handhabungsgerät modulares Kontrollsystem modulares Kontrollsystem modulares programmierbares System modulares Robotersystem modulares Speichersystem modulares Steuerungssystem modulares System modulares taktiles Greifersystem modulares taktiles Sensorsystem Modularisierung Modularität Modularsystem Modulation Modulation durch Lichtintensität Modulation mit Trägerwellenunterdrückung Modulationsantwort Modulationsgrad Modulationskennlinie Modulationskontrollgerät Modulationsübertragungsfunktion Modulationsverfahren für die Datenübertragung Modulationswirkunsgrad Modulator Modulator‐Demodulator Modulator‐Demodulator Modulatorsteuersignal Modulbauweise modulbeschränkte Einwirkung Modulierbarkeit modulieren modulierte Größe modulierter Trägerfrequenzkanal modulierter Trägerstromkanal moduliertes monochromatisches Licht moduliertes Signal Modulo‐n‐Kontrolle Modulo‐n‐Prüfung Modulo‐Operation Modulprinzip Modulroboter Modulsteckbaugruppe Modulsystem automatischer Regelung Modulsystemtechnologie Modulübersicht Modulüberwachung Modus Moduswechsel mögliches Ereignis post‐detection gain 494 advanced administrative system, AAS advanced linear programming system advanced linear programming system, ALPS advanced linear programming system advanced linear programming system, ALPS advanced text management system, ATMS advanced administrative system, AAS modernized assembly fine modification modification of control program modificator modifier register modification module modular modulary structurized microprocessor modular construction modular expansion modular assembly machine modular programming modular robot hardware modular robot software modular structure modular tactile gripper unit modular connecting technique modular design modular programmable automaton modular handling system modular check[ing] system modular checking system modular programmable system modular robot system modular memory system modular control system modular system modular tactile gripper system modular tactile sensor system modularization modularity modular system modulation light‐intensity modulation quiescent‐carrier modulation modulation response modulation factor modulation response modulation monitor modulation transfer function modulation technique for data transmission modulation efficiency modulator modem modulator‐demodulator modulator control signal modular concept action limited by absolute value modulation capability modulate v modulating signal modulated carrier channel modulated carrier channel modulated monochromatic light modulating signal modulo‐n check modulo‐n check modulo operation modular principle module robot plug‐in module modular system of automatic control module system technology module map module supervision mode mode change possible event stran 180 od 326 EN ‐DE: slovar avtomatizacije in robotike Molek[ularelek]tronik molecular electronics molekularer Generator molecular generator Moment moment Moment der Zufallsfunktion moment of random function Momentanablesung instantaneous reading momentane Schraubachse momentary screwed axis momentane Störung momentary disturbance Momentanfehler instantaneous error Momentanfrequenz instantaneous frequency Momentanleistung instantaneous power Momentanphasenmesser momentary phase meter Momentanwert instantaneous value Momentanwertumsetzer instantaneous value converter Momentbestimmung moment destination moment reference point Momentbezugspunkt Momenteinschaltung snap closing momentfreies Relaisfolgesystem momentless relay servosystem Momentkennlinie torque characteristics momentloses Relaisfolgesystem momentless relay servosystem Momentüberwachung survey of moments Monitor verifying device Monitor monitor Monitoring‐Verfahren monitoring procedure Monitorinterface monitor interface Monitorprogramm monitor program Monitorsteuerung monitor control monoenergetisches Manipulatorsystem monoenergetic manipulator system monoenergetisches Manipulatorsystem (System eines Manipumonoenergetic manipulator system monolithisch monolithic adj monolithische Schaltung monolithic circuit monolithische Struktur monolithic structure monolithischer Aufbau monolithic structure monolithischer Schaltkreis monolithic circuit monolithischer Taktgenerator monolithic clock generator monolithischer Umsetzer monolithic converter Monolokutor monolocutor Monomodebetrieb single‐mode operation Monomode‐Lichtwellenleitersensor single‐mode optical fiber sensor Monoprozessorsystem monoprocessor system Monopulslidar monopulse lidar monostabile Schaltung monostable circuit monostabiler Multivibrator monostable multivibrator monostabiler Multivibrator one‐shot multivibrator monostabiler Sperrschwinger single‐shot blocking oscillator monoton monotonous monotone Funktion monotonic function monotonous transient response monotoner Übergangsprozess monotoner Vorgang monotonous process Montage installation Montage (durch Roboter) mounting (by robot) Montage einer Baugruppe assembly mounting Montage einer Unterbaugruppe sub‐assembly mounting Montage im Mikrobereich assembly within micro‐range Montage mittels Industrieroboters robot mounting, robot assemblage, industrial robot mounting, Montageablauf assembly sequence, assembly flowing Montageablauf mittels Industrieroboters robot assembly sequence, mounting sequence by means of the Montageabteilung assembly department Montagealternative assembly alternative Montageanweisung fitting instruction, assembly instruction Montagearbeit assembly operation (working) Montagearbeitsplatz montage working station, montage operator position Montageaufgabe assembly task Montageausrüstung assembly equipment Montageautomat assembly automaton Montageautomatisierung (mit Robotern) assembly automation (by robots) Montageband assembly line Montagebasisteil assembly base part Montagebauteil component of assembly Montagebauweise precast construction Montagebedingung assembly condition Montagebefehl assembly instruction Montagebeschreibungsdatei assembly description file Montagebewegung assemblage movement, mounting motion Montagebewegung feines Industrieroboters robot mounting motion, industrial robot mounting motion Montagebewegungslänge assembly movement length Montagebewegungsrichtung assembly movement direction stran 181 od 326 EN ‐DE: slovar avtomatizacije in robotike Montagebewegungszeit Montagebewertung Montagebock Montagedaten pl Montagedokumentation Montageeinheit Montageeinheit Montageeinrichtung Montageeinrichtung Montageeinrichtung montage Montageerfahrung Montagefamilie Montagefolge Montagegraph Montagegreifer Montagegreifer mit elastischen Elementen Montagegreiferbewegung Montagegrundverfahren Montagehalle Montagehaltevorrichtung Montagehauptprogramm Montagehilfe Montagehilfe Montagehinweis Montageindustrieroboter Montagekonzeptuntersuchung Montagekopf eines Montageroboters Montagekosten bei Robotereinsatz Montagekraft Montagekran Montagelage Montageleimung Montagelinie Montagelösung Montagemanipulator Montagemaschine Montagemaschinenkonfiguration Montagemechanisierungsgrad Montagemethode Montagemikrobibliothek Montagemittel Montagemodell Montagemomente Montageobjekt Montageobjektdaten pl Montageoperation Montageoperation eines Industrieroboters Montageoperationsdatei Montageorganisation Montageorganisation für lR Montageperipherie Montageplanung für IR Montageplatte Montageplatz Montageplatzlayout Montagepositionierfehler Montagepositionsfehler Montageprinzip Montageproblem eines Industrieroboters Montageprogramm Montageprojekt Montageprozess Montageprozessbestimmung Montageprozessperipherie Montagepunkt Montagereihenfolge Montageroboter Montageroboter für elektronische Bauelemente Montageroboter mit direkter Steuerung von Werkzeugen Montageroboteranpassung Montageroboterart Montagerobotergruppe Montageroboterhardware Montagerobotersoftware Montageroboterstruktur Montageroboterverhalten assembly movement time assembly valuation assembly stand assembly data erection drawing assembling unit assembly unit assemblage device assembly fixture erecting tool assembly experience assembly family assembly sequence montage graph assembly gripper assembly gripper with elastic elements movement of assembly gripper, motion of assembly gripper basic assembling procedure assembly hall assembly support assembly main program, assembly master routine assemblage device assembly fixture assembly instruction assembly industrial robot assembly draft investigation assembly head of assembly robot robot assembly costs assembly force erection crane assembly position constructional gluing assembly line (automated) assembly solution assembly manipulator assembly machine, mounting machine assembly machine configuration mechanization order of assembly assembly method assembly micro‐library, AML assembly instrument assembly model assembly moments assembly object assembly object data assembly operation, assemblage operation robot assemblage operation, IR assemblage operation assembly operation file assembly organization robot assembly organization assembly periphery robot mounting planning, robot assembly planning mounting plate erection site layout of erection site assembly positioning error assembly position error assembly principle assembly problem of [industrial] robot assembly program erection project assembly process assembly process determination assembly process periphery assembly point assembly sequence mounting robot, assemblage robot, industrial robot for mount assembly robot for electronic components assembly robot with direct control of tools adaptation of assembly robot assembly robot kind assembly robot group assembly robot hardware assembly robot software assembly robot structure, structure of assembly robot assembly robot behaviour stran 182 od 326 EN ‐DE: slovar avtomatizacije in robotike Montageroboter‐Wechselsystem Montageschema Montageschema Montageschraube Montageschwierigkeit Montageschwierigkeit montage Montageschwierigkeit montage Montageschwierigkeitsgrad Montagesensor Montagesimulationsprogramm Montagesimulationsverfahren montagespezifische IR‐Programmierung Montagesprache Assembly Language (Robotersprache) Montagestation Montagestationenlayout Montagesteuersystem Montagesteuersystem Montagestraße f. Montagebahn Montagestückzahl Montagesystem Montagesystem Montagesystem Montagesystem mit Robotern Montagesystemgenerieren Montagesystemnachgiebigkeit Montagesystemparameter Montagetechnik Montagetechnik Montagetechnik montage Montagetechnik montage Montagetechnikmodell Montagetechnologie Montagetechnologie Montagetechnologie Montagetechnologie montagetechnologischer Ablauf montagetechnologisches Prinzip Montageteil Montageteilhandhabung Montageteilhandhabung Montageteilhandhabung Montageteilprozess Montageumdrehoperation Montageuntergruppe Montageunterlagen Montageversuch Montageversuch mit Industrierobotern Montagevorgang Montagevorzugsrichtung Montagewerkzeug Montagezeichnung Montagezeit Montagezelle Montagezentrum Montagezubringervorrichtung Montagezustand eines Roboters (Industrieroboters) Montagezyklus eines Industrieroboters Monte‐Carlo‐Simulation Monte‐Carlo‐Verfahren montieren (durch Roboter) montierte Einzelteile pl montierte Endposition montiertes Bauelement montiertes Kugellager Moore‐Penrose‐Inverse Moore‐Penrose‐Inverse Motor Motor mit regelbarer Drehzahl Motordrehzahlregelung Motorführung Motorführung Motorgeschwindigkeitssteuerung motorgetriebener Roboter Motorimpulssteuerung Motorkompensator mit PID‐Regler PID Motorlebensdauer change system of assembly robot installation diagram installation lay‐out fitting bolt mounting difficulty, assembly difficulty mounting difficulty assembly difficulty difficulty coefficient of assembly assembly sensor assembly simulation program assembly simulation process assembly‐specific IR‐programming assembly language, AL (robot language) assembly station assembly station layout assembly control systems assembly control systems, ACS assembly line assembly number of pieces assembly system, mounting (assemblage) system assembly system mounting system robot assembly system assembly system generation elasticity of assembly system, flexibility of assembly system assembly system parameter assembly technique mounting technique, assemblage technique mounting technique assemblage technique assembly technique model assembling technology mounting technology, assembly technology mounting technology assembly technology technological development of assembly technological principle of assembly assembly part handling of assembly parts, manipulation of assembly parts handling of assembly parts manipulation of assembly parts assembly sub‐process assembly revolution operation sub‐assembly, assembly elements, assembly module assembly documentation assembly test robot assembly test, industrial assembly test assembly process assembly‐preferred direction (of robot) assembly tool assembly drawing erecting time, assembling time assembly cell assembly centre assembly feed device assembly state of [industrial] robot robot assembly cycle, industrial robot mounting cycle Monte‐Carlo modelling Monte‐Carlo techniques mount to (by robot) assembled parts (pieces) assembled end (final) position assembled component assembled ball bearing Moore‐Penrose pseudoinverse pseudoinverse motor change‐speed motor motor speed control motor control engine control motor speed control motor‐driven robot motor pulse control motor compensator with PID regulator working life of motor stran 183 od 326 EN ‐DE: slovar avtomatizacije in robotike Motorsteuerungseinheit Motorversorgungsstrommessung Motorzeitkonstante Multibusfamilie Multibusstruktur multidimensionale Verteilung Multielement‐Aktivierungsanalyse Multielementtrennung Multifunktionsrelais Multigruppenmodell Multigruppennäherung Multigruppentheorie Multikanalbus Multilokutor Multimikroprozessorsystem Multiparameteranalyse Multiparameteranalyse multiplex Multiplexbetrieb Multiplexbetrieb Multiplexeinrichtung Multiplexer Multiplexfernmessverfahren Multiplexierung Multiplexkanalsteuereinheit multiplikatives Gegenstromverfahren Multiplikator Multiplikator Multiplikator Multipliziereinheit f Multipliziereinheit f Multipliziereinheit f Multiplizierer Multiplizierer Multiplizierer Multiplizierschaltung Multiplizität Multiplizitätsfilter Multipositionsschalter Multiprozessor Multiprozessor mit Verbindungskanälen Multiprozessoranwendung Multiprozessorarbeit Multiprozessorbetrieb Multiprozessorsteuersystem Multiprozessorsystem Multipunktsensor Multipunktsteuerung Multipunktsteuerung MP Multisensor Multisoft‐Roboter Multistabilität Multivibrator Muster Mustererkennung Mustererkennungsalgorithmus Musterfunktion Musterfunktion für IR Musterkarte Musterkartenvorbereitung Musterklassifizierung Mustermaske Mustermodell myoelektrisch gesteuerte Roboterhand . myoelektrisches Signal myoelektrisches Signal n n auswechselbarer Greifer n definierte Greiferbahn n definierte Roboterraumbahn n energieunabhängiger Speicher n flexible Handhabetechnik n hydraulische Flüssigkeit n Kontaktkraft n mechanischer Sensor n optischer Inkrementalkodierer (für Roboter) n optisches Zeichenlesen motor control assembly motor supply current measurement motor time constant Multi bus family multiple‐bus structure multidimensional distribution multielement activation analysis multielement separation multifunction relay multigroup model multigroup approximation multigroup theory multichannel bus multilocutor multimicroprocessor system multiparameter analysis multidimensional analysis multiplex multiplex mode multiplexed operation multiplex device multiplexer multiplex telemetering multiplexing multiplexer channel control unit multiplicative counter‐current process multiplier multiplying device multiplying unit multiplier multiplying device multiplying unit multiplier multiplying device multiplying unit multiplication circuit multiplicity multiplicity filter multiposition switch multiprocessor channel‐coupled multiprocessor multiprocessor application multi[ple‐]processor operation multi[ple‐]processor operation multiprocessor control system multiprocessor system multipoint sensor multipoint control multipoint control, MPC, multipoint, MP multisensor multisoft robot multistability multivibrator sample master identification algorithm for pattern recognition pattern function robot pattern function sample card sample card preparation pattern classification pattern mask demonstration model myoelectric‐controlled robot hand myoelectric signal myoelectric signal interchangeable gripper defined gripper path defined robot space path energy‐independent store flexible handling technique hydraulic fluid contact force mechanical sensor optical incremental encoder (for robots) optical character recognition, OCR stran 184 od 326 EN ‐DE: slovar avtomatizacije in robotike n s. C 227 complex environmental acquisition n Schwingbewegung oscillatory motion n stabile Roboterdaten pl stable robot data theory of numerical treatment n Theorie der numerischen Behandlung tool quality checking n Werkzeugqualitätsprüfung nach geschalteter Prozessor back‐end processor, BEP nach visuellen Informationen cording to visual information Nacharbeit patch work Nachbarelement adjacent element Nachbarkanal adjacent channel Nachbarkanalschwebungsfrequenz adjacent‐mode beat frequency Nachbarmodenüberlagerungsfrequenz adjacent‐mode beat frequency Nachbarzustände adjacent states Nachbearbeitung additional treatment Nachbearbeitung subsequenttreatment Nachbehandlung additional treatment Nachbehandlung subsequenttreatment nachbilden simulate v Nachbildung eines kybernetischen Systems simulation of cybernetic system Nachbildung von digitalen Systemen auf einem Rechner computer simulation of digital systems Nacheilungsdarstellung lag representation Nacheilungswinkel lag angle nacheinander sequential nacheinander serial automatic guidance system Nachführautomatik Nachführregelung f(eines IR) master‐and‐slave control (of IR) nachgeschalteter Prozessor back‐end processor nachgiebige Greiferlagerung elastic gripper support nachgiebiges Robotergelenk elastic robot joint Nachgiebigkeit feines Montagesystems elasticity of assembly system, flexibility of assembly system Nachlaufperiode hunting period Nachlaufregelungssystem follow‐up system Nachlaufregelungssystem servosystem Nachlaufverzögerung tracking lag Nachleuchtdauer decay time Nachregelung readjustment Nachricht message Nachricht notice Nachrichtenaufbau information build‐up Nachrichtenbehandlung message handling Nachrichteneinheit information unit Nachrichteneinheit information bit Nachrichtenelement information unit Nachrichtenelement information bit Nachrichtenfernverkehr m remote communications Nachrichtenführung message routing Nachrichtenkanal communication channel Nachrichtenleitung message routing Nachrichtenmittel communication communication medium Nachrichtenpriorität message priority Nachrichtenquelle information transmitter Nachrichtenquelle message source Nachrichtentheorie communication theory Nachrichtenübertragung und Steuerung im Tier und in der Macommunication and control in the animal and in the machine Nachrichtenübertragungsnetz communication network Nachrichtenübertragungsprozess communications communication process Nachrichtenübertragungs‐Steuerprogramm message control program Nachrichtenübertragungssystem message transfer system Nachrichtenverkehrsanwendung communication application Nachrichtenvermittlung message switching Nachrichtenverwaltung message handling Nachschaltprozessor back‐end processor Nachschaltprozessor back‐end processor, BEP Nachspeisung make‐up [feed] Nachstellglied reset component Nachstellwirkung floating action nachweisbar identifiable Nachweisempfindlichkeit detection sensibility Nachweisschwelle detecting threshold Nachweiszeit detection time nahangeordneter Sensor proximity sensor zero (ZO) nahe‐Null (ZE) Näherung approximation Näherungsdetektor proximity detector proximity effect Näherungseffekt approximate design Näherungsentwurf stran 185 od 326 EN ‐DE: slovar avtomatizacije in robotike Näherungsformel Näherungsgleichung Näherungsgröße Näherungsgröße Näherungsintegration Näherungslösung Näherungsmodell eines IR Näherungsrechnung Näherungsrechnung Näherungssensor Näherungssensorsystem Näherungssimulation Näherungsverfahren Näherungswert Näherungswert Nahgeber Nahsensoren Nahtschweißen Nahtschweißmanipulator NAND‐Glied NAND‐Operation NAND‐Schaltung Nanosekunde Nanosekunde Nanosekundenimpulsgenerator nanosecondes Nanovoltzerhacker nanovolts naturgetreue Antwort natürlich natürliche Erregung natürliche Kühlung natürliche Nichtlinearität natürliche Sprache natürliches Ansprechen natürliches Wort Navigation Navigationskommunikation NC‐Bearbeitungsprogramm NC‐Datensicherung NC‐Maschine n‐dimensionaler Spaltenvektor Nebenachse feines IR Nebenanlagen Nebenarbeitsraum eines IR nebeneinandergeschaltet Nebenfunktion nebengeschalteter Regelkreis nebenlaufend Nebenmodulation Nebennichtlinearität Nebenprozessor Nebenprozessor Nebenprozessor Nebensprechmesser Nebenstromkreis Negation negativ (NE) negativ definit negative feedback coupling resistor 426 negative Bahnabweichung negative Beschleunigung negative Impedanz negative Logik negative Rückführung negative Rückführung negative Schaltungslogik negativer Impuls negativer Scheinwiderstand negativer Selbstausgleich negativer Widerstand negativer Wirkwiderstand negatives Phasensequenzrelais negativ‐groß (NG) negativ‐klein (NK) Negativlogikschaltung Negativlogiksignal negativ‐mittel (NM) Negativschaukasten approximate formula approximate equation approximate quantity approximate value approximate integration approximate solution approximation model of IR approximate calculation approximate computation approximation sensor approximation sensor system approximation simulation approximation method approximate quantity approximate value proximity sensor close sensors seam welding seam welding handler (manipulator) NAND‐element NAND‐operation NAND‐circuit nanosecond millimicrosecond nanosecond impulse generator nanovolt chopper natural response natural natural excitation natural cooling natural non‐linearity natural language natural response natural parole navigation navigation communication numerical control processing program, NC‐processing program numerical control data backup numeric controlled machine tool n‐dimensional column vector auxiliary axis of IR off‐sites slave working room of IR parallel‐connected secondary function parallel control loop concurrent spurious modulation intentional non‐linearity support processor, slave processor support processor slave processor cross‐talk meter subcircuit negation negative (N) negative definite negative path deviation negative acceleration negative impedance negative logic degenerative feedback negative feedback negative logic negative pulse negative impedance negative self‐regulation negative resistance negative resistance negative phase sequence relay negative big (NB) negative small (NS) negative‐logic circuit negative‐logic signal negative medium (NM) negatoscope stran 186 od 326 EN ‐DE: slovar avtomatizacije in robotike Negierbefehl negieren Neigungswinkelmesser NEIN‐Schaltung NEIN‐Schaltung Nennabgabe Nennausschaltvermögen Nennbelastung Nennbelastung Nennbereich Nennerpolynom Nennfrequenz Nenngröße Nennlast Nennlebensdauer Nennleistung Nennleistung für Aussetzbetrieb Nennreichweite Nennspannung Nennspannung Nennspannungsbereich Nennstrom Nennumwandlungsverhältnis Nennwert Nennwert Neodym‐Laser Neondigitalanzeige Neondigitaldarstellung Neper Nephelometer nephelometrische Analyse Nernstbrücke Nettoimpulsrate des Kernstrahlungsdetektors netzabhängiger Wechselrichter Netzanschlusswert Netzaufbau Netzausfall Netzcomputer Netzdämpfung Netzdämpfung Netzfrequenz Netzgerät Netzkonstante Netzmodell Netzoptimierung Netzphasenrelais Netzplantechnik Netzregler Netzspannung Netzspannungsregler Netzspannungsregler Netzspannungsschwankungen Netzstabilität Netzstrom Netzstruktur Netzüberwachung Netzwechselspannung Netzwerk Netzwerkanalysator Netzwerkanalyse Netzwerkanalyse Netzwerkanwendung Netzwerkelement Netzwerkelement Netzwerkelement Netzwerkgleichungslöser Netzwerksimulator Netzwerksteuerungssystem Netzwerksynthese Netzwerktheorie Netzwerktopologie Netzwerkübertragungsschaltkreis Netzwerkübertragungsschaltung Neueinstellung neutral gesteuertes Objekt neutrale Zone ignore instruction negate v clinometer NOT‐circuit NOT‐gate nominal output rated breaking capacity rated load nominal load nominal range of use denominator polynomial nominal frequency rated quantity rated capacity rated life nominal output periodic rating nominal range of use rated voltage nominal voltage range of rated voltage rated current nominal transformation ratio nominal value rating neodymium laser neon digital display neon digital display neper nephelometer nephelometric analysis Nernst bridge net pulse rate of nuclear radiation detector dependent inverter mains connection value network configuration power fail[ure] network computer network attenuation network damping power frequency power supply unit network constant network model network optimization network phasing relay network technique voltage regulator line voltage line voltage regulator line variation line voltage fluctuations network stability supply current network configuration net control alternating‐current line voltage network network analyzer circuit analysis network analysis network application circuit element switching element network element network analyzer network analyzer network control system network synthesis network theory network topology network communications circuit network communications circuit reset[ing] neutral‐controlled plant neutral zone stran 187 od 326 EN ‐DE: slovar avtomatizacije in robotike neutrales Relais neutrales System Neutralisation Neutralisieren Neutronenaktivierungsanalyse Neutronengenerator Neutronenimpuls Newtonsche Bewegungsgleichung Newtonsche Strömungsmechanik Newtonsches [Iterations‐] Verfahren nichlineares Entkopplungsverfahren Nichols‐Plan Nichols‐Plan nicht abgestimmte Dämpfung nicht abgestimmte Dämpfung nicht abgewichenes Energieniveau nicht abnehmende Funktion nicht ausfallsichere Betriebsweise nicht behebbarer Fehler nicht beherrsch bare Roboterregelung nicht definierte Robotertrajektorie nicht definierter Arbeitspunkt eines Roboters nicht in der richtigen Reihenfolge nicht steuerbares System nicht umkehrbare Steuerung nicht umkehrbarer Zähler nicht verketteter Manipulator nicht zerstörungsfreie Prüfung nichtadressierbarer Speicherbereich nichtanzeigender Regler nichtäquivalentes Element Nichtäquivalenz nichtarithmetische Operation Nichtauslegungsstörfall Nichtauslegungsunfall nichtautomatisches Ansprechen nichtautomatisiertes Informationssystem nichtbehebbarer Fehler nichtbehebbarer Fehler nichtbeobachtbares System nichtdeterminierter Automat nichtdigitale Information nichtdispersive Spektrometrie nichtdringlicher Alarm nichtdringliches Alarmsignal nichtelektrische Größe NICHT‐Element NICHT‐Element nichtentartetes System nichtetikettiert nichtgeforderte Funktionszeit nichtgerichteter Stromschutz nichtgestörter Wert Nichtgleichgewicht Nichtgleichgewichtszustand nichthomogenes Magnetfeld nichthomogenes Magnetfeld nichtintegrierte Bauweise nichtisotherme Messdaten pl nichtkohärente Detektion nichtkohärentes Empfängersystem nichtkohärentes Signal Nichtkompatibilität nichtkompatibler Mikroprozessor nichtkritische Abmessung nichtkritische Masse nichtkritischer Reaktor nichtlinear nichtlineare Abhängigkeit nichtlineare Dämpfung nichtlineare Differentialgleichung nichtlineare Differentialgleichung nichtlineare dynamische Operation nichtlineare Entkopplungsschaltung nichtlineare Erscheinungen im akustischen Feld nichtlineare Gleichung non‐polarized relay neutral system neutralization neutralization neutron activation analysis neutron generator neutron pulse Newton's motion equation Newtonian fluid mechanics Newton‐Raphson method non‐linear decoupling process Nichols chart Nichols diagram aperiodic damping aperiodic attenuation non‐degenerate energy level non‐decreasing function non‐failsafe mode unrecoverable error non‐controllable robot regulation non‐defined trajectory of robot non‐defined working point of robot out of sequence Uncontrollable system non‐reversible control non‐reversible counter non‐chained manipulator destructive test non ‐addressable memory area, non‐addressable store zone non‐indicating controller non‐equivalence element non‐equivalence non‐arithmetical operation non‐design‐basis accident non‐design‐basis accident non‐automatic tripping non‐automated information system unrecoverable error uncorrectable error unobservable system non‐deterministic automaton non‐digital information non‐dispersive spectrometry non‐urgent alarm non‐urgent alarm non‐electric value NOT‐component NOT‐element non‐degenerate system unlabelled non‐required time non‐directional current protection quiescent value non‐equilibrium non‐equilibrium state inhomogeneous magnetic field nonhomogeneous magnetic field non‐integrated concept non‐isothermal measuring data incoherent detection incoherent reception system incoherent signal incompatibility incompatible microprocessor non‐critical dimension non‐critical mass non‐critical reactor non‐linear non‐linear dependence non‐linear damping nonlinear differential equation non‐linear differential equation non‐linear dynamic operation non‐linear stopper circuit non‐linear effects in acoustical field non‐linear equation stran 188 od 326 EN ‐DE: slovar avtomatizacije in robotike nichtlineare Kopplung nichtlineare Mechanik nichtlineare Modulationskennlinie nichtlineare Optik nichtlineare optische Eigenschaften nichtlineare optische Suszeptibilität nichtlineare optische Wechselwirkung nichtlineare Programmierung nichtlineare Reaktanz nichtlineare Regelung nichtlineare Regelung nichtlineare Roboterbewegungsgleichung nichtlineare Suszeptibilität nichtlineare Transiente nichtlineare Verzerrung nichtlineare Wechselwirkung nichtlinearer Anteil nichtlinearer Anteil nichtlinearer Anteil nichtlinearer Bauteil nichtlinearer Bauteil nichtlinearer Entkopplungsanteil nichtlinearer Funktionsgenerator nichtlinearer Geschwindigkeitsregler nichtlinearer optischer parametrischer Prozess nichtlinearer Umwandler nichtlinearer Verstärker nichtlineares nichtlineares Element nichtlineares Element nichtlineares Element nichtlineares Element mit Begrenzung nichtlineares Element mit eindeutiger Kennlinienfunktion nichtlineares Element mit Hysterese nichtlineares Element mit Lose nichtlineares Element mit mehrdeutiger Kennlinienfunktion nichtlineares Element mit Sättigung nichtlineares Element mit Totzone nichtlineares Element mit zweideutiger Kennlinienfunktion nichtlineares Element mit Zweipunktverhalten nichtlineares Entkopplungsverfahren nichtlineares Filtersystem nichtlineares Glied nichtlineares Glied nichtlineares Regelungssystem nichtlineares Regelungssystem nichtlineares Regelungssystem nichtlineares System nichtlineares System nichtlineares Übertragungsglied Nichtlinearität Nichtlinearität Nichtlinearität als prinzipielle Eigenschaft nichtmanuelle Robotersteuerung nichtmarkiert Nichtmischbarkeitsanalyse Nichtmoderator nichtmodulierte Trägerwelle nichtnormalisierte Darstellung nichtnumerische Punktsteuerung nichtnumerische Steuerung nichtparametrischer Roboteralgorithmus nichtperfekte Kontur nichtperiodische Funktion nichtperiodisches Amperemeter nichtprivilegierter Befehl nichtprogrammierbare Handhabungsgeräte nichtradioaktiver Indikator nichtrealisierter Befehl nichtrelevanter Ausfall Nichtresonanzprozess nichtreziproker parametrischer Verstärker NICHT‐Schaltung NICHT‐Schaltung nichtschwingendes System nichtselektiver pneumatischer Detektor non‐linear coupling non‐linear mechanics non‐linear modulation response non‐linear optics non‐linear optical properties non‐linear optical susceptibility non‐linear optical interaction non‐linear programming non‐linear reactance non‐linear regulation non‐linear control non‐linear motion equation of robot non‐linear susceptibility non‐linear transient non‐linear distortion non‐linear interaction non‐linear share, non‐linear part non‐linear share non‐linear part non‐linear link non‐linear element non‐linear decoupling part non‐linear function generator non‐linear speed controller non‐linear optical parametric process non‐linear converter non‐linear amplifier nonlinear nonlinear element non‐linear link non‐linear element limiting nonlinearity single‐valued nonlinearity hysteresis nonlinearity backlash nonlinearity multivalued nonlinearity saturating nonlinearity dead zone nonlinearity two‐valued nonlinearity on‐off nonlinearity non‐linear decoupling process non‐linear filter system non‐linear link non‐linear element nonlinear control system non‐linear control system nonlinear feedback control system nonlinear system non‐linear system non‐linear transfer circuit nonlinearity non‐linearity inherent nonlinearity non‐manual robot control unlabelled immiscibility analysis non‐moderator unmodulated carrier non‐normalized representation non‐numerical point control non‐numerical control non‐parametric robot algorithm non‐perfect contour non‐periodical function dead‐beat ammeter unprivileged instruction, non‐privileged instruction non‐programmable manipulation devices non‐radioactive indicator unimplemented instruction non‐relevant failure non‐resonance process non‐reciprocal parametric amplifier NOT‐circuit NOT‐gate non‐oscillating system non‐selective pneumatic detector stran 189 od 326 EN ‐DE: slovar avtomatizacije in robotike nichtsensorisiertes System Nichtsicherheitsfunktion nichtsinguläre Matrix nichtsingulärer Punkt nichtstationär nichtstationäre Bewegung nichtstationärer Betriebszustand nichtstationärer Eingang nichtstationärer Prozess nichtstationärer stochastischer Prozess nichtstationärer Vorgang nichtstationäres System nichtsteuerbares System nichtsymmetrische Selbstschwingungen NICHT‐Tor NICHT‐Tor nichttriviale Lösung nichtumlaufende Drehbewegung NICHT‐UND‐Glied NICHT‐UND‐Operation nichtunterbrechbare Betriebsweise nichtvorgespannt nichtzerstörendes Lesen Niederdruckbereich Niederdruckkreislauf Niederdruckprozess Niederdruckteil Niederfrequenzdemodulator Niederfrequenzfilter Niederfrequenzinduktionsheizung Niederfrequenzintervall Niederfrequenzkanal Niederfrequenzkreis Niederfrequenzverstärker Niederfrequenzverzerrung Niederleistungsanwendung Niederspannungskreis Niedertemperaturbolometer Niedertemperaturdemodulator Niedertemperaturdetektor niedrige Robotergeschwindigkeit niedrige Schwellenstromdichte niedriger Zustand Niedrigpegelschaltung Nietarbeitsgang durch Roboter Nieten mittels Industrieroboters Nietroboter Niveauanzeiger Niveaudetektor Niveaufernanzeiger Niveaufernanzeiger Niveaugeber Niveaukreuzung Niveauquantisierung Niveauregler NNC nochmalige Abtastung nockengeführte Achse nockenloser Automat Nockenpositionierung Nockensteuerung Nockensteuerung nomalisierte unscharfe Menge nominales Motoranzugsmoment Nominalsteilheit der Wellenfront Nomogramm NOR‐Funktion Norm Norm Norm eines Vektors Normalausrüstung Normalband Normalbetrieb Normale normale Markow‐Algorithmen normale Permeabilität non‐sensorized system non‐safety function non‐singular matrix non‐critical point non‐steady unsteady motion non‐steady running conditions non‐stationary input non‐stationary process non‐stationary random process non‐stationary process non‐stationary system uncontrollable system non‐symmetric autooscillations NOT‐circuit NOT‐gate non‐trivial solution non‐circulating rotation movement NAND‐element NAND‐operation uninterruptable mode unbiased non‐destructive reading low‐pressure range low‐pressure circuit low‐pressure process low‐pressure subsystem low‐frequency demodulator low‐frequency filter low‐frequency induction heating interval of low frequencies audio channel audio‐frequency circuit audio‐frequency amplifier low‐frequency distortion low‐power application low‐voltage circuit low‐temperature bolometer low‐temperature demodulator low‐temperature detector low robot speed low‐threshold current density low state low‐level circuit rivet operation by robot robot riveting, riveting by means of the industrial robot rivet robot level indicator level detector level teleindicator remote level indicator level transmitter level crossing amplitude quantization level controller non‐numerical control repeat scanning cam‐operated axle camless automatic machine cam positioning cam control cam‐set control normalized fuzzy set rated motor torque nominal steepness of wave front nomogram NOR‐function norm standard norm of vector standard equipment normal band normal operation normal normal Markov algorithms normal permeability stran 190 od 326 EN ‐DE: slovar avtomatizacije in robotike normaler Anfahrvorgang normaler Energiepegel normaler Kernmasseneffekt normaler Start normales Anfahren Normalform (kanonische Form) Normalgerät normalisieren normalisierte Daten pl normalisierte Form Normalisierung Normalmagnetband Normalmagnetisierungskurve Normalverteilung Normalverteilung Normalverteilung von zwei Größen Normalzustand Normalzustand normierte Dämpfung normierte Spektraldichte normierte spektrale Leistungsdichte normierte Zeit Normierungsprinzip Normsignal NOR‐Schaltung Nortstrom Not Notabschaltung Notausschalter Notausschalter eines tR Notausschaltknopf Noteregelung Notschalter (eines Industrieroboters) Notstoppprogramm Notstromversorgung notwendige Optimalitätsbedingungen n‐Spurenband Nuklearmessinstrumente Null Null Nullabgleich Nullabgleich Nullabgleich Nullabgleichglied Nullanschluss Nullanschluss Nullanzeigegerät Nullast Nullausgangssignal Nullbyte Nullbyte Nulldatenlänge Nulldimension Nulldispersion Nulldurchgang Nulldurchgang Nulleffektimpulsrate Nulleinstellen von Selsynen Nulleinstellung Nulleinstellung Nulleinstellung Nulleiter Nullenunterdrückung Nullereignis Nullfehlerstellungssystem Nullfolge Nullform Nullfrequenz Nullgang Nullgeschwindigkeit Nullimpuls Nullimpulsgeber Nullindikatorverstärker Nullinstrument Nullkoordinatensystem Nullmatrix normal start‐up procedure normal energy level normal mass effect normal start‐up procedure normal start‐up procedure normal form standard instrument normalize v normalized data normalized form normalization normal band normal magnetization curve Gaussian distribution normal distribution bivariate normal distribution normal condition normal state damping ratio normalized power spectral density normalized power spectral density non‐dimensional time standardization principle standard signal NOR‐circuit standby current emergency emergency shut‐down emergency cutout off‐emergency of industrial robot emergency stop‐button emergency control emergency switch (of industrial robot) emergency stop program emergency power supply necessary optimality conditions n‐channel tape nuclear measuring instruments zero null balance check null balance zero balance null‐balance device neutral connection neutral lead null [indicating] device zero charge zero output zero byte byte of zero zero data length zero dimension zero dispersion zero point null point background pulse rate zero setting of selsyns zero adjustment reset[ing] zero resetting neutral conductor zero suppression null event zero error position system zero series zero form zero frequency null stroke zero velocity reset pulse zero impulse generator zero‐balance amplifier null instrument zero‐phase‐sequence coordinate system null matrix stran 191 od 326 EN ‐DE: slovar avtomatizacije in robotike Nullmatrix Nullmessmethode Nullmessmethode Nullmethode Nullmethode Nullmethode Nullmethode Nullpotential Nullpunkt Nullpunkt Nullpunkt der Skale Nullpunktabgleich Nullpunktabgleich Nullpunktabgleich Nullpunktabweichung Nullpunktabweichung Nullpunktdetektion Nullpunkteinstellung Nullpunkteinstellung Nullpunkteinstellung Nullpunkteinstellung Nullpunkteinstellung Nullpunkteinstellvorrichtung Nullpunkteinstellvorrichtung Nullpunkteinstellvorrichtung Nullpunkteinstellvorrichtung Nullpunktempfindlichkeit Nullpunktenergie Nullpunktkonstanz Nullpunktlage eines Greifers Nullpunktrichtung Nullpunktsensor Nullpunktstabilität Nullpunktwanderung Nullspannung Nullspannungsauslöser Nullspannungsauslöser Nullstelle Nullstelle Nullsteller Nullsteller Nullsteller Nullsteller Nullstellung Nullstellungsanzeigevorrichtung Nullstellungsausschaltung Nullstellungszustand Nullsystemschutz Nulltyp‐Elektrometer Nullvorlaufsteuerung Nullvorspannung Nullwahrscheinlichkeit Nullwert Nullzeitimpuls Nullzustand numerisch gesteuerte Arbeitsmaschine numerisch gesteuerte Handhabeeinrichtung numerisch gesteuerte Manipulatoreinrichtung numerisch gesteuerte Werkzeugmaschine numerisch gesteuerter Drei‐Achsen‐Roboter numerisch gesteuerter Industrieroboter numerisch gesteuerter Verdrahtungsautomat numerische Analysis numerische Behandlung numerische Behandlung numerische Behandlung numerische Daten pl numerische Datenübertragung numerische Differentiation numerische Einrichtung numerische Einstellung numerische Größe numerische Integration numerische Iteration numerische Konstante numerische Positionsanzeige zero matrix compensation measuring method null point method of measurement null‐balance principle zero method balanced method null method zero potential zero point null point scale zero balance check null balance zero balance zero error zero variation null detection zero adjustment zero adjuster zero adjusting device zero resetting device zero set[ting] control zero adjuster zero adjusting device zero resetting device zero set[ting] control zero‐level sensitivity zero point energy zero point constancy gripper zero point position zero direction zero point sensor zero stability zero drift zero voltage no‐voltage release no‐voltage trip zero null zero adjuster zero adjusting device zero resetting device zero set[ting] control zero position null [indicating] device disengaging zero position reset condition zero‐phase‐sequence protection null‐type electrometer zero offset control zero bias zero probability zero value generator zero pulse time zero state numeric controlled working machine numerically controlled manipulation equipment numeric controlled manipulator equipment numeric controlled machine tool numerically controlled three‐axes robot numeric controlled industrial robot numerically controlled line wiring automaton numerical analysis numerical handling, numerical treatment numerical handling numerical treatment numerical data digital data communication numerical differentiation numerical setting‐up numerical setting‐up digital quantity numerical integration numerical iteration numerical constant numerical position indication stran 192 od 326 EN ‐DE: slovar avtomatizacije in robotike numerische Positionsanzeige numerical position indication numerische Positionssteuerung numerical position control numerical point control numerische Punktsteuerung numerische Rechenschemen numerical computation schemes numerische Robotersteuerung computerized numerical control of IR numerische Steuerung digital control numerische Steuerung numerical control numerische Steuerung discrete control numerische Steuerung von Werkzeugmaschinen numerical machine tool control numerische Steuerungsanlage (Roboter) numerical control equipment numerische Struktur numerical structure numerische Techniken numerical techniques numerische Techniken digital technique numerischer Frequenzmesser digital frequency meter numerischer Kodierer digital encoder numerischer Programmierschritt numerical programming step numerischer Wert numerical value numerisches Präzisionsmanometer numerical precision manometer numerisches Signal numerical signal numerisches Signal digital signal numerisch‐grafische Methode numerical‐graphic method numerisierte Parole o numerized parole Nutationskonstante nutation constant nutzbare Große utilize quantity (for computer) Nutzdämpfung effective transmission equivalent Nutzenergie net energy nutzerorientierter Entwurf m,anwendungsorientierter Entwu user‐oriented design Nutzkomponente desired portion Nutzkomponente useful component Nutzleistung active power Nutzleistung real power Nutzleistung useful performance Nutzleistung effective power Nutzprogramm utility program Nutzsignal useful signal Nutzsignal desired signal Nutzungsdauer period of use Nutzungsfaktor eines Industrieroboters working factor of industrial robot Nutzungsgrad eines Rechners computer efficiency Nyquist stability criterion Nyquist Kriterium Nyquist‐Ebene object configuration 442 Nyquist plane Nyquist‐Methode method of Nyquist Nyquist‐Methode Nyquist method Nyquistsches Diagramm Nyquist curve Nyquistsches Diagramm Nyquist diagram Nyquistsches Kriterium Nyquist criterion obenaktives Signal high‐active signal obere Integrationsgrenze upper limit of integration obere Schranke upper bound oberer Grenzwert upper limit oberer Roboterarm upper robot arm oberes logisches Niveau logic high level Oberflächenbehandlung surface treatment Oberflächenbeschaffenheit surface quality Oberflächenbeschaffenheit surface character of the surface Oberflächendruckverteilung surface pressure distribution Oberflächengüte surface quality Oberflächenkontrolle surface checking Oberflächenmesssonde surface measuring probe Oberflächenschleifroboter surface grinding robot Oberflächenstruktur surface structure Oberwelle overtone Oberwelle higher harmonic Oberwellenanalysator Fourier analyzer Oberwellenanalysator harmonic analyzer Objektabtastung durch Greifer Objektoberfläche object sensing by gripper Objektaggressivität aggressivity of object Objektaggressivität aggressivity of object Objektaufnahme object receiving Objektbeschreibung object description Objektbild object image, image of object Objektbild object image Objektbild image of object Objektbildanalyse object image analysis Objektbildrestaurierung restoration of object image Objektbildverbesserung object image improvement stran 193 od 326 EN ‐DE: slovar avtomatizacije in robotike Objektdaten pl Objektdatensatz Objektdatensatz Objektdimension Objektebene Objekteigenschaft Objekterfassung Objektergreifen Objekterkennung Objekterkennung Objekterkennung Objekterkennung grafischer Strukturen Objekterkennungseinrichtung Objekterkennungsfehler Objekterkennungsfehler Objekterkennungsfehler Objekterkennungssystem Objekterkennungssystem Objekterkennungssystem Objektfixierung Objektform Objektform Objektfunktion Objektgestalt Objektgewicht Objekthalten Objektherstellung objektive Veränderliche objektives Fotometer Objektkonfiguration Objektlage Objektmasse Objektmasse eines Manipulators Objektmaterial Objektmodul Objektoberflächenreflexion objektorientierte Robotertechnik (Robotik) Objektparameter Objektposition Objektprogramm Objektraum Objektraumerweiterung Objektraumerweiterung r* Objektspeicher am Roboter Objekttemperatur Objektverzerrung Objektwerkstoff OCP ODER‐Glied ODER‐Glied ODER‐Operation ODER‐Schaltung ODER‐Verknüpfung off off offene kinematische Kette eines Greifergetriebes offene Robotersteuerkette offene Schleife offene Schleifensteuerung offene Steuerkette eines Industrieroboters offene Steuerung offener Stromkreis offener Wirkungskreis offener Wirkungskreis offenes Impulssystem offenes Impulssystem mit veränderlichen Parametern offenes System Offline‐ Verarbeitung Offlinef offline Offlinef offline Offline‐Konvertiersystem Offline‐Modus Offline‐Organisation Offline‐Programmierung Offline‐Programmierung Offline‐Steuerung object data object data set objet data set object dimension plane of object property of object object registration object gripping object identification, pattern recognition object identification pattern recognition object identification of graphic structures object recognition device object recognition error (fault) object recognition error object recognition fault object recognition system, system of object detection object recognition system system of object detection object fixing object form form of object, shape of object object function form of object, shape of object object weight, weight of object holding of object object production objective variable physical photometer object configuration object position object mass, mass of object manipulator object mass material of object object module object surface reflection object‐oriented robotics parameter of object object position object program object zone extension of object zone extension of object zone robot object memory temperature of object distortion of object material of object optimal point control, optimal control of points, OCP, optimal s OR‐component OR‐element OR‐operation OR‐circuit disjunction off out of circuit adj open kinematic chain of gripper gear open robot control chain open loop open‐loop control open robot control chain open‐loop control open circuit open cycle control open loop open‐loop pulse system open‐loop sampled data system with variable parameters open system offline processing offline autonomous offline converting system offline mode offline organization offline programming off‐line programming offline control stran 194 od 326 EN ‐DE: slovar avtomatizacije in robotike Öffnen des Greiforgans Öffnen eines Greifers (Roboterbefehl) Öffnungsimpuls Öffnungskontakt Öffnungskontakt Öffnungsweg eines Greiforgans Öffnungswinkel Öffnungswinkel der Greiferbacken Öffnungswinkel eines Greiforgans Öffnungswinkel eines Zangengreifers ohmsche Aufheizung ohmsche Belastung ohmsche Belastung ohmsche Komponente ohmsche Last ohmsche Last ohmscher Kontakt ohmscher Spannungsabfall ohmscher Spannungsabfall ohmscher Verlust ohne Rückkehr zu Null Ohrroboter Ökonomie der IR‐Technik ökonomische Kriterien von Robotern ökonomische Kybernetik ökonomischer Variantenvergleich ölhydraulischer Geschwindigkeitsregler ölpneumatisch Ölrückführung Ölschalter Ölspurenmessgerät Online‐Datenerfassung Online‐Datenerfassung Online‐Datenverarbeitung Online‐Diagnose Onlinef Online‐System Online‐Testeinrichtung Operation Operation eines Roboterrechners Operation zwischen scharfen Mengen Operationsabschlusssignal Operationsabschlusssignal Operationsalgorithmus Operationsanalyse operationsanalytische Methode Operationsausführung Operationsbefehl Operationsbefehl Operationsbereich Operationsbereich Operationsbeschleunigung Operationsentschlüßler Operationsfaktor Operationsgeschwindigkeit Operationskode operationsloser Zustand Operationsmethode Operationsmethode Operationsprinzip Operations‐Research‐Problem Operationsroboter Operationsschritt eines IR Operationsschwelle Operationsspeicher (einer Robotersteuerung) Operationssteuerpult Operationssteuerpult Operationssteuerung Operationssystem Operationsverstärker operativer Programmteil operativer Programmteil Operatoren folge feines Industrieroboters Operatorgleichung Operatormethode oproelektronisches Gerät opening of grip organ gripper opening (robot command) break impulse break contact resting contact opening path of grip organ acceptance angle groove angle of gripper jaw groove angle of grip organ groove angle of pincer gripper ohmic heating ohmic load resistive load resistive component ohmic load resistive load ohmic contact ohmic drop resistance drop ohmic loss non‐return‐to‐zero robot with ears, ear robot economy of industrial robots technique economical criteria of robots economical cybernetics economic comparison of variants oil‐hydraulic speed controller oil‐pneumatic oil return oil switch oil traces measuring instrument online data acquisition online data collection online data processing online diagnostics online online system online test facility operation operation of robot computer binary operation operating limiting signal operation limiter operation algorithm operational analysis method of operation analysis operation version operational command operational instruction operating range working range speeding‐up of operations operation decoder operation factor performing operation speed operation code idle state operation method method of operation operating principle operations research problem operational robot operation step of IR threshold of operation operation memory (of robot control) operation console benchboard control of operations operating system operational amplifier operative program part operative program section robot operator sequence, operator sequence of industrial robo operator equation operational programming method light‐wave device stran 195 od 326 EN ‐DE: slovar avtomatizacije in robotike Optimalantwort Optimalbedingung optimale Adaptation optimale Anpassung optimale Bahnsteuerung optimale Bewegungsstrategie optimale Dämpfung optimale Digitalisation optimale Digitalisierung optimale Einstellung optimale Greiferanpassung optimale Greiferauswahl optimale Greiferbewegung optimale Greiferkonstruktion optimale Greifstelle optimale Handlungsstrategie optimale Kenngröße optimale Kodierung optimale Kopplung optimale Lagerhaltung optimale Maschinenbelegung optimale Montage[reihen]folge optimale Montagefolge optimale Montagereihenfolge optimale Montagetechnologie optimale Programmierung optimale Prozesslösung optimale Punktsteuerung optimale Punktsteuerung optimale Punktsteuerung optimale Raumtemperatur bei Robotereinsatz optimale Regelung Optimale Regelung optimale Regelung optimale Regelung optimale Roboterführung optimale Robotersteuerung optimale Robotertechnologie optimale Schaltfunktion optimale Schaltlinie optimale Strategie optimale Struktur optimale Suchmethode optimale Übergangscharakteristik optimale Übertragungsfunktion optimaler Betriebszustand optimaler Durchsatz optimaler Durchsatz optimaler Extrapolator optimal optimaler Prozess optimaler Regler optimaler Relaisservomechanismus optimaler Übergangsprozess optimaler Verlauf optimales Datenabtastsystem optimales Impulssystem optimales Lagerhaltungsproblem optimales Nichtlinearsystem optimales Programmieren optimale optimales Regelungs‐ und Steuerungssystem optimales Schalten optimales Suchfilter Optimalfilter Optimalitätsforderung Optimalitätskriterium Optimalitätsprinzip Optimalpunkt Optimalregelung Optimalregelung Optimalregelung Optimalregelung Optimalsystem Optimalsystem Optimalwert optimieren optimierendes System optimum response optimum condition optimal adaptation optimal adaptation optimal path control optimal movement strategy optimal damping optimal digitization optimal digitization optimal adjustment optimal adaptation of gripper optimal selection of gripper optimal gripper movement optimal gripper construction (design) optimum grip place optimal action strategy optimal parameter optimum coding optimum coupling optimal inventory optimal machine loading optimal assembly sequence optimal assembly sequence optimal assembly sequence optimal mounting technology, optimal assembly technology minimum access programming optimal process solution optimal point control, optimal control of points, OCP, optimal s optimal point control optimal spot control optimum room temperature for robot application extremum control optimal control peakholding control optimum control; optimal robot guide optimal robot control optimal robot technology optimum switching function optimum switching line optimal strategy optimum structure optimum seeking method optimum transient response optimum transfer function optimum behaviour optimum throughput optimal throughput optimum predictor optimum process minimum error controller optimum relay servomechanism optimum transient response optimum process optimum sampled‐data system optimum sampled‐data system optimal inventory problem non‐linear optimalizing system optimum programming optimal control system optimal switching optimum detecting filter optimal filter optimality demand optimality criterion principle of optimality optimum point extremum control optimal control peakholding control optimum control; optimal system optimizing system optimum value optimize v automatically taught system stran 196 od 326 EN ‐DE: slovar avtomatizacije in robotike optimierendes System optimierte Anordnung optimiertes Layout Optimierung Optimierung adaptiver Steuerung Optimierung dynamischer Systeme Optimierung mittels Hybridrechner Optimierung von selbst ablaufender Reaktion Optimierungsmethode Optimierungsmodul (eines Industrieroboters) Optimierungsproblem Optimierungsprogramm Optimierungssystem für Auftragsabwicklung Optimierungsvariable Optimisator Optimum optisch angeregt optisch gepumpt optisch‐akustischer Gasanalysator optische {optisch gesteuerte) Montage optische Abtastung optische Achse optische Analogsignalübertragung optische Analogübertragung optische Anzeige optische Anzeige optische Ausrichtung optische Datenverarbeitung optische Detektion optische Dichte optische Einstellung optische Energiedichte optische Entzerrung optische Faser optische Folgeprogrammierung optische Frequenz optische Geradeausverstärkung optische Impulskodemodulation optische Kontrolle optische Korrelation optische Logik optische Montage optische Montage (durch Oberflächenreflexion des Objekts) optische Nachbildung optische Nachführanlage mit elektronischer Abtastung optische Phasenabweichung phase optique optische Polarisationsmethode optische Resonanz optische Rückkopplung optische Sendeeinrichtung optische Sensorik optische Sensorik optische Sensorik (Sensortechnik) optische Sensortechnik optique optische Sensortechnik optique optische Signalerfassung optische Signalverarbeitung optische Speicherschaltung optische Spektroskopie optische Spitzenleistung optische Strahlenauslenkung optische Strahlenrichtungssteuerung optische Übertragungsfunktion optische Verstärkung optische Verzögerungschaltung optische Verzögerungsleitung optische Zeilenabtastungseinheit optisch‐elektronisches System optischer Abtaser optischer Abtaser optischer Analogrechner optischer Bildsensor optischer Eingang optischer Erfassungssensor optischer Erfassungssensor optischer Fühler self‐teaching system of automatic optimization optimized layout optimized layout optimization adaptive control optimization, ACO optimization of dynamic systems hybrid optimization optimization of sustained reaction optimization method optimization module (of industrial robot) optimization problem optimization program optimization system for order processing optimization variable optimizer optimum optically excited optically pumped optical‐acoustic gas analyzer optical mounting optical scanning optical axis analog optical transmission analog optical transmission optical display system optical projection system optical alignment optical data handling optical detection optical density optical alignment optical energy density optical equalization optical fibre optical sequence programming optical frequency optical direct amplification optical pulse code modulation optical check[ing] optical correlation optical logic optical mounting optical assembly (by surface reflection of object) optical simulation electronically scanned optical tracker optical phase deviation polarization optical method optical resonance optical feedback optical transmitting set optical sensorics optical sensor technique optical sensorics, optical sensor technique optical sensorics optical sensor technique optical signal acquisition optical signal treatment optical storage line optical spectroscopy peak optical power optical beam deflection optical beam‐direction control optical transfer function optical amplification optical delay circuit optical delay line optical line scan equipment optoelectronic system photoelectric reader optical scanner optical analog computer optical image sensor optical input optical acquisition sensor optical pick‐off optical pick‐off stran 197 od 326 EN ‐DE: slovar avtomatizacije in robotike optischer Fühler optischer Geber optischer Geber optischer Geber (Sensor) optischer Gleichheitsprüfer optischer Höhenmesser optischer Kanal optischer Kodierer optischer Kontakt optischer Kopf optischer Koppler optischer Leistungsmesser optischer Leistungsteiler optischer Leser optischer Radarsender optischer Richtkoppler optischer Schalter optischer Schaltkreis optischer Schaltkreis optischer Schaltkreis (eines Sensors) optischer Sender optischer Signalträger optischer Spannungskoeffizient optischer Speicher optischer Verarbeitungskreis optischer Vergleicher optischer Verschlüßler optischer Verstärker optischer Wegmesswandler optischer Wirkungsgrad optischer Zeichenleser optischer Zugriff optisches Abbildungssystem optisches Abtastsystem optique d'exploration optisches Anzeigesystem optisches Anzeigesystem optisches Ausgangssignal optisches Ausgleichselement optisches Bildverarbeitungsgerät optisches Breitband‐Übertragungssystem optisches Dämpfungsglied optisches Datenübertragungssystem fibres optiques optisches Datenverarbeitungssystem optisches Empfangsbauelement optisches Erkennungssystem optisches Erkennungssystem optisches Erkennungssystem optisches Erkennungssystem für Industrieroboter optisches Erkennungssystem für visuelle informationen optisches Faserbündel optisches Fernmeldesystem optisches Filter optisches Informationsverarbeitungssystem optisches Informationsverarbeitungssystem optique optisches Interferenzfilter optisches kohärentes Radar optisches Kohärentstrahlenradar optisches Kommunikationssystem optisches Kompensationsfilter optisches Laserradar optisches Laufzeitglied optisches Lesen optisches Messverfahren optisches Phasendifferenzradar optisches Signal optisches Signal optisches Signal optisches Überlagerungsgerät optisches Überlastsignal optisches Verbindungsgerät optisches Wahrnehmungssystem optisch‐sensorisierter Greifer optoelektronische Datenspeicherung optoelektronische Digitallogik optoelektronische Schaltung optoelektronischer Sensor optical acquisition sensor optical pick‐off optical acquisition sensor optical sensor optical comparator optical altimeter optical channel optical encoder optical contact opto‐head optical coupler optical power meter optical fiber power splitter optical reader optical radar transmitter optical directional coupler optical interrupter optical circuit (of sensor) optical switching circuit optical circuit (of sensor) optical transmitting set optical signal carrier stress optical coefficient optical memory optical processing circuit optical comparator optical encoder optical amplifier optical sensor for displacement measurement optical efficiency optical character reader optical access optical imaging system optical scanning system optical display system optical projection system optical output signal optical balancing element visual image processor broadband optical transmission system optical attenuator fiber optic data transmission system optical data processing system light detecting component optical identification system, optical perception system optical identification system optical perception system optical identification system for industrial robots, optical perc optical perception system for visual information optical fibre bundle optical communication system optical filter optical information processing system optical information processing system optical interference filter optical coherent radar coherent optical radar optical communication system optical compensating filter optical laser radar optical delay line optical reading optical measuring method optical phase‐difference radar optical signal visual signal visible signal optical superposition device optical overload signal optical communication device visual perception system optical‐sensorized gripper optoelectronic data storage optoelectronic digital logic optoelectronic circuit opto‐electronic sensor stran 198 od 326 EN ‐DE: slovar avtomatizacije in robotike optoelektronischer Sensor optoelectronic sensor system 458 optoelektronischer Signalempfänger optoelektronischer Signalgeber optoelektronischer Signalgeber optoelektronisches Bauelement optoelektronisches Kopplungselement optoelektronisches Sensorsystem optoelektronisches Sensorsystem optoelektronisches System Optokopf oraler Dialogprozessor orales Signal Ordinatenachse Ordinatenachse ordnen Ordnung Ordnung der logischen Funktion Ordnung der Regelstrecke Ordnung der Ziffer Ordnungseinrichtung Ordnungsparameter Ordnungsprinzip Organisation der Betriebsführung und Betriebswirtschaft Organisation der Wiederherstellung organisatorische Operationen organisatorisches Programm organisatorisches Programm organische Busstruktur orientiert orientierter Automat orientierter Graph Orientierung eines Robotereffektors Orientierung eines Greifers am Roboter Orientierung von Handhabungsobjekten Orientierungsangabe Orientierungsangabe des Greifers Orientierungsbewegung Orientierungsdaten pl Orientierungshilfe für Robotereinsatz Orientierungskode für Robotermontage Orientierungssystem Orientierungsvektor Originaldaten pl Originalfunktion orthogonale Darstellung orthogonale Datenfolge orthogonale Transformation orthogonaler Einheitsvektor orthogonales Filter orthogonales Filter orthogonales Rechtssystem (für IR‐Bezeichnung) Orthogonalitätsfehler Orthogonalitätsfehler örtliche Rückkopplung ortsbewegliche Maschine ortsbeweglicher Roboter ortsfeste Montageeinheit ortsfester Industrieroboter ortsfester Robotereinsatz Ortsfunktion Ortskurve der Frequenzgangfunktion Ortskurve der Frequenzgangfunktion Ortskurve der Frequenzgangfunktion Ortsvektor Ortsvektor eines Effektors Ortsvektor eines Handhabungsobjekts ortsveränderliches Gerät Ortsvermittlungsstelle Ortung Oszillation Oszillatorinduktionsgeber oszillatorische Bewegung Oszillatorschaltung oszillierende Eigenbewegung oszillierende Eigenbewegung oszillierende Eigenbewegung optoelectronic sensor opto‐electronic signal receiver optoelectronic signal generator opto‐electronic signal generator optoelectronic component optical‐electronic coupling element optoelectronic sensor system opto‐electronic sensor system optoelectronic system opto‐head oral dialogue processor oral signal axis of the ordinates Y‐axis order v order order of logic function order of controlled system number order order device order parameter order principle organization of industrial management recovery management non‐productive operations master program steering program organic structure of bus oriented oriented automaton oriented graph effector orientation of robot gripper orientation of robot orientation of handling objects specification of orientation orientation specification of gripper orientation movement orientation data aid of orientation for robot use robot orientation code orientation system orientation vector original data original function orthogonal representation orthogonal data sequence orthogonal transformation orthogonal unit vector orthogonal filter rectangular filter orthogonal right system orthogonality error non‐orthogonality (of an oscilloscope) local feedback stationary mobile machine stationary mobile robot stationary assembly unit stationary industrial robot stationary application of robots position function Nyquist diagram Nyquist plot polar plot local vector local vector of effector local vector of handling object mobile device local exchange localization oscillation oscillatory induction transmitter oscillatory motion oscillator circuit autooscillation self‐oscillation selfvibration stran 199 od 326 EN ‐DE: slovar avtomatizacije in robotike oszillierende Eigenbewegung oszillierende Eigenbewegung oszillierender Regelkreis oszillografische Darstellung von Vorgängen Oszillogrammzeitmarken Oszilloskop Oszillotitrator OUTPUT‐ERROR‐Modell OUTPUT‐ERROR‐Modell OUTPUT‐ERROR‐Modell Oval‐Speicher (IR‐Werkstückspeicher) Override‐Schalter (einer IR‐Steuerung) P Paarungsmesseinrichtung Packungsdichte Packungsschema Pade‐Approximation Palettenbeladungsplan Palettenladeeinrichtung Palettieren von Werkstücken Palettierungsproblem (eines Industrieroboters) Paley‐Wiener‐Kriterium Pantografenarm Pantografen‐Roboterarm Parabel Parabelfunktion Parabelinterpolation parabolförmige Charakteristik parabolische Belastung parabolische Charakteristik parabolische Geschwindigkeit parabolische partielle Differentialgleichung Parabolreflektor Parallaxefehler Parallaxeneinstellung parallaxfreies Ablesen parallel bewegbare Greiferbacken parallel geschaltetes Korrekturglied Parallel Struktur Parallelabfrage Parallelaufauswahl Parallelbetrieb Parallelbewegung eines Greiforgans Paralleldarstellung Paralleldatenkanal Paralleldatensteuergerät Paralleldatenumwandler Paralleldigitalrechner parallele Ausführung f(von Programmabschnitten) parallele Backenbewegung (eines Greifers) parallele Klauenbewegung parallele Organisation parallele Programmausführung parallele Robotermontage parallele Sensoren parallele Stabilisation parallele Stabilisierung parallele Verbindung parallele Verbindung Paralleleingabe Paralleleingang paralleler Zugriff parallelgeschaltet Parallelinterface Parallelkaskadenverhalten Parallelkurven Parallelmanipulator Paralleloperation Parallelrechenwerk Parallelregler Parallelresonanz Parallelresonanz parallelrückgekoppelter Funktionsverstärker Parallelschaltkreis Parallelschaltung Parallelschaltung free oscillation natural oscillation oscillating control servomechanism oscillographic presentation of processes oscillogram time‐marks oscilloscope oscillotitrator OE model OE model (OE = OUTPUT‐ERROR) OUTPUT‐ERROR model oval memory override switch (of IR‐control) P (proportional) pairing measuring device packing density packing scheme Pade approximation pallet loading plan pallet loading device palletizing of work pieces palletization problem (industrial robot) Paley‐Wiener criterion pantograph robot arm pantograph robot arm parabola parabolic function parabolic interpolation parabolic characteristic parabolic charge parabolic characteristic parabolic velocity parabolic partial differential equation parabolic reflector parallax error parallax adjusting parallax‐free reading parallel movable gripper jaws parallel correcting element parallel structure parallel search parallel‐operation recognition parallel operation parallel motion of grip organ parallel representation parallel data channel parallel data controller parallel data converter parallel digital computer parallel execution (of program sections) parallel movement of jaws (of gripper) parallel movement of claws parallel organization (of computers) parallel program execution parallel robot mounting, parallel robot assembly parallel sensors parallel stabilization parallel stabilization parallel connection parallel circuit parallel input parallel input parallel access parallel‐connected parallel interface parallel cascade action parallel curves parallel manipulator time‐shared operation parallel arithmetic unit parallel run controller antiresonance parallel phase resonance parallel feedback operational amplifier parallel switching circuit parallel combination parallel connection stran 200 od 326 EN ‐DE: slovar avtomatizacije in robotike Parallelschaltung Parallelschaltung des Gleichrichters Parallelschaltung von Regelkreisgliedern Parallelschnittstelle Parallelschwingkreis Parallel‐Seriell‐Umsetzung Parallel‐Serien‐Struktur Parallelsteuerung Parallelstruktur Parallelsuche Parallelsystem Parallelübertragung Parallelübertragung der Information parallelwirkendes Register paramagnetisches System Parameter Parameter Parameter der Handoperation Parameter eines Anwenderprogramms Parameter eines Industrieroboters Parameter eines Montagesystems Parameterabbildung parameterabhängiger Befehl parameterabhängiger Roboterbefehl Parameteränderung Parameterannahme Parameterbegrenzer Parameterbereich Parameterbereich Parameterbestimmung Parameterempfindlichkeit Parametererkennung Parametergebiet Parametergebiet Parametergleichung Parametergrenze Parameteridentifikation Parameteridentifikation Parameteroptimierung Parameteroptimierung einer IR‐Steuerung Parameterrandwert Parameterrangfolge Parameterraum Parameterschätzung Parameterschätzung Parameterschätzverfahren Parametervariation Parameterwert parametrische Dämpfung parametrische Erregung parametrische Frequenzkonversion parametrische Frequenzumsetzung parametrische Optimierung parametrische Programmierung parametrische Pumpenenergie parametrische Resonanz parametrische Universalität parametrische Wechselwirkung parametrischer Elektronenstrahlverstärker parametrischer Gewinn parametrischer Rückwärtswellenverstärker parametrischer Vervielfacher parametrisches elektronisches Bauelement parametrisches Modell parametrisierte Operation parametrisierter Operator parasitäre parasitäre parasitäre Kapazität parasitische Modulation parasitische Selbstschwingungen Paritätsbit Paritätsfunktion Paritätsfunktion Paritätskontrolle Paritätskontrolle parallel circuit parallel rectifier circuit parallel combination of control loop elements parallel interface oscillating parallel circuit parallel‐to‐serial conversion parallel‐serial structure parallel control parallel structure parallel search parallel system parallel transfer parallel transmission of information parallel register paramagnetic system parameter parametric parameter of hand operation user program parameter parameters of industrial robot assembly system parameter parameter image parameter‐dependent instruction parameter‐dependent robot instruction parametric variation parameter acceptance parameter delimiter parameter region parametric domain parameter determination parameter sensitivity parameter identification parameter region parametric domain parametric equation parameter limit parametric estimation parametric identification parameter optimization parameter optimization of IR control boundary parameter value parameter hierarchy parametric space parametric estimation parametric identification parametric estimation method variation of parameters parameter value parametric damping parametric excitation parametric frequency conversion parametric frequency conversion parametric optimization parametric programming parametric pumping energy parametric resonance parametric generality parametric interaction electron‐beam parametric amplifier parametric gain backward‐wave parametric amplifier parametric multiplier parametric electronic component parametric model parametrized operation parametrized operator hunting parasitic oscillations parasitic capacitance spurious modulation parasitic autooscillations parity bit even function parity function odd‐even check parity check stran 201 od 326 EN ‐DE: slovar avtomatizacije in robotike Parolenverarbeitung Parsevalsches Theorem Partialbruchzerlegung Partialdruck partial‐read pulse 470 Partialsystemmodell Partialvolumen partiell partiell symmetrische Funktion partielle (teilweise) Robotisierung partielle Differentialgleichung partikuläre Leitfähigkeit partikuläre Lösung partikuläres Integral Partition PASCAL‐Compiler PASCAL‐Programm passive Ausgleichseinrichtung passive Ausgleichseinrichtung passive optische Komponente passive Schaltung passiver Fügemechanismus passiver Kreis passiver Ultrarotentfernungsmesser passives Bauelement passives Bauelement passives Glied passives Glied passives Infrarotsystem passives optisches Element Pausenzeichen‐Steuerung P‐Bereich P‐Bereich PCM‐Übertragungssystem PD‐Regler PD‐Regler PDT1 (Lead)‐Element (‐Regler) Pedipulator Pedipulatorsystem Pegeleinstellung Pegelfernanzeiger Pegelfernanzeiger pegelgeschalter pegelgettriggert Pegelmesser Pegelmessung Pegelprüfer Pegelregelung Pegelzeiger mit unmittelbarer Ablesung Peirce‐Funktion P‐Element P‐Element Pendeleinrichtung Pendeleinrichtung (eines Schweißroboters) pendelfreie Regelung Pendelmanipulator Pendelung Pendelung perfekt Periode Periode des Sinuskurvenabklingens Periodendauermessung periodisch periodisch gedämpftes Element periodische Dämpfung periodische Frequenzmodulation periodische Funktion periodische Geschwindigkeitsschwankung periodische Große periodische Intensitätsverteilung periodische Lösung periodischer Koeffizient periodischer Taster periodisches Element periodisches Testsignal peripher periphere Einrichtungen für den Industrierobotereinsatz parole processing Parseval theorem partial‐fraction expansion partial pressure partial system model partial volume part[ial] partially symmetrical function partial robotization partial differential equation particular conductivity particular solution particular integral partition[ing] PASCAL compiler PASCAL program passive compliance device passive compliance device, PCD passive optical component passive circuit passive joint mechanism passive circuit passive infrared rangefinder passive element passive component passive element passive component passive infrared system passive optical component pause signal control proportional band proportional control zone pulse‐code‐modulation transmission system PD (proportional‐plus‐derivative)‐controller proportional‐plus‐derivative controller phase‐lead compensator pedipulator, walking robot pedipulator system level setting level teleindicator remote level indicator level‐triggered level‐triggered tank gauge level measurement level detector level regulation direct reading transmission measuring set Peirce function P (proportional)‐element P element oscillation installation (unit) pendulum device antihunting control pendulum manipulator hunting parasitic oscillations perfect period decay time of sinusoidal oscillation cycle duration measurement periodic, underdamped, 0 < D < 1 damped periodic element underdamping periodic frequency modulation periodic function periodic velocity fluctuation periodic quantity periodic intensity distribution periodic solution periodic coefficient impulse element periodic element periodic test signal peripheral peripheral equipment for application of industrial robots stran 202 od 326 EN ‐DE: slovar avtomatizacije in robotike periphere Robotereinrichtung periphere Steuerung peripherer Prozessor peripherer Werkstückspeicher peripheres Verwaltungsprogramm Peripherie Peripherie eines Hybridrechners Peripherie eines Roboterrechners Peripherie für den Montageprozess Peripheriegerätezuordnung Peripherieprozessor Peripherieschnittstellen‐ Anpassungsbaustein Peripheriesteuerung Peripheriesteuerungsbaustein Peripherie‐Untersystem permanente Daten permanente Schaltung permanenterregter Gleichstrommotor Permanentspeicher Permanentspeicher Permeabilität Personalminimum Phantomschaltkreis Phase Phase periodischer Große Phasen Phasenabgleich Phasenabgleichfehler Phasenabgleichfehler Phasenabgleichkondensator Phasenanpassung Phasenanpassungsbeziehung phasenasynchrone Schnittstelle Phasenbahn Phasenbedingung Phasenbrechzahl Phasendetektor Phasendetektor Phasendiagramm Phasendiskriminator Phasendiskriminator Phasendiskriminator Phasenebene Phaseneinstellung Phaseneinstellungsregulierung phasenempfindlicher Detektor phasenempfindlicher Gleichrichter phasenempfindlicher Nullanzeiger phasenempfindliches Nachweisgerät Phasenentzerrer phase Phasenentzerrer phase Phasenfehler Phasenfolgeanzeiger Phasengang Phasengang Phasengang Phasengeschwindigkeit Phasengleichheitsdetektion Phasenimpulsmodulation Phasenimpulsmodulation Phasenkennlinie Phasenkennlinie Phasenkennlinie Phasenkonstante Phasenkopplung Phasenkurve Phasenlaufzeit Phasen‐Minimum‐System Phasenmitteilung Phasenmodulation Phasenmodulator phasenmodulierte Trägerwelle f phasenmodulierter Träger phasenmoduliertes optisches Signal Phasennacheilung Phasennacheilung peripheral robot equipment peripheral control peripheral processor peripheral store, peripheral store of s peripheral administrative program periphery periphery of hybrid computer periphery of robot computer assembly process periphery peripheral device allocation peripheral processor peripheral interface adapter peripheral control peripheral controller peripheral subsystem permanent data full‐time circuit permanently excited d. c. motor, permanent excited direct cur fixed memory permanent memory permeability minimum of staff phantom circuit phase periodic quantity phase phase phasing misphasing skew phasing capacitor phase matching phase‐matching relation phase‐asynchronous interface phase path root‐locus, phase condition phase index phase detector phase discriminator phase diagram phase‐sensitive amplifier phase detector phase discriminator phase plane phasing phasing adjustment phase‐sensitive detector phase‐sensitive rectifier phase‐sensitive null indicator phase‐sensitive detector phase compensator phase equalizer phase[ing] error phase‐sequence indicator phase plot phase characteristic phase response phase velocity inphase amplitude detection displacement modulation phase‐pulse modulation phase characteristic phase locus phase response phase constant phase lock phase curve phase delay minimum phase‐shift system phase averaging phase modulation phase modulator phase‐modulated carrier phase‐modulated carrier phase‐modulated optical signal phase lag phaselag stran 203 od 326 EN ‐DE: slovar avtomatizacije in robotike Phasennachlauf Phasenportrait Phasenrand Phasenraum Phasenrauschen Phasenregelung Phasenregelungsschema Phasenreserve Phasenschieber Phasenschiebung Phasenschiebung Phasenschnittfrequenz Phasenschnittkreisfrequenz Phasenspektrum Phasenstabilität phasenstarr [synchronisiert] Phasensynchronisierung Phasensynchronisierung Phasensynchronisierungsschleife Phasentaktsignal Phasenteiler Phasentrajektorie Phasentrennung Phasenübereinstimmung Phasenumkehrer Phasenumkehrrelais Phasenumkehrschaltung Phasenumkehrung Phasenumkehrung Phasenumkehrverstärker Phasenumtastung Phasenunterspannungsrelais Phasenverhältnis Phasenverschiebung Phasenverschiebungskette Phasenverschiebungskreis Phasenverzerrung Phasenverzerrung Phasenverzögerung Phasenvoreilung Phasenvoreilung Phasenvoreilung Phasenvoreilungsschaltung Phasenvoreilungsstromkreis Phasenvorhaltglied Phasenwender Phasenwinkel Phasenwinkel in geschlossenem Kreis Phasenwinkelanzeiger Phasenwinkelort Phasenzähler phonemische Analyse Phonmesser Phonmesser physikalische Adresse physikalische Eigenheiten physikalische Größe picoprocessor 482 physikalische Manipulatorgröße physikalische Montageobjektdaten pl physikalische Simulation physikalisches Fotometer physikalisches Modell physikalisches Modell physische Verbindung physischer Einheitsblock physischer Kanal physisches Eingabe‐Ausgabe‐Steuersystem physique Picoprogrammierung Picoprozessor Picosekunde PID‐Regelung PID‐Regelung PID‐Regelung PID‐Regler PID‐Regler phase lag phase portrait phase margin phase space phase noise phase control phase control circuit phase margin phase advancer phase advancing phase shift phase cross‐over frequency phase crossover angular frequency phase spectrum phase stability phase‐locked phase synchronization phase lock phase lock loop phase timing signal phase splitter phase path phase separation phase coincidence phase inverter phase reversal relay phase inverter circuit reversal of phase phase reversal paraphase amplifier phase manipulation phase undervoltage relay phase relationship phase shift phase‐shift circuit phase‐shift circuit phase distortion delay distortion phase delay phase advance phase lead phaselead phase‐lead circuit phase‐lead circuit phase‐lead network phase inverter phase angle closed‐loop phase angle phase indicator phase angle locus phase counter phonemic analysis decibelmeter noise test set physical address physical properties physical value physical manipulator size physical assembly object data physical simulation physical photometer physical analog physical model physical connection physical unit block physical channel physical input‐output control system picoprogramming picoprocessor picosecond derivative‐proportional‐integral control proportional‐integral‐derivative control proportional‐floating‐derivative control; PID (proportional‐plus‐integral‐plus‐derivative)‐controller, three‐term controller three‐term controller stran 204 od 326 EN ‐DE: slovar avtomatizacije in robotike PID‐Regler PID‐Regler piezoelektrische Schwingung piezoelektrischer Dehnungsmessstreifen piezoelektrischer Druckmesser piezoelektrischer Effekt piezoelektrischer Lasermodulator piezoelektrischer Sensor piezoelektrischer Wandler piezoelektrisches Bauteil piezoelektrisches Manometer piezoelektrisches Messgerät piezooptisch Piezowiderstandseffekt‐Messmethode PI‐Glied Pilotanlage Pilotanlage Piloteinsatz Pilotfrequenzgenerator Pilotstromkreis Pilotsystem Pipeline‐Arbeitsweise Pipeline‐Architektur Pirani‐Messgerät PI‐Regelung PI‐Regelung PI‐Regelung PI‐Regler PI‐Regler PI‐Regler PI‐Regler PI‐Regler PI‐Regler PI‐Zustandsregelung Plan eines Aufgabenziels Planungsgrundlage Planungsmethode Planungsmodelle Planungsrechner Planungsunterlagen Plasma Plasmadynamik Plasmagenerator Plasmaphasenschieber plastisches Potentiometer Plastizitätsmesser Platinotron Platinotron Plattenbetriebssystem Plattenbetriebssystem Plattenkodierer Plattenspeicher‐Steuergerät Plattensystemsoftware Platzbedarf eines Industrieroboters Plotter Plotter Plotter Plotterkonfiguration plötzliche Änderung Plussechskode pneumatisch pneumatisch betätigter Greifer pneumatisch impulsgesteuerte Programmsteuerung pneumatisch verzögerte Steuerung pneumatische pneumatische Analogie pneumatische Brückenschaltung pneumatische Dämpfung pneumatische Drossel pneumatische Fernmesstechnik distance pneumatische Fernsteuerung pneumatische Fernübertragung pneumatische Fernübertragung pneumatische Förderung pneumatische Hochdruckregelung proportional‐integral‐derivative controller PID‐controller; piezoelectric vibration piezoelectric strain gauge piezoelectric pressure gauge piezoelectric effect piezoelectric laser modulator piezoelectric sensor piezoelectric transducer piezoelectric device piezoelectric pressure gauge piezoelectric measuring instrument piezo‐optic piezoresistance effect measuring method PI‐element pilot plant experimental unit pilot run pilot frequency generator pilot circuit pilot system pipelining pipelined architecture Pirani gauge proportional‐plus‐integral control proportional‐plus‐reset control PI‐control PI (proportional‐plus‐integral)‐controller PI (proportional‐plus‐integral)‐controller, two‐term controller two‐term controller proportional‐integral controller PI‐controller proportional‐floating PI (proportional‐plus‐integral) control with state feedback task target plan planning documents planning method planning models planning computer planning documents plasma magneto‐fluid dynamics plasma generator plasma phase shifter plastic potentiometer plastometer amplitron platinotron disk operating system DOS disk coder disk controller disk system software robot floor space required, IR floor space required plotter graph plotter curve plotter plotter configuration abrupt change excess‐six‐code air‐operated pneumatic‐operated gripper pneumatic pulse‐controlled program control pneumatically delayed control pneumatic level control pneumatic analogy pneumatic bridge circuit air damping pneumatic throttle pneumatic remote measuring technique pneumatic remote control pneumatic remote transmission air‐operated remote transmission air lift pneumatic high‐pressure control stran 205 od 326 EN ‐DE: slovar avtomatizacije in robotike pneumatische Logikanlagen pneumatische Logikelemente pneumatische Niederdruckregelung pneumatische Pegelregelung pneumatische Regelung pneumatische Regelung pneumatische Robotersteuerung (IR‐Steuerung) pneumatische Roboterversion (Roboterausführung) pneumatische Schaltung pneumatische Stelleinrichtung pneumatische Steuerungstechnik pneumatische Übertragungsleitung pneumatische Wheatstonesche Brücke pneumatische Zeitkonstante pneumatischer Annäherungssensor pneumatischer Antrieb pneumatischer Antrieb pneumatischer Beschickungsroboter pneumatischer Digitalrechner pneumatischer Drehwinkelantrieb pneumatischer Drehwinkelantrieb rotation pneumatischer Drehwinkelmotor pneumatischer Druckwächter pression pneumatischer Effektor pneumatischer Effektor pneumatischer Einzweckregler spéciale pneumatischer Förderer pneumatischer Geber pneumatischer Geber (Sensor) pneumatischer Greiferantrieb pneumatischer Greiffinger pneumatischer Handhabebaukasten pneumatischer Handhabebaukasten pneumatique pneumatischer Industrieroboterantrieb pneumatischer Integrator pneumatischer Kanal pneumatischer Kreis pneumatischer Manipulatorantrieb pneumatischer Manipulatorantrieb pneumatique pneumatischer Maßwandler pneumatischer Mehrfunktionsgreifer pneumatischer Membranservomechanismus pneumatischer Messumformer pneumatischer Mikroschalter pneumatischer Miniroboter pneumatischer Programmgeber pneumatischer Rechenverstärker pneumatischer Regler pneumatischer Regler pneumatischer Regler pneumatischer Regler pneumatischer Roboter pneumatischer Roboterantrieb pneumatischer Roboterfinger pneumatischer Robotersensor pneumatischer Rotationsdruckluftmotor pneumatischer Schalttisch pneumatischer Schreiber pneumatischer Signalumformer pneumatischer Simulator pneumatischer Stellantrieb pneumatischer Steuerzylinder pneumatischer Teiler pneumatique pneumatischer Temperaturregler pneumatischer Verstärker pneumatischer Verstärker pneumatischer Vibrationsantrieb pneumatischer Widerstand pneumatisches Analogierechensystem pneumatisches Analogmodell pneumatisches Antriebssystem pneumatisches Anzeigegerät pneumatisches Element pneumatisches Fernmesssystem pneumatisches Gerät pneumatisches Glied pneumatic logical installations pneumatic logical elements pneumatic low‐pressure control pneumatic level control air‐operated control pneumatic control pneumatic robot control, pneumatic IR control pneumatic robot version pneumatic circuit air actuator pneumatic control technique pneumatic transmission line pneumatic Wheatstone bridge pneumatic time constant pneumatic approximation sensor air‐operated drive pneumatic actuator pneumatic feeding robot air‐operated digital computer pneumatic drive of rotation angle pneumatic drive of rotation angle pneumatic rotation angle motor pneumatic pressure guard air‐operated drive pneumatic actuator pneumatic single‐purpose controller air conveyor pneumatic sensor pneumatic sensor pneumatic gripper drive pneumatic grip finger pneumatic manipulation assembly unit pneumatic manipulation assembly unit pneumatic industrial robot drive pneumatic integrator pneumatic channel pneumatic circuit pneumatic manipulator drive pneumatic manipulator drive pneumatic dimensions tranducer pneumatic multifunction gripper pneumatic diaphragm servomotor pneumatic measuring transducer pneumatic microswitch pneumatic minirobot pneumatic program timer pneumatic operational amplifier pneumatic controller air‐operated controller pneumatically operated regulator pneumatic controller pneumatic robot pneumatic robot drive pneumatic robot finger pneumatic robot sensor pneumatic rotation air [pneumatic] motor pneumatic switchboard pneumatic recorder pneumatic signal converter pneumatic simulator pneumatic setting drive air‐operated power cylinder pneumatic divider pneumatic temperature controller air‐operated amplifier pneumatic pneumatic vibrating drive pneumatic resistance pneumatic analog computing system pneumatic analog model pneumatic drive system pneumatic indicator pneumatic element air‐operated telemetering system pneumatic equipment air actuator stran 206 od 326 EN ‐DE: slovar avtomatizacije in robotike pneumatisches logisches Glied air‐operated logical element pneumatisches Modell pneumatic model pneumatisches Regelsystem air‐operated control system pneumatisches Regelsystem pneumatic control system pneumatisches Signal pneumatic signal pneumatisches Stellglied pneumatic setting vane pneumatisches Steuerventil air pilot valve air‐operated logical element pneumatisches Verknüpfungselement pneumatic‐hydraulic control system pneumatisch‐hydraulische Steuerung pneumatisch‐hydraulischer Antrieb pneumatic‐hydraulic drive pneumatisch‐hydraulischer Regler pneumatic‐hydraulic controller pneumoelektrisch pneumoelectric pneumohydraulisch pneumohydraulic pneumohydraulischer Roboterantrieb hydro‐pneumatic robot drive Pneumonik pneumonics Pneumoniksystem pneumonic system pneumonische Bauteile pneumonic building block elements Poissonsche Verteilung Poisson's distribution Polardiagramm polar diagram Polarisation polarization Polarisationsanalysator polarization analyzer Polarisationsdispersion polarization dispersion Polarisationseffekte polarization effects Polarisationsfilter polarizing filter polarisationsoptisches Verfahren optical polarization method Polarisationsschwund fading by polarization Polarisationsstabilität polarization stability polarisationsunabhängig polarization‐independent Polarisationsverhalten polarization behaviour Polarisationszustand polarization state Polarisator polarizer Polarisierbarkeit polarizability polarisieren polarize v polarisierendes Bauelement polarizing component polarisierte Strahlung polarized radiation polarisiertes Relais mit Neutralstellung centre stable relay Polaritätsdetektor polarity detector Polarkoordinaten polar coordinates Polarroboterarm polar robot arm Polarwinkel polar angle Polieren (durch Roboter) polishing (by robot) pole‐zero plot, pole‐zero diagram Pol‐Nullstellenplan Polrisationsrichtung direction of polarization pole Polstelle Polungsweiser polarity detector pole placement Polvorgabe Polynom multinomial Polynom polynomial Polynom‐Approximation polynomial approximation Polyoptimierung polyoptimization Popov line Popow‐Gerade Portalindustrieroboter portal industrial robot Portalmanipulator portal manipulator Portalmanipulatorprinzip portal manipulator principle portal process unit Portalverfahrenseinheit Portalwagen eines Manipulators manipulator portal car Position einer Greifeinheit position of grip unit Positioner valve positioner Positionierabweichungsausgleich positioning deviation compensation Positionierantrieb positioning drive positionierbar positionable positionierbare Achse positionable shaft positionierbarer Sollwert positionable nominal value Positionierfehler positioning error Positioniergenauigkeit positioning exactitude Positioniergenauigkeit positioning accuracy Positioniergenauigkeit positioning exactitude, positioning accuracy Positioniergenauigkeit feines Industrieroboters robot positioning accuracy, industrial robot positioning accura Positionierhilfen aids of positioning Positionierhilfen aids of positioning Positionierpunkte points of positioning Positionierregelungsgenauigkeit positioning control accuracy Positionierregelungsgenauigkeit t Regelungsgenauigkeit der Ppositioning control accuracy Positioniersystem positioning system Positioniertoleranz eines Roboters positioning tolerance of robot Positionierung durch Hilfsroboter positioning by auxiliary robot stran 207 od 326 EN ‐DE: slovar avtomatizacije in robotike Positionierung eines Handhabungsobjekts Positionierungenauigkeit Positionierungssensor Positionierungsservomechanismus Positionierungssystem Positionierungstechnik Positionierungsungenauigkeit Positionsabfragefrequenz (Abfragefrequenz) eines IR positionsabhängiger Kode Positionsabweichung feines Greifers Positionsanzeige eines IR Positionsdaten pl Positionsdaten pl eines Manipulators Positionsdaten pl eines Roboters Positionserkennung Positionsermittlung durch Potentiometer Positionsermittlung durch Winkelkodierer Positionsfehler Positionsfehler Positionsfolgessystem Positionsfolgessystem Positionskode Positionskoordinaten Positionsmechanismus Positionsmechanismus Positionsmesssystem Positionsmessung Positionsregelungsgenauigkeit Positionssensor Positionssicherung Positionssteuerung Positionssteuerung Positionssteuerungssystem positionsunabhängiger Kode Positionsunsicherheit eines IR Positionszeitpunkt positiv (PO) positiv definit positive Bahnabweichung positive Differenz positive Kopplung positive Logik positive quadratische Form positive Rückkopplung positive Schaltungslogik positiver Impuls positiver Selbstausgleich positives Niveau positives Potential positives Signal positiv‐groß (PG) positiv‐klein (PK) Positivlogiksignal positiv‐mittel (PM) Postenzähler Postulat Postulat Potential des Vektorfeldes Potential[verteilungs]steuerung Potentialanalogie Potentialbild Potentialdiagramm Potentialfunktion Potentialkorrektur Potentialkurve Potentialschwelle Potentialsprung Potentialtheorie Potentialverlauf Potentialverteilung Potentialwall potentielle Energie Potentiometer Potentiometer für Koordinatenwandlung Potentiometer mit Kräfteausgleich Potentiometerabgriff positioning of handling object positioning inaccuracy, inaccuracy of positioning positioning sensor position control servomechanism positioning system positioning technique positioning inaccuracy, inaccuracy of positioning position interrogation frequency of IR position‐dependent code deviation of gripper position position indication of IR position data position data of manipulator position data of robot position identification, position perception (recognition) determination of position by potentiometer determination of position by angle encoder position error position[ing] error kinetic control system positional servosystem (US) position code position coordinates position mechanism positioner position measuring system position measurement position control accuracy position sensor position protection, protection of position position control digital position control position control system position‐independent code position uncertainty of IR position instant, position moment positive (P) positive definite positive path deviation positive difference positive coupling positive logic positive quadratic form positive feedback positive logic positive pulse positive self‐regulation positive level positive potential positive signal positive big (PB) positive small (PS) positive‐logic signal positive medium (PM) item counter axiom postulate potential of vector field potential distribution control potential analogy potential diagram potential diagram potential function potential correction potential‐energy curve potential barrier potential jump potential theory potential distribution potential distribution potential barrier potential energy potentiometer resolver potentiometer force‐balanced potentiometer potentiometer pick‐off stran 208 od 326 EN ‐DE: slovar avtomatizacije in robotike Potentiometermethode Potentiometerregler potentiometrisches Fehlermesssystem Potentiostat PPT1 (Lag)‐Element (‐Regler) PPT1‐PDT2 Element PPT1‐PDT2‐Regler Präcompoundprozess Prädikatenlogik prädiktives Filter prädiktives Relaissystem Präionisation Präionisation praktischer Beharrungszustand Prämisse Präsenz Präzision Präzision Präzision Präzision Präzisionsgerätetechnik Präzisionsindustrieroboter Präzisionsindustrierobotertechnik Präzisions‐IR Präzisionsroboter Präzisionsrobotertechnik Präzisionsrobotertechnik Präzisionsschweißautomat Präzisionssteuerung Präzisionstechnik Präzisionswälzlager Prediktornetzwerk predizierendes Netzwerk Preemphase P‐Regelung P‐Regelung P‐Regelung P‐Regler P‐Regler P‐Regler P‐Regler P‐Regler P‐Regler mit Störgrößenausschaltung preisgünstiger Sensortyp Pressen von Einzelteilen Pressluftanlage Pressluftanschluss für Roboter Pressverbindung Primärdaten pl Primärdaten pl Primärelement primärer Fühler primäres Regelelement Primärparameter Primärprozess Primärregelung Primärserienauslöser Primärspeicher Primärspeicher Primärvorgang Printer Prinzip der adaptiven Zeitkonstante Prinzip der Gruppenrangordnung Prinzip des Argumentes Prinzip gleichzeitig ablaufender Operationen Prinzip gleichzeitig ablaufender Operationen Prinzipschaltbild Prinzipschaltbild Prinzipschaltung Prinzipschaltung Prinzipschema Prinzipschema Prinzipzeichnung Prinzipzeichnung Prioritätengruppe Prioritätsanzeiger potentiometer method potentiometer controller potentiometric error measuring system potentiostat phase‐lag compensator lag‐lead compensator lag‐lead compensator pre‐equilibrium process predicate logic predicting filter prediction relay control system auto‐ionization preionization practical steady state premise presence accuracy exactness exactitude precision precision device engineering precision robot, precision industrial robot precision Industrial robot technique, precision industry roboti precision robot, precision industrial robot precision robot, precision industrial robot precision robotics precision robotics (robots technique) automatic precision welding equipment precision control precision engineering precision antifriction bearing predictor network predictor network pre‐emphasis P control proportional control P‐control P controller proportional controller proportional [action] controller Pcontroller throttling controller proportional controller with disturbancevariable compensatio cheap sensor type, inexpensive sensor type press working of one‐off parts compressed‐air equipment compressed‐air connection for robot presspng] fastening primary data original data primary cell primary detector primary control element primary parameter primary process primary regulation direct series trip primary memory primary store primary process printer principle of adaptive time constant control hierarchy principe argument principle principle of simultaneous operations concept of simultaneous operations schematic circuit schematic diagram schematic circuit schematic diagram principle scheme principle drawing principle scheme principle drawing priority group priority indicateur stran 209 od 326 EN ‐DE: slovar avtomatizacije in robotike Prioritätsgrad Prioritätsinterruptsteuerung Prioritätskontrolle Prioritätsordnung Prioritätsprogramm Prioritätssteuerung Prioritätsstromkreis priority control 502 Prioritätsstruktur Prioritätsstufe Prioritätsverarbeitung Prioritätszuteilung Prismateil prismatisches Greiforgan prismatisches Objekt probabilistisch probabilistische Logik probabilistischer Automat Probe Probebetrieb Probebetrieb Probelauf Probenraum Probeproduktion Problem der Operationsforschung Problem der Quantisierung Problemalgorithmus Problembearbeitungsprozess Problembeschreibung Problembestimmung Problemdefinition Probleme der Robotertechnik Problemeinstellung Problemloser (Roboterprogramm) Problemlösungsprozess problemorientierte Geometriesprache problemorientierte Programmiersprache problemorientierte Roboter‐Programmiersprache problemorientierte Steuerung problemorientierte Werkstückbeschreibung problemorientierte Werkstückbeschreibung problemorientiertes Programm problemorientiertes Softwarepaket problemorientiertes Systemunterlagenpaket Problemprogramm Problemzustand Processsteuersystem Produktenentwurf Produktentwurf Produktionsausrüstung Produktionsautomatisierung Produktionsintegration Produktionskontrollsystem produktionsorientiertes Roboterprogramm Produktionsplanung Produktionsplanung Produktionsprozesskontrolle Produktionsrate Produktionsrhythmus Produktionsroboter Produktionssteuerungsplan Produktionsstichprobe Produktionssystem Produktionsüberwachung Produktivitätssteigerung Produktlinie Produktmontage mittels Industrieroboters produzierender Prozess produzierte Montageeinheit Profoldispersionskoeffizient Prognosearbeit Prognosearbeit Prognosearbeit Programm Programm des bedingten Übergangs Programm eines Universalrechners Programm für Industrieroboter priority grading priority interrupt control priority check order of priority priority program priority control priority circuit priority structure priority grading priority processing priority dispatching prism part prismatic grip organ prismatic object probabilistic probabilistic logics probabilistic automaton sample test run trial run trial run sample space trial production operations research problem quantization problem problem algorithm problem preparation process problem description problem definition problem definition robotic problems set‐up of problem problem solver (robot program) problem preparation process problem‐oriented geometry language problem‐oriented language problem‐oriented robot programming language problem‐oriented control problem‐oriented description problem‐oriented work piece description problem‐oriented program problem‐oriented software package problem‐oriented software package problem program problem state process control system product design product design production equipment production automation integration into production production control system production‐oriented robot program product scheduling production scheduling, product scheduling production process control production rate rhythm of production production robot production control scheme productive sampling test production system production supervision increased productivity product line robot product assembly producer process produced assembly unit profile dispersion parameter prediction prognosis prognostication program branching program universal computer program robot program, industrial robot program stran 210 od 326 EN ‐DE: slovar avtomatizacije in robotike Programm zur Analyse von Schaltungen Programm zur automatisierten Datenverarbeitung Programm zur Filtersynthese Programm zur Simulation hybrider Schaltungen programmabhängig programmabhängiger Betrieb programmabhängiger Fehler Programmablauf Programmablauf Programmablauf Programmablaufänderung Programmablaufnachbildung Programmablaufplan Programmablaufplan programme Programmablaufsteuerung Programmablaufverzweigung Programmalgorithmus Programmanalysator Programmanalysebericht Programmanforderung Programmanpassung Programmanweisung Programmaufbau Programmausführung Programmausführungskommando Programmbeschreibung Programmbetrieb eines Manipulators Programmbibliothek Programmdaten pl (eines Roboterprogramms) Programmende Programmentwicklungssystem Programmfehler programme Programmfehler programme Programmfehlerermittlung Programmfernsteuerung Programmfernsteuerung Programmfolge Programmfunktion Programmgeber Programmgeber Programmgenerator Programmgenerierung programmgesteuert programmgesteuert programmgesteuerte Datenverarbeitungsanlage f programmgesteuerter Ablauf programmgesteuerter Automat programmgesteuerter Bohrroboter (für Leiterplatten) programmgesteuerter Einschienenmanipulator programmgesteuerter Makroprozessor programme programmgesteuerter Manipulator programmgesteuertes Gerät programmgesteuertes Schaltsystem programme programmgesteuertes Vorrangunterbrechungssystem Programmgrobstruktur Programmidentifikation Programmidentifizierer Programmier[ungs]problem Programmieranleitung Programmierarbeitsplatz programmierbare programmierbare Anzeige programmierbare Beschickungseinrichtung programmierbare fluidische Steuerung programmierbare Fördereinrichtung programmierbare Handhabeeinrichtung programmierbare Handhabungsgeräte ohne Logikfunktionen programmierbare Interruptsteuereinheit programmierbare Kommunikationsleitung programmierbare Lageregelung programmierbare Logik programmierbare Montagemaschinenkonfiguration programmierbare Roboterkontrolle programmierbare Schaltung programmierbare Schnittstellenanpassung programmierbare Sensorsteuerung circuit analysis program automatic data processing program, ADPP filter synthesis program hybrid program program‐dependent program‐dependent operating program‐dependent error computer operation program proceeding, program flow program flow dynamic sequential control program simulation program flowchart program flow chart program flow control branch of program flow program algorithm program analyzer program analysis report program request adaptation of program program statement program structure program execution program execution instruction program description program operation of manipulator program library program data (of robot program) program end program development system program error program fault program error detection remote program control programmed telemetry control program sequence program function program controling element programmer program generator program generation program‐controlled software‐controlled program‐controlled data processing system program‐controlled sequence program‐controlled automaton program‐controlled drill robot (for printed‐circuit boards) program‐controlled monorail manipulator program‐controlled macroprocessor program‐controlled manipulator program‐controlled device program‐controlled switching system program‐controlled priority interrupt system program coarse structure program identification program identifier programming problem programming instruction programming workplace programmable interrupt controller programmable display programmable loading device programmable fluidic control programmable conveyor device programmable handling device programmable manipulation devices without logic functions programmable interrupt controller programmable communication line programmable regulation of position programmable logic programmable assembly machine configuration programmable robot checking programmable logic programmable interface adapter programmable sensor control stran 211 od 326 EN ‐DE: slovar avtomatizacije in robotike programmierbare Sortiereinrichtung programmierbare Steuerung programmierbarer Armbewegungsablauf programmierbarer Automat (für Roboter) programmierbarer Industrieautomat programmierbarer Industrieroboter (Roboter) programmierbarer Interface‐Adapter programmierbarer Manipulator programmierbarer Miniautomat programmierbarer Multiplexer programmierbarer Peripherieschnittstellenbaustein programmierbarer Punkt programmierbarer Roboterarm programmierbarer Sensorroboter programmierbares Greifertastorgan programmierbares Handhabemittel programmierbares Kommunikationsinterface programmierbares Montagesystem programmierbares Steuerungssystem (für Roboter) Programmiereigenschaft Programmiereigenschaft feines IR Programmiereinheit programmieren Programmieren in natürlicher Sprache Programmieren von Industrierobotern Programmierer von Industrierobotern Programmiererleichterung Programmierfehler Programmiergerät Programmiergestell Programmierhandbuch Programmierhilfen Programmierkonsole Programmierphase Programmiersprache Programmiersprache f"für numerische Steuerung Programmiersprache mit hohem Niveau Programmiersprachenfamilie Programmierstrategie Programmiersystem programmierte Aufgabenzuordnung programmierte Beschleunigung programmierte Betriebsart programmierte Bewegungsposition programmierte Bewegungssequenz programmierte Fehleranzeige programmierte Fernsteuerung programmierte Fernsteuerung programmierte Sicherheitsgruppe programmierte Soll‐Bahn programmierte Sperre programmierte Toleranzprüfung program memory 512 programmierte Verriegelung Programmiertechnik Programmiertechnologie programmierter Bewegungsraum programmierter Bewegungsschritt programmierter Datenaustausch programmierter Geschwindgkeitssollwert programmierter Grafikprozessor programmierter Industrieroboter programmierter Roboterbefehl programmierter Roboterbewegungsablauf programmiertes Lernen programmiertes Werkzeugmaschinensystem Programmierung Programmierung auf Modulbasis Programmierung grafischer Geräte Programmierung komplexer Montageroboter Programmierung von Bewegungspunkten Programmierung von Roboterproblemen Programmierungskode Programmierungsoperatormethode Programmierungssprache für Roboter Programmierverfahren Programmierwerkzeug programmable sorting device programmable control programmable arm movement running programmable automaton (for robot) programmable industrial automaton programmable industrial robot, programmable robot programmable interface adapter programmable manipulator programmable mini‐automaton programmable multiplexer programmable peripheral interface programmable spot, programmable point programmable robot lever programmable sensory robot programmable gripper touching organ programmable handling mean programmable communication iterface programmable assembly system programmable control system (for robots) programming property robot programming property programming unit program v programming in natural language programming of industrial robots robot programmer, industrial robot programmer programming ease programming error programming device programming rack programming handbook software programming console programming phase programming language automatically programmed tool language, APT, programming high‐level programming language programming language family programming strategy programming system programmed task coordination timed acceleration programmed operation mode programmed movement position programmed movement sequence programmed error indication remote program control programmed telemetry control programmed action safety assembly programmed nominal path programmed interlock programmed tolerance check[ing] programmed interlock programming technique programming technology programmed motion room programmed movement step programmed data change programmed speed nominal value programmed graphic processor programmed industrial robot programmed robot instruction programmed sequence of robot movements programmed learning programmed machine tool system programming modular programming programming of graphic devices programming of complex assembly robots programming of movement points programming of robot problems programming code operational programming method robot programming language programming method programming tool stran 212 od 326 EN ‐DE: slovar avtomatizacije in robotike Programmimpuls Programminterpreter Programmkapazität Programmkennzeichner Programmkompatibilität Programmkonzept Programmkorrektur (eines IR‐Programms) Programmkreis Programmlauf eines Roboters Programmlenkung Programmodifikation Programmpaket eines Roboters Programmposition Programmpositionszahl Programmprüfung programme Programmregelung Programmregelung Programmregelungssystem Programmregler Programmregler Programmregler Programmreproduktionsabweichung Programmsatz Programmschaltelement Programmschalter Programmschritt eines Roboters Programmschrittzahl Programmschutz eines Roboters Programmsimulation Programmspeicher Programmspeicher Programmspeicherung für einen Industrieroboter Programmsprache Programmstart Programmstatement Programmsteuerbefehl Programmsteuerbyte Programmsteuereinheit Programmsteuereinrichtung mit Drucktasten Programmsteuergerät Programmsteuerung Programmsteuerung Programmsteuerung mit Koordinatografen Programmsteuerung von technologischen Prozessen Programmsteuerungsart Programmsteuerwerk Programmstrategie Programmstruktur Programmsystem Programmsystemstruktur Programmtafel zur Verschlüsselung programmtechnische Lösung Programmtext Programmtextangabe Programmträger Programmübersetzung Programmumsetzungseffektivität/ Programmunterbrechung Programmvariable Programmverträglichkeit Programmverzweigung Programmverzweigungsoperation progressive Wirkung Projektierung Projektierung Projektierung Projektierung Projektierungsmethode Projektierungsmodell Projektionsanzeige Projektionsroboter Projektplanungsmethode Projektunterlagen prompte Kritikalität prompte Kritikalität prompte Kritizität program pulse program interpreter. interpreter of robot program program capacity program identifier program compatibility program concept program correcting (of IR program) program circle program run of robot preset guidance modification of program program pack of robot program position program position number program testing program control time‐cycle control program control system program controller time‐cycle controller time‐schedule controller (US) deviation of program reproduction sentence sequence control element sequence controller robot program step, program step of robot program step number program protection of robot program simulation program memory program storage robot program storage, 1R program storage programming language program start program statement program control instruction program control byte program control unit keyboard programming unit program control gear program control time‐cycle control program control device with coordinatographs program control of technological processes type of program control program control unit program strategy program structure program system software architecture program table for coding program‐technical solution program text program text specification program carrier program translation program conversion efficiency program interrupt program variable program compatibility program branching program branching operation progressive action projecting engineering planning designing projecting method projecting model projection display projection robot method for project planning project documents prompt criticality prompt critical state prompt criticality stran 213 od 326 EN ‐DE: slovar avtomatizacije in robotike prompte Kritizität prompter Reaktivitätssprung prompter Sprung promptkritischer Zustand promptkritischer Zustand Proportion Proportion proportional proportional wirkender Regler proportional wirkender Regler proportional wirkender Regler Proportionalbeiwert Proportionalbeiwert Proportionalbeiwert Proportionalbereich Proportionalbereich proportional‐derivative Einwirkung Proportional‐Differential‐Regler proportionale Rückkopplung proportionale Rückkopplung proportionale Schmalbandregelung proportionale Verstärkung Proportionaleinwirkung Proportionaleinwirkung proportionaler Bereich proportionaler Berichtigungsfaktor proportionaler Zähler proportionales Band proportionales Verhalten proportionales Verhalten proportionales Verhalten Proportional‐Integral‐Derivativ‐Regelung Proportional‐Integral‐Derivativ‐Regelung Proportional‐Integral‐Derivativ‐Regler Proportional‐Integral‐Derivativ‐Regler Proportional‐Integral‐Differential‐ Regelung Proportional‐Integral‐Regelung Proportional‐Integral‐Regelung Proportional‐Integral‐Regelung Proportional‐Integral‐Regler Proportional‐Integral‐Regler Proportional‐Integral‐Regler Proportionalität Proportionalitätsfaktor Proportionalitätsnavigation Proportionalkomponente Proportionalregelung Proportionalregelung Proportionalregelung Proportionalregelungsgrenzen Proportionalteiler Proportionalverhalten Proportionalverstärker Proportionalzählrohrspektrometer proportionell prothetischer Manipulator Prototyp Prototypsystem Prozedur prozedurorientierte Programmiersprache Prozedurvereinbarung Prozentvergleichsschutz Prozess Prozeß Prozess vom Markowschen Typ Markov Prozessalgorithmisation Prozessalgorithmus Prozessanalyse Prozessausgabe Prozessausnutzungsfaktor Prozessautomatisierung Prozessdaten pl Prozessdatenadapter Prozessdatenanschlusseinheit Prozessdaten‐Steuereinheit Prozessdatenübertragungseinrichtung prompt critical state prompt [reactivity] jump prompt [reactivity] jump prompt criticality prompt critical state ratio proportion proportional proportional [action] controller Pcontroller throttling controller dc gain proportional constant proportional gain proportional band proportional control zone proportional‐rate action proportional‐plus‐derivative controller proportional feedback rigid feedback narrow‐band proportional control proportional gain proportional action proportional input throttling zone proportional correction factor proportional counter throttling zone proportional action proportional behaviour proportional input proportional‐integral‐derivative control proportional‐floating‐derivative control; proportional‐integral‐derivative controller PID‐controller; derivative‐proportional‐integral control proportional‐plus‐integral control proportional‐plus‐reset control PI‐control proportional‐integral controller PI‐controller proportional‐floating proportionality coefficient of proportionality proportional navigation proportional component proportional control throttling control P‐control proportional control limits proportional divider proportional action linear amplifier proportional counter spectrometer proportional prothetic manipulator prototype prototyping system procedure procedure‐oriented language procedure declaration percentage differential protection process stochastic process Markovian‐type process process algorithmization process algorithm process analysis process output process utilization factor process automation process data data adapter unit data adapter unit process data control unit process communication system stran 214 od 326 EN ‐DE: slovar avtomatizacije in robotike Prozessdatenverarbeitung Prozessdatenverarbeitungssystem Prozesseingabe Prozesseinheit Prozesseinrichtung Prozesseinrichtung Prozessentwicklung Prozessfernsteuerung prozessflexible Industrierobotertechnik (Robotertechnik) prozessflexibler Industrieroboter/n prozessflexibles Montagesystem mit Robotern Prozessfolge prozessgekoppelt prozessgekoppelte Datenerfassung prozessgekoppelte Datenerfassung prozessgekoppelte Datenverarbeitung prozessgesteuerter Manipulatorarbeitsplatz Prozesshardware Prozesshardware Prozessidentifikation Prozessinformationen Prozessinformationssystem Prozessinformationssystemplanung Prozessintensivierung Prozesskennlinie Prozessknoten Prozesskommunikation Prozesskontrolle bei Manipulation mechanischer Teile Prozesskonvergenz Prozesslösung Prozessmodellsteuerung Prozessniveau Prozessniveau Prozessniveau Prozessor Prozessor Prozessor Prozessor für Vorverarbeitung Prozessorarchitektur prozessorgesteuerte Logikanalyse prozessorgesteuerte Vermittlungsstelle processeur Prozessorleistung Prozessormodul Prozessorregister Prozessorschnittstelle Prozessortakt Prozessorunterbrechung Prozessorverbindungsprogramm Prozessorzyklus Prozessregelung Prozessschritt Prozesssensor prozessspezifische Industrierobotertechnik (IR‐Technik) prozessspezifischer Montageroboter Prozessstabilisierung Prozesssteuersystem Prozesssteuerung Prozesssteuerung process 504 Prozesssteuerungsanalyse Prozessstörung Prozessüberwachung Prozessüberwachung Prozesszyklusregler Prüf bit Prüf Operationsdatei Prüfablauf Prüfablaufüberwacher Prüfalgorithmus Prüfalgorithmus Prüfanzeiger Prüfaufgabe Prüfautomat Prüfautomatennetz Prüfbedingung Prüfbedingungen Prüfbit process data treatment process data processing system process input process unit process hardware process hardware, process device process development process remote control process‐flexible [industrial] robots technique, process‐flexible process‐flexible {industrial] robot robot process flexible assembly system sequence of processes online online data acquisition online data collection online data processing process‐controlled manipulator workplace process hardware process hardware, process device process identification process data process information system planning of process information system process intensification process characteristic process node process communication process control at manipulation of mechanical parts process convergence process solution process model control activity level level of activity level of process processor, processing unit, PU processor processing unit processor for pretreatment processor architecture processor‐controlled logic analysis processor‐controlled exchange processor power processor module processor register processor interface processor clock processor interrupt processor junction program processor cycle process control processing step process sensor process specific industrial robots technique process specific mounting robot process stabilization process control system process control proceeding control process control analysis process disturbance process supervision processing monitoring process cycle controller check bit, CB checking operation file test process test monitor check algorithm, checking algorithm check[ing] algorithm check indicator check problem automatic tester automatic tester network test condition test requirements check bit stran 215 od 326 EN ‐DE: slovar avtomatizacije in robotike Prüfbit Prüfbit Prüfdaten pi Prüfdaten pl Prüfeinheit Prüfeinrichtung prüfen prüfen Prüfer Prüfer Prüffeldrechner Prüffolge Prüffolge Prüffolgenerzeugung Prüfgerät Prüfgerät Prüfinformation Prüfinformation Prüfkode Prüfkode Prüflauf Prüfmaschine Prüfmethode Prüfmodulation Prüfperiode Prüfplatz Prüfplatz Prüfprogramm Prüfprogramm eines Industrieroboters Prüfprogrammbeginn Prüfprogrammbeginn Prüfprogrammende Prüfprogrammende Prüfprogrammfehler Prüfprogrammfehler Prüfprogrammzeit Prüfprogrammzeit Prüfprozess Prüfpunktanalyse Prüfselbsthalteschaltung Prüfsender Prüfsignal Prüfspannung Prüfspannung Prüfstation Prüfstopp Prüfsystem Prüftisch m Prüftisch m Prüftisch m Prüftisch m Prüfung der Werkzeugqualität Prüfung durch Rückübertragung Prüfung durch Rückübertragung Prüfung innerhalb einer Schaltung Prüfverfahren Prüfverfahren Prüfverfahren Prüfvorgang Prüfvorgang Prüfwähler Prüfwerkzeuge Prüfzeichen Prüfzeit Prüfziffernsystem Pseudobefehl Pseudobefehl Pseudobefehl pseudoharmonische Schwingung Pseudoinverse Pseudoinverse Pseudokode Pseudokode Pseudokode Pseudokodesystem pseudolinear parity bit test bit checking data checking data checking unit checking equipment monitor v verify v testing instrument check instrument test panel computer checking sequence test sequence test pattern generation testing instrument check instrument check[ing] information checking information error‐detecting code check code check run test machine test method check modulation test period test place test assembly checking program checking program of robot, checking program of industrial rob check program beginning test program beginning check program end test program end test program error check program error check program time test program time test process sampling analysis test latch signal generator test signal test tension test voltage checking station check stop checking system instrument table test stand test board test table tool quality checking echo checking echo testing in‐circuit check checking procedure test procedure testing technique operation of testing test operation test selector test[ing] tools test pattern test period check digit system pseudoinstruction abstract code pseudo‐code pseudoharmonic oscillation Moore‐Penrose pseudoinverse pseudoinverse abstract code conditional code pseudo‐code pseudo‐code system pseudolinear stran 216 od 326 EN ‐DE: slovar avtomatizacije in robotike pseudolineares System pseudometrischer Raum Pseudooperation Pseudoprogramm Pseudorechner Pseudoskalar pseudoskalare Große pseudoskalare Kopplung pseudovektorielle Bindung Pseudovektorkopplung Pseudozufallsfolge Pseudozufallszahlen PT1‐Element PT2‐Element PT2‐Element PT2‐Element (mit D < 1 PT2‐Element (mitD > 1 PTP‐Steuerung PU Puffer Puffer Puffer Puffer für vorausgeholte Informationen Pufferbaustein Pufferfunktion Pufferkreis Puffermodul Pufferregister einer Robotersteuerung Pufferspeicher Pufferspeicher Pufferspeicher Pufferspeicher Pufferspeicher einer Robotersteuerung Puffersteuerwort Pufferstufe Pufferstufe Pufferstufe einer Robotersteuerung Pufferverstärker Pulsation Pulsation Pulsation Pulsationsinstabilität Pulsationskoeffizient Pulsekodemodulationsübertragungssystem Pulsen Pulsen Pulsen Pulsfrequenzmodulation pulsierende Spannung Pulslängenmodulation Pulslängenmodulation Pult Pumpen Pumpenanlage Pumpimpuls Punkt stabilen Gleichgewichtes Punktabtastsystem punktbeschreibendes Element Punktfür‐ Punkt‐Diagrammaufzeichnung punktgesteuerter Roboterarm (Industrieroboterarm) Punkt‐Punkt‐Steuerung Punktschweißen Punktschweißmanipulator Punktschweißroboter Punktschweißzange Punktschweißzangenöffnen r Punktschweißzangenschließen Punktsteuerung Punktsteuerung Punktsteuerung Punktsteuerung eines Manipulators Punkttransformation punktweise Annäherung Punkt‐zu‐Punkt‐Steuerung Putzen von Gussstücken P‐Verhalten pseudolinear system pseudometric space pseudooperation pseudoprogram abstract computer pseudoscalar quantity pseudoscalar quantity pseudoscalar coupling pseudovector coupling pseudovector coupling pseudorandom sequence pseudorandom numbers first order lag element second order lag element second‐order system underdamped system overdamped system point‐to‐point control, PTP control processor, processing unit, PU buffer memory buffer storage buffer store prefetch buffer buffer module buffer function buffer circuit buffer module buffer register of robot control buffer buffer memory buffer storage buffer store buffer memory of robot control buffer control word, BCW buffer cascade buffer stage buffer stage of robot control buffer amplifier beat[ing] pulsing pulsation pulsation instability pulsation coefficient pulse‐code‐modulation transmission system beat[ing] pulsing pulsation pulse‐frequency modulation pulsating voltage impulse ratio modulation pulse width modulation console pump[ing] pumping plant pump pulse stable equilibrium point point‐to‐point scanning system point‐descriptive element point‐to‐point mapping graph spot‐controlled robot arm, point‐controlled industrial robot ar point‐to‐point control, PTP control spot welding spot welding manipulator spot welding robot portable spot‐welding gun spot welding tong opening spot welding tong closing coordinate setting manipulator point control point‐to‐point control, PTP control manipulator point control point transformation point approximation point‐to‐point control cleaning of castings P action stran 217 od 326 EN ‐DE: slovar avtomatizacije in robotike P‐Verhalten proportional action Pyrometer mit konstanter Brennweite fixed focus pyrometer PZ‐Regler proportional controller with disturbancevariable compensatio qasistationäres Verhalten quasi‐stationary behaviour Q‐Messer Q‐meter Quadrantenschaltung heterostatic circuit quadratisch quadratic quadratische Fehlerfläche quadratic error area quadratische Matrix square matrix quadratische Modulation quadrature modulation Quadratische Regelfläche integral of squared error (1SE) quadratische Regelfläche integral of squared error (ISE) quadratischer Mittelwert root‐mean square quadratisches Integralkriterium integral square estimation quadratisches Kriterium quadratic criterion quadratisches Mittelwertkriterium mean square estimation Quadraturoszillator quadrature oscillator qualification testing Qualifikationsprüfung qualitative Analyse qualitative analysis Qualitätskontrolle quality checking Qualitätslenkung quality direction quality engineering Qualitätstechnik quanteln quantize v Quantelung quantification Quantenbedingung quantum condition Quantendetektor quantum detector quantum electronics Quantenelektronik quantum frequency conversion Quantenfrequenzumsetzung Quantengrenze quantum limit Quantenniveau quantum level Quantenoptikgenerator quantum optical generator Quantenrauschen quantum noise Quantensystem quantum system Quantentheorie quantum theory Quantenverstärker quantum amplifier Quantenwirkungsgrad quantum efficiency quantisieren quantize v quantisiertes Signal quantized signal Quantisierung quantification Quantisierungsfehler quantification quantizing error Quantisierungsgeräusch n quantizing distortion Quantisierungsgeräusch n quantizing noise Quantisierungsgeräusch n quantization distortion Quantisierungsgeräusch n quantization noise Quantisierungskodierer quantizing coder quantization step Quantisierungsschritt quantizing distortion Quantisierungsverzerrung quantizing noise Quantisierungsverzerrung Quantisierungsverzerrung quantization distortion quantization noise Quantisierungsverzerrung quantitative Analyse quantitative analysis quantitative Gasdruckmessung quantitative measurement of gas pressure quantitatives Modell quantitative model quasi‐abgeglichene Brücke quasi‐balanced bridge quasi‐associated quasiassoziiert quasiassoziierter Modus quasi‐associated mode Quasiautomat quasi‐automaton quasiharmonische Schwingung quasi‐harmonic oscillation quasiharmonisches System quasi‐harmonic system quasikritische Dämpfung quasi‐critical damping quasilineares System quasi‐linear system Quasilinearisierung quasi‐linearization Quasimaschinenstruktur quasi‐machine structure quasimonochromatischer Laser nearly single‐frequency laser quasinatürliche Sprache quasi‐natural language quasiparallele Programmausführung quasi‐parallel program execution quasiparallele Programmausführung {Ausführung von Progra quasi‐parallel program execution quasiperiodisches Verhalten almost periodic behaviour, quasi‐periodic behaviour quasiperiodisches Verhalten almost periodic behaviour quasiperiodisches Verhalten quasi‐periodic behaviour quasistabil quasi‐stable quasistationär quasi‐stationary quasistatisch quasi‐static Quelladresse source address Quelladresse feines IR‐Programms source address of IR‐program Quelle für Lese‐Schreibstrom read‐write current source stran 218 od 326 EN ‐DE: slovar avtomatizacije in robotike Quelle kleiner Leistung Quelle verschiedener Strahlungsarten Quellenkonfiguration Quellenmodul Quellenprozess Quelllochband Quelloperand Quellprogramm Quellprogrammeditor Quellprogrammlänge Quellsprache Quellwiderstand Querbezugsliste Querdehnungszahl Querprüfung Querprüfung über Sicherungszeichen Querredundanzprüfung Querrichtungsempfindlichkeit Querschnitt Querstabilität Quirlen Quittungszeichen Quotientenmesser R622 Radar Radarbefehlsstelle Radardaten pl Radarecho Radarecho Radarfrequenz Radarreflektor radiale Armbewegung radioaktives Warngerät Radioautografie Radioautografie Radioautografie Radioautografie Radioautogramm Radioautogramm Radioautogramm Radioautogramm radioelektrischer Sensor radioelektrisches Fernsteuerungssystem Radioelektronik Radioisotopenmessmethode Radiometermanometer radiometrischer Analysator radiometrisches Dichtemessverfahren Radioortungsgerät Radiospektroskopie Rahmenschlußschutz Ramansche Spektrometrie Rampenantwort rampenförmiges Signal Rampenfunktion Rampensignal Randbedingungen Randelement Randintegral Randmaximum Randminimum Randstabilität Randwertproblem Randwertproblem Randwertschaltung Rang einer Matrix Rangordnung rationale ganzzahlige Funktion rationales numerisches System Rationalisierungsaufwand Rationalisierungseffekt Rationalisierungsgrad Rationalisierungsinvestition Rationalisierungskonzeption Rationalisierungsmittel Rationalisierungsmittelkonstruktion low‐power source multiple source source configuration source module producer process source punched tape source operand source program source program editor source program length source language source impedance cross reference table Poisson's ratio vertical check vertical redundancy check vertical redundancy check cross sensitivity cross section lateral stability conical scanning acknowledge[ment] signal ratiometer thrust movement of robot radar radar command post radar data radar echo blip radar frequency radar reflector radial lever movement radioactive warning device autoradiogram autoradiograph radioautograph radioautogram autoradiogram autoradiograph radioautograph radioautogram radioelectric sensor king class radioelectronics radioisotopic measuring method vacuum radiometer gauge radiometric analyzer radiometric method of density measuring radio‐direction finder radiospectroscopy frame leakage protection Raman spectrometry tamp response ramp signal tamp function linear rising signal boundary conditions boundary element circulation integral boundary maximum boundary minimum marginal stability boundary equation boundary value problem clamping circuit rank of matrix hierarchy rational integral function rational numerical system rationalization costs rationalization effect degree of rationalization rationalization investment program of rationalization means of rationalization construction of means of rationalization stran 219 od 326 EN ‐DE: slovar avtomatizacije in robotike rationelle Kombination Rauchgasprüfer Raum der Steuerwirkungen Raumbahn Raumbahnart raumfestes Koordinatensystem Raumkraft Raumkurve Raumkurvenapproximation Raumkurvendefinition räumliche Armbewegung räumliche Bewegung des Objekts räumliche Greiferbewegung räumliche Kurbelschleife räumliche Roboterarmbewegung räumliche Zuordnung räumlicher Mechanismus räumliches Koordinatensystem Raumpunkt Raumpunktfolge raumsparende Ausführung raumsparende Ausführung Raumüberwachungsgerät Raum‐Zeit‐Ausbeute raumzentriert Rauschanteil rauscharmer parametrischer Verstärker rauscharmer Verstärker Rauschbegrenzer rauschbegrenzt rauschbehaftet Rauscheigenschaften Rauscheinmischung Rauschen rauschen rauschend Rauschersatzschaltbild Rauschersatzschaltung Rauschfilter rauschfrei rauschfrei rauschfreier optimaler Regler Rauschgenerator Rauschgrenze Rauschimpuls Rauschkompensation Rauschleistung Rauschmesser Rauschmesser Rauschmessgerät Rauschmessgerät Rauschmessgerät Rauschpegel Rauschpegel Rauschpegel eines Stromkreises Rauschspektrum Rauschunempfindlichkeit Rauschverhältnis Rauschverhältnis Rauschverminderung RC‐Generator Reaktanz Reaktanzspannungsabfall Reaktanz‐Verzögerungslinie Reaktionskraft Reaktionskraft (bei automatischer Montage) Reaktionsmoment Reaktionsmoment (bei automatischer Montage) reaktionsschneller Regelungsalgorithmus Reaktionsträger Reaktionszeit Reaktionszeit Reaktionszeit eines IR Reaktor mit idealer Vermischung Reaktordynamik Reaktormodellierung rational combination flue‐gas analyzer space of control actions space path kind of space path space‐fixed coordinate system body force space curve approximation of space curve definition of space curve, definition of robot space curve spatial arm movement, spatial robot arm motion spatial movement of object, spatial motion of object spatial movement of gripper spatial Scotch yoke spatial arm movement, spatial robot arm motion spatial coordination spatial mechanism spatial coordinate system space point sequence of space points compact construction compact design area monitor space‐time yeld body‐centered noise component low‐noise parametric amplifier low‐noise amplifier noise limiter noise‐limited noisy noise properties noise interference noise noise v noisy noise equivalent circuit noise equivalent circuit noise suppressor noise‐free noiseless noise‐free optimal regulator noise generator noise threshold noise impulse noise compensation noise power decibelmeter noise test set noise measuring instrument noise meter noise test set noise level noise ratio circuit noise level noise spectrum noise immunity noise level noise ratio noise reduction capacitance‐resistance oscillator reactance reactance drop inductance‐capacitance delay line reaction force (on automatic assembly) reaction force (on automatic assembly) reaction moment (on automatic assembly) reaction moment (on automatic assembly) fast response regulation algorithm carrier of reaction reaction time time of response reaction time of IR perfectly mixed reactor reactor dynamics reactor modelling stran 220 od 326 EN ‐DE: slovar avtomatizacije in robotike Reaktorregelung Realautomat Realdiagramm reale aktuelle Arbeitsplatzposition reale Roboterbewegung reale Roboterumwelt reale Umwelt eines Industrieroboters realer Prozess reales Gas reales Gas realisierbares System Realisierbarkeitsbedingungen realisierter Fehler realisierter Versuch sauf bau realisierter Versuchsaufbau Realisierung einer Roboterlösung Realisierung eines digitalen Systems Realisierungsbasis realistische Wiedergabe Realstruktur Realteil Real‐Time‐Datenübertragungssteuerung Realwert Realwert Realwert Realzeituhr rech er unterstütztes Entwerfen und Fertigen Rechenanlage Rechenanlage Rechenanlage Rechenanlage Rechenaufgabe Rechenautomatentechnik Rechenautomatentechniker Rechenelement Rechenergebnis eines Roboterprogramms Rechenfrequenz Rechenfunktion Rechengenauigkeit Rechengeschwindigkeit Rechengeschwindigkeit Rechengesetz Rechenhilfsmittel Rechenhilfsmittel Rechenintervall Rechenmaschine f Rechenmaschine f Rechenmaschine f Rechenmaschine f Rechenmaschinenergebnis Rechenmathematik Rechenoperation Rechenoperation Rechenprogramm Rechenprogramm für Satzbau‐Analyse Rechenprozess Rechenprozess Rechenprüfung Rechenprüfung Rechenregister Rechenregister Rechentakt Rechenvorgang Rechenvorgang Rechenwerk Rechenwerk Rechenzeit Rechenzeit Rechenzeit Rechenzeitminimierung Rechenzentrale Rechenzentrale Rechenzentrum Rechenzentrum Rechner eines Industrieroboters Rechner für Diagnose reactor control real automaton real diagram real actual workplace position real robot movement real robot environment real robot environment actual cycle actual gas real gas feasible system feasibility conditions conscious error realized experimental arrangement realized experimental arrangement realization of robot solution digital system realization base of realization (theory of automata) realistic reproduction real structure real part real‐time data transmission control actual value real value desired value real‐time clock computer augmented design and manufacturing, CAD CAM, co computer computing machine calculating machine calculator computing problem computing automaton technique computer engineer computing element computing result of robot program calculating frequency calculating function computing accuracy computing speed computing velocity computing law computation aids computations means computing interval computer computing machine calculating machine calculator computer result calculus mathematics calculating operation arithmetical operation computing program computer program for structural analysis computational process computing process arithmetical check[ing] mathematical check[ing] arithmetic register calculating register computing interval computational process computing process arithmetic‐logic unit ALU computer time computing time machine time computing‐time minimization data processing centre computing centre data processing centre computing centre robot calculator, industrial robot calculator computer for diagnosis stran 221 od 326 EN ‐DE: slovar avtomatizacije in robotike Rechner für industrielle Verarbeitung computer for industrial processing Rechner für Roboteroptimierung computer of robot optimization computer for testing Rechner für Testung computer for machine tool control Rechner für Werkzeugmaschinensteuerung Rechner in biomedizinischer Forschung computer in biomedical research Rechner mit festem Programm fixed‐program computer Rechneradressenbus computer address bus Rechneranalyse computer analysis Rechneranwendung computer application Rechnerarchitektur computer architecture Rechnerbauelement computer component Rechnerbefehl computer instruction rechnerbestückt computerized rechnerbestückter Messplatz computerized measuring device, computerized test rack rechnerbestückter Messplatz computerized measuring device rechnerbestückter Messplatz computerized test rack rechnerbestückter Prüfautomat computerized automatic tester Rechnerblockdiagramm computer block diagram Rechnerblockschaltbild n computer block diagram Rechnerdaten pl eines Industrieroboters computer data of [industrial] robot Rechnerdrucker computer printer Rechnerentwerfer computer designer Rechnerergänzungsspeicher computer backing store Rechnerergebnis computer result rechnererstellte Originalschablone computer‐generated artwork rechnererzeugte Struktur computer‐produced structure Rechnergebiet computer field computerized rechnergeführt computer‐guided image identification rechnergeführte Bilderkennung computer‐guided numerical control rechnergeführte numerische Steuerung rechnergeführte Robotik computer‐guided robotics Computer managed instruction, CM! rechnergeführte Unterweisung rechnergeführter Messplatz computerized measuring assembly rechnergenerierte Information computer‐generated information rechnergeneriertes Roboterablaufprogramm computer‐generated robot operating schedule rechnergesteuerte Anzeige computer‐controlled display rechnergesteuerte Anzeige computer‐controlled display, CCD rechnergesteuerte digitale Steuerung computer‐controlled digital control rechnergesteuerte Koordinatentransformation computer‐controlled transformation of coordinates rechnergesteuerte Montage computer‐controlled assembly rechnergesteuerte Robotermontage computer‐controlled robot assembly rechnergesteuerte Sichtkontrolle computer‐controlled visual checking computer‐controlled unmanned factory rechnergesteuerte unbemannte Fabrik rechnergesteuerter Antrieb computer‐controlled drive rechnergesteuerter Fertigungsbereich computer‐controlled production region rechnergesteuerter Manipulator computer‐controlled manipulator rechnergesteuerter Prüfautomat computer‐controlled automatic tester rechnergesteuerter Roboter computer‐controlled robot rechnergesteuerter Sehvorgang computer‐controlled visual process rechnergesteuerter Zuschnittsroboter computer‐controlled cut robot rechnergesteuertes Fehlersuchen computer‐controlled error seek computer‐controlled measuring device rechnergesteuertes Messgerät rechnergesteuertes System für Sehvorgänge computer‐controHed system for visual processes rechnergesteuertes System für Sehvorgänge computer‐controlled system for visual processes rechnergesteuertes Verteilungszentrum computer‐controlled distribution centre computer‐aided presentation rechnergestützte Darstellung rechnergestützte Enwurfsmittel computer‐aided design librarcomputer‐aided design facilities computer‐aided manufacturing, CAM rechnergestützte Fertigung computer micrographics rechnergestützte Mikrografik rechnergestützte Programmierung computer‐aided programming rechnergestützte Programmierung computerassisted programming computer‐aided quality direction rechnergestützte Qualitätslenkung computer‐aided control data generation rechnergestützte Steuerdatenerzeugung rechnergestützte Textverarbeitung ordinateur computer‐aided text processing computer‐aided investigation rechnergestützte Untersuchung computer‐aided system design rechnergestützter Systementwurf rechnergestütztes Lernen computer‐assisted learning, CAL rechnergestütztes Lernen computer‐controlled manipulator computer‐assisted learning rechnergestütztes Logik‐Design automatic logic design rechnergestütztes Skizzieren und Entwerfen computer‐aided drafting and design, CAD, computer‐aided des rechnergestütztes strukturelles Detaillieren calculatrice computer‐aided structural detailing rechnergestütztes Zeichnen computer‐aided drawing Rechnergleichung machine equation Rechnergleichung computer equation Rechnergrafik computer graphics Rechnergruppe computer group stran 222 od 326 EN ‐DE: slovar avtomatizacije in robotike Rechnerindexregister Rechnerindikator Rechnerinstallation Rechnerinterface rechnerinterne Beschreibung rechnerinterne Darstellung rechnerinterne Darstellung rechnerinterne kodierte Beschreibung rechnerinterne Schablone rechnerinternes digitales Abbild (Bild) rechnerischer Grundteil Rechnerkapazität Rechnerkonfiguration rechnerkontrollierte Lieferung rechnerkontrollierte Zulieferung rechnerkontrollierte Zulieferung {Lieferung) rechnerkontrollierter Lagerbestand Rechnerkontrollzustand Rechnerkonzept Rechnerleistung Rechnerleistungsfähigkeit Rechnerliteratur Rechnerlogik Rechnermerkmal Rechnermerkmal Rechnermethode Rechnermodell Rechnermodule Rechnernetzwerk rechnerorientierter Algorithmus Rechnerperiode Rechnerperipherie Rechnerprogrammierungssystem Rechnerprüfprogramm Rechnerschnittstellenadapter Rechnersimulation digitaler Systeme Rechnersimulierung Rechnerspeichertrommel Rechnersprache Rechnersteuerung Rechnersteuerung Rechnersteuerung eines Manipulatorarbeitsplatzes Rechnersteuerung eines Manipulators Rechnersteuerung feines Manipulatorarbeitsplatzes Rechnerstruktur Rechnersystemaufbau Rechnersystemstruktur Rechnersystemstruktur Rechnertechnologie Rechnerterminal Rechnertest Rechner‐Übertragung rechnerunterstützte Fertigung rechnerunterstützte Montageeinrichtung rechnerunterstützte Programmierung rechnerunterstützte Robotermontage rechnerunterstützte Selektion rechnerunterstützte Signalauswertung rechnerunterstützte Verfahrenserkennung rechnerunterstützter Entwurf rechnerunterstütztes Entwerfen und Fertigen rechnerunterstütztes Entwerfen und Fertigen rechnerunterstütztes Entwerfen und Fertigen rechnerunterstütztes Ingenieurwesen rechnerunterstütztes Konstruieren Rechnerverfahren Rechnerwirkzeit Rechnerwort Rechnerzeit Rechnung Rechnung Rechnung von Differenzen rechte s‐Halbebene rechteckige Hystereseschleife rechteckige Hystereseschleife rechteckige Impulsmodulation computer index register computer indicator computer installation computer interface computer‐intern description computer‐intern representation machine representation computer‐intern coded description computer‐intern model computer‐intern digital image, computer‐internal digital imag arithmetic[al] element computer capacity computer configuration computer‐checked supplying computer‐checked supplying computer‐checked supplying computer‐checked stock computer checking state concept of computer computer performance computer capacity computer literature computer logic computer feature feature of the computer computer method computer model computer modules computer network computer‐oriented algorithm machine cycle computer peripherals computer programming system computer test routine computer interface adapter computer simulation of digital systems computer simulation computer memory drum machine language computer control manipulator computer control computer control of manipulator workplace manipulator computer control computer control of manipulator workplace computer structure construction of computer system structure of computer system computer system structure computer technology computer terminal computer check computer transfer computer‐assisted manufacturing computer‐assisted assembly device computer‐assisted programming computer‐assisted robot mounting, computer‐assisted robot a computer‐assisted selection computer‐assisted signal evaluation computer‐aided process identification computer‐aided design, CAD, computer‐aided conception computer augmented design and manufacturing CAD/CAM computeraided computer‐aided engineering computer‐aided drafting and design, CAD, computer‐aided des computer method machine‐available time machine word computer time calculation computation calculus of differences right half s‐plane (RHP) rectangular hysteresis loop square hysteresis loop square‐wave modulation stran 223 od 326 EN ‐DE: slovar avtomatizacije in robotike Rechteckimpuls Rechteckimpuls Rechteckmatrix rechteckmoduliert Rechteckwellenform rechteckwellenmoduliert Rechts‐Max‐Methode rechtwinklige Verteilung Redigiereinrichtung Reduktion redundante Bahnstruktur redundante Schaltung redundanter Modul redundantes System Redundanz Redundanzbaustein Redundanzbeseitigung Redundanzprüfung reduzibel reduzierte Frequenz reduzierte Gleichung reduzierter Fehler reduzierter Roboterberechnungsaufwand reelle Frequenzcharakteristik reelle Veränderliche reelles Element Referenzbild Referenzdaten pl Referenzgröße Referenzkoordinatensystem Referenzpunkt eines Roboters Referenzspannung Referenzwert Reflexionsnormaleinstellung Reflexschaltung Reflexschaltung Reflexsensor Reflexverstärker refraktometrische Analyse Refresh‐Periode Refresh‐Schaltung Refresh‐Steuerung Refresh‐Zyklus Regel Regel Regelabstand Regelabweichung Regelabweichung Regelabweichungssignal Regelaktion Regelalgorithmus Regelalgorithmus Regelanlage Regelanlage mit schmaler Unempfindlichkeitszone Regelantrieb Regelband Regelband Regelband regelbar regelbare Drosselspule regelbare Größe regelbare Induktivität regelbare Verstärkung regelbarer Antrieb eines Montageroboters regelbarer Autotransformator regelbarer Kondensator regelbares Dämpfungsglied regelbares Dämpfungsglied regelbares Dämpfungsglied Regelbarkeit Regelbarkeit regelbasierte Schlussfolgerung Regelbasis Regelbefehl Regelbefehl Regelbereich orthogonal pulse rectangular pulse rectangular matrix rectangular modulated rectangular waveform rectangular modulated last of maxima (LOM) defuzzification rectangular distribution editing equipment reduction redundant path structure redundant circuit redundant module redundant system redundancy redundant module redundancy elimination redundancy check reducible reduced frequency depressed equation reduced error reduced robot calculation expense real frequency characteristic real variable real element reference image reference data reference value reference coordinate system robot reference point reference voltage reference value adjustable reference mismatch double amplification circuit reflex circuit reflex sensor reflex amplifier refractometric analysis refresh period refresh circuit refresh control refresh cycle control rule control interval control deviation control error control error signal regulating action control algorithm regulation algorithm, regulating algorithm control installation control installation with narrow dead zone control drive zone of action control band regulation band controllable variable inductor regulating quantity continuously adjustable inductivity adjustable gain adjustable drive of assembly robot variable autotransformer variable capacitor adjustable attenuator, variolosser adjustable attenuator variolosser controllability readjustability rule‐based inference rule‐base control instruction forward signal control band stran 224 od 326 EN ‐DE: slovar avtomatizacije in robotike Regelbereich Regelbereich Regelbereich Regelbereich Regelbereich Regelbus Regeldauer Regeldifferenz Regeldrossel Regeleinrichtung Regeleinrichtung Regeleinrichtung Regeleinrichtung mit nachgebender Rückführung Regeleinrichtung mit nachgebender Rückführung Regelelement Regelfaktor Regelfläche Regelfläche Regelfühlglied Regelfunktion Regelgarnitur Regelgenauigkeit Regelgenauigkeit Regelgenauigkeit Regelgenauigkeit im Beharrungszustand Regelgenauigkeit im Beharrungszustand Regelgeschwindigkeit Regelgeschwindigkeit Regelgeschwindigkeit Regelgeschwindigkeit Regelgeschwindigkeit Regelgeschwindigkeit Regelgeschwindigkeit Regelglied Regelgrenzen Regelgröße Regelgröße Regelgröße Regelgröße einer Regelstrecke Regelgrößenbereich Regelgruppe Regelgüte Regelgüte Regelgüteverbesserung Regelgüteverbesserung Regelknopf Regelkondensator Regelkraftwerk Regelkreis Regelkreis Regelkreis eines Vakuummanometres Regelkreis mit nichtrationaler Übertragungsfunktion Regelkreis mit Übertragungsverzögerung Regelkreis mit veränderlicher Verstärkung Regelkreis mit vorgeschiebener Überschwingweite Regelkreiselement Regelkreisglied regellos regellose Füllung regellose Funktion regelloser Teil der Funktion regelmäßige Logikschaltungsstruktur regelmäßige Zellenstruktur Regelmedium regeln Regeln mit ODER‐Verknüpfung Regeln mit UND‐Verknüpfung regelnde Maschine Regelobjekt Regelobjekt Regelschaltung Regelschleife Regelschwankung Regelschwankung Regelsignal Regelsignal control range operating range control area control domain regulation band control bus control time control error regulating inductor control equipment control assembly controlling system elastic feedback controller variable feedback controller control element control action coefficient control area control domain control sensitive element control function control set accuracy of control accuracy of regulation regulation precision steady state control accuracy steady‐state control accuracy control rate controlrate correction rate regulation speed, control speed adjusting speed regulation speed control speed function element of controller control limits controlled parameter controlled value controlled variable controlled variable of controlled system controlled value range control assembly control effectiveness control performance improvement of control quality improved precision control key adjusting capacitor controlling power station control loop control system vacuum gauge control circuit control system with nonrational transfer function control circuit with transfer lag control circuit with variable amplification control circuit with prescribed overshoot loop element loop element random random filling random function irregular part of the function regular logic regular cell structure control agent control v disjunctive rules conjunctive rules controlling machine controlled device controlled member regulating circuit control loop hunting parasitic oscillations command signal control signal stran 225 od 326 EN ‐DE: slovar avtomatizacije in robotike Regelstabeichung Regelstrecke Regelstrecke Regelstrecke Regelstrecke eines Manipulators Regelstrecke mit Totzeit Regelstrecke ohne Ausgleich Regelstreckenanalyse Regelstreckencharakteristik Regelstreckencharakteristik Regelstreckendämpfung Regelstreckenkennlinie Regelsystem Regelsystem eines Industrieroboters Regelsystem eines Industrieroboters Regelsystemanalysator Regelsystemkomponente Regeltätigkeit Regelung Regelung Regelung Regelung Regelung Regelung Regelungdurch das Robotersteuerungssystem Regelungdurch visuelle Überwachung Regelung des Greifereinsatzes Regelung des Rückkopplungssystems Regelung durch Absorption Regelung durch Frequenzänderung Regelung durch Spannungsänderung Regelung durch visuelle Überwachung Regelung einer Bahnabweichung Regelung gemäß zweiter Ableitung Regelung im vermaschten Regelkreis Regelung kleiner Durchflussmengen Regelung kontinuierlicher Prozesse Regelung mit Beobachter Regelung mit festem Sollwert Regelung mit festem Sollwert Regelung mit geschlossenem Regelkreis Regelung mit geschlossenem Regelkreis Regelung mit geschlossenem Zyklus Regelung mit geschlossenem Zyklus Regelung mit Reglerverstärkung Regelung mit Störgrößenaufschaltung Regelung mit Störgrößenaufschaltung Regelung mit stufenlos einstellbaren Getrieben Regelungs‐ und Steuerungstechnik Regelungsalgorithmus Regelungsfolge Regelungsgenauigkeit Regelungsgenauigkeit Regelungsgenauigkeit Regelungsgeschwindigkeit Regelungsgeschwindigkeit Regelungsgeschwindigkeit Regelungsgeschwindigkeit Regelungsgesetz Regelungsintervall Regelungskoeffizient Regelungsnormalform Regelungspegel Regelungsprozess Regelungssabilität Regelungsstatik Regelungsstruktur Regelungsstufe Regelungssystem Regelungssystem Regelungssystem Regelungssystem Regelungssystem mit direkter Gegenkopplung Regelungssystem mit Hilfsenergie Regelungssystem mit Hilfsenergie Regelungssystem mit Totzeit control rod calibration controlled system plant plant (US) controlled system of manipulator controlled system with transportation lag astatic controlled system plant identification controlled plant characteristic plant characteristic plant attenuation plant characteristic closed‐loop control system robot regulating system, industrial robot regulating system [industrial] robot regulating system control system analyzer control system component regulating action automatic control closed‐loop control control automatic regulation self‐regulation control of metal transfer regulation by robot control system regulation by visual supervision regulation of gripper use control of feedback system absorption control variable‐frequency control variable‐voltage control regulation by visual supervision path deviation regulation second derivative control multicircuit control control of small flows continuous process control observer based control fixed set point regulation regulation with fixed set point closed‐cycle control closed‐loop control closed‐cycle control closed‐loop control servo‐operated control feed forward control feedf orward control control by means of infinitely variable gears automatics regulation algorithm, regulating algorithm control sequence accuracy of regulation, regulation precision, control accuracy control accuracy positioning control accuracy regulation speed, control speed adjusting speed regulation speed control speed control law control interval control coefficient controllable canonical form control level regulation process control stability control statics regulation structure control step auto feedback control system automatic feedback control system, control system feedback control system control system unity‐feedback control system indirect control system system with power amplification control system with time delay stran 226 od 326 EN ‐DE: slovar avtomatizacije in robotike Regelungssystem ohne Hilfsenergie Regelungssystementwurf Regelungstechnik Regelungstechnik Regelungstechnik Regelungstechnologie für fR Regelungstheorie Regelungstheorie Regelungstheorie Regelungsverhalten Regelungsvorgang Regelungswirkung Regelvariable Regelvariable Regelventil Regelventil Regelventil Regelventil für kleine Durchflussmengen Regelverfahren Regelverfahren Regelverhalten Regelverlauf Regelvorgang Regelwarte Regelwiderstand Regelwirkung Regelwirkung Regelwirkung mit teilweise unterdrücktem Bereich Regelzeit Regelzyklus regenerativer Impulsgenerator Regenerator Regenerator Regenerator regenerieren regenerieren Regenerierung Regenerierungszeit Register Registerbank Registerbefehl Registerdirektadressierung Registerindirektadressierung Registeroperationsbefehl Registerpaaradresse Registersatz Registerspeicher Registerspeicher Registerspeicher Registerstruktur Registrator stetiger Daten Registrierelement registrierender Beschleunigungsmesser registrierender Dichtemesser registrierender Doppelbereich‐ Durchflussmesser registrierender Gasanalysator registrierender Pegelanzeiger registrierender Schwärzungsmesser registrierendes Densitometer registrierendes Element eines Galvanometers registrierendes Mikrodensitometer registrierendes Niederdruckdurchflussmesser registrierendes Spektralfotometer Registrierfrequenzmesser Registriergerät Registriergerät Registrierinstrument Registriermechanismus Registriermessgerät Registriermessgerät Registrierpotentiometer Registrierregler Registriersatz registrierter Wert Registrierzählinstrument Registrierzählinstrument direct control system control design control engineering control system technology control technique robot regulating technology, IR regulating technology automatic control theory control theory theory of servomechanism control action, controller action regulation process control action, controller action command variable control variable air throttle governor valve regulating valve control valve for small flows control method regulation process, regulating process controller action control performance control action control centre regulating resistor controller action control action offset characteristic control time control cycle regenerative pulse generator regenerative repeater intermediate repeater regenerator reclaim v regenerate v regeneration recovery time register register bank register instruction register direct addressing register indirect addressing register instruction register pair address register record register memory, register store register memory register store register structure analog data recorder recording element recording acceloremeter recording densitometer double‐range recording flowmeter recording gas analyzer recording level gauge recording microdensitometer recording densitometer galvanometer recorder recording microdensitometer low‐pressure recording flowmeter recording spectrophotometer recording frequency meter autographic recording apparatus chart recorder chart recorder registering mechanism automatic recorder recording meter recording potentiometer recorder controller recording unit recorded value automatic recorder recording meter stran 227 od 326 EN ‐DE: slovar avtomatizacije in robotike Regler Regler Regler Regler Regler Regler Regler Regler für Fernheizungsanlage distance Regler mit bestmöglicher Ausregelung Regler mit Hilfsenergie Regler mit Hilfsenergie Regler mit mehrfachem Eingang Regler mit starrer Rückführung Regler mit stetigem Prüfsignal Regler mit Vorhalt Regler mit Vorhalt Regler mit Vorhalt Regler ohne Hilfsenergie Regler ohne Hilfsenergie Regler zur Ventilstellung Reglerbaueinheit Reglerfunktion Reglerspeisung Reglerstrecke Reglersystem Reglerübertragungsfunktion Reglerwiderstand Reglerwirkung Regression Regressionsanalyse Regressionskoeffizient regulär reguläre Logik reguläre Zellenstruktur regulärer Teil der Funktion reguläres Element regulierbare Skaleneinteilung Regulierbefehl Reguliertransformator Reibschweißen mittels Roboter Reibungsdämpfung Reibungskoeffizient Reihenaufstellung von Robotern Reihenbetrieb Reihendivergenz Reihenfolge Reihenfolge Reihenfolgemodell Reihenfolgemodell reihengeschaltete Drehzahlsteuerung reihengeschaltetes Korrekturglied Reihenkaskadenwirkung Reihenkonvergenz Reihenparallelregelung Reihenparallelschaltung Reihenparallelschaltung mit Brückenschaltung Reihenparallelsystem Reihenprüfung Reihenresonanz Reihenrobotermontage Reihenschaltung Reihenschaltung Reihenschluss‐Gleichstrommikromotor Reihenverfahren reine Laufzeit reine Laufzeit reine Trägheitsführung reine Verzögerung reine Verzögerung reißbrettorientierte Korrektur reißbrettorientierter Arbeitsplatz Rekombination Rekombinationskoeffizient Rekombinationsmechanismus Rekombinationsmodell Rekombinationsspektrum auto controller automatic controller compensator controller governor control device control unit long‐distance heating installation controller minimum error controller indirect action controller relay‐operated controller multiinput controller rigid feedback controller continuous test signal controller rate action controller differential controller D‐controller direct acting controller direct operating controller valve positioner packaged control unit controller action regulator supply regulator distance controller system controller transfer function controller resistance controller action regression regression analysis regression coefficient regular regular logic regular cell structure regular part of the function regular element adjustable scale adjustment instruction regulating transformer friction welding with robot frictional damping friction coefficient series positioning of robots, series arrangement of robots batch operation divergence of series chain (of action) sequence scheduling model sequencing model concatenation speed control sequential correcting element series cascade action convergence of series series‐parallel control series‐parallel circuit bridge transition series‐parallel system batch testing series resonance series robot mounting, series robot assembly cascade connection series connection series‐DC‐micro motor batch process pure time delay real dead time all‐inertial guidance pure time delay real dead time drawing board‐oriented correction drawing board‐oriented workplace recombination recombination coefficient recombination mechanism recombination model recombination spectrum stran 228 od 326 EN ‐DE: slovar avtomatizacije in robotike Rekursion Rekursionsformel Rekursionsfunktion Rekursionsrelation Rekursionsverfahren rekursiv rekursive Struktur rekursiver Selbstaufruf rekursives Filter rekursives Verfahren Relais für bestimmte Relais mit stabiler Mittelstellung Relais mit zwei festen Lagen Relaisbahnsteuerung eines Roboters Relaischarakteristik Relaisfernmesssystem Relaisgerätanordnung Relaisgruppe Relaiskennlinie Relaiskennlinie mit Unempfindlichkeitszone Relaiskettenstrukturformel Relaiskettensystem Relaiskompensation Relaiskontakt Relaiskreisbetriebszustand Relaismatrize Relaisnichtlinearität Relaisregelkreis Relaisregelung Relaisregelung Relaisregelung Relaisregelung Relaisregelung Relaisregler Relaisrückgangsfaktor Relaissatz Relaisschalterservomechanismus Relaisschaltung Relaisschütz Relaisschutzkanal Relaisstelle Relaissteuerung Relaissystem Relaissystemanordnung Relaisunterbrecher Relaiswählkreis Relaiswirkung Relation Relation Relation zwischen scharfen Mengen relationaler Fuzzy‐Regler relationaler Fuzzy‐Regler Relativadresse relative Abweichung der Stellgröße relative Adresse relative Amplitude relative Breite relative Dämpfung relative Dielektrizitätskonstante relative Empfindlichkeit relative Häufigkeit relative mittlere Rauschamplitude relative Regelabweichung relative Stabilität relative Streufunktion relative Streuung relative Winkelbeschleunigung relative Winkelgeschwindigkeit relativer Fehler relativer harmonischer Anteil relativer Kode relativer Parameter relativer Proportionalitätsbereich relativer Regelbereich relatives Maximum relatives Minimum recursion recursion formula recursive function recurrence relation recursive procedure recursive recursive structure recursive self‐call recursive filter recursive procedure definite time‐lag relay centre stable relay bang‐bang relay relay path control of robot relay characteristic relay telemetering system relay device structure relay group relay characteristic relay characteristic with dead zone relay circuit structural formula relay chain system relay compensation relay contact operating state of relay circuit relay matrix relay non‐linearity relay servomechanism relay control relay servomechanism bang‐bang control two‐stage control two‐step control relay controller relay reset coefficient relay group contactor servomechanism relay network relay fitted contactor relay protection channel repeater station relay control relay system relay system structure relay interrupter relay selecting circuit relay action relation relation[ship] binary relation Mamdani controller MAMDANI‐controller relative address relative deviation of manipulated variable relative address relative amplitude relative duration relative damping relative permittivity relative sensibility relative frequency normalized root‐mean square value relative deviation of controlled variable relative stability relative scattering function relative scatter intensity relative angle acceleration relative angle speed relative error relative harmonic cotent relative code relative parameter relative proportional band relative proportional band relative maximum relative minimum stran 229 od 326 EN ‐DE: slovar avtomatizacije in robotike relatives Programmieren relatives System Relativgeschwindigkeitsabfall Relaxationsgenerator Relaxationsgenerator Relaxationskreis Relaxationsschwingungen Relaxationsspektrum Relaxationszeit Remanenz Reparaturfähigkeit Reparaturroboter Repetierbarkeit Repetierbarkeit Repetierbarkeit repräsentativer Parameter Reproduktion einer Bewegungsbahn reproduzierbar Reproduzierbarkeit Reproduzierbarkeit Reproduzierbarkeit Re‐produzierbarkeit eines Roboters Reproduzierbarkeitsgrad Reserveausstattung Reservebetrieb Reserveeinheit Reservekanal Reservekühlsystem Reserve‐Notkühlsystem Reserveregelung Reserveschutz Reserveschutz Reservesystem Reservesystem Reservezuschaltung Reservezuschaltung residente Systemunterlagen Residuenmethode Residuentheorie Resolver Resolverpotentiometer Resonanz Resonanz ### Charakteristik Resonanz mit Hysterese Resonanzbreite Resonanzfrequenz Resonanzfrequenzmesser Resonanzkreisfrequenz Resonanzkreisfrequenz Resonanzkurve Resonanzmessverfahren Resonanznebenschluß Resonanzschaltung Resonanzverstärker Resonanzverstärker Resonanzwert des Amplitudengangs (PT2‐Element) Ressource Ressourcensteuerung Ressourcen‐Zuordnungsprozessor retardiertes Argument Reversibilität Reversibilitätsgrad Reversiersteuerung reziproke Übertragungsfunktion rezpiroke Richtigkeit Richtigstellung Richtmoment Richtrelais Richtung'der Montagebewegung richtungsabhängige Leitfähigkeit richtungsabhängiges Arbeiten Richtungsdiagramm Richtungsrelais richtungsunempfindliches Relais Riemann‐integrierbar relative programming relative system relative speed drop relaxation [pulse] generator relaxation [pulse] oscillator relaxation circuit relaxation oscillations relaxation spectrum relaxation time remanence maintainability repair robot repeatability, reproducibility reproducibility repeatability representative parameter reproduction of movement track reproducible reproducibility repeatability, reproducibility repeatability repeatability of robot, reproducibility of robot reproducibility degree backup equipment standby mode standby unit spare channel standby emergency cooling system standby emergency cooling system emergency control back‐up protection reserve protection backup system standby system standby connection back‐up connection resident software method of residues calculus of residues resolver resolver potentiometer resonant jump resonance jump resonance sharpness of resonance resonant frequency resonance frequency meter angular resonant frequency resonant angular frequency resonance curve resonance measuring method resonant shunt resonance circuit resonance amplifier tuned amplifier resonant peak magnitude resource resource control resource allocation processor retarded argument reversibility reversibility degree reversible control inverse transfer function inverse transfer function validity corrective action restoring torque directional relay assembly movement direction asymmetrical conductivity directional operation directional diagram directional relay non‐directional relay Riemann integrable stran 230 od 326 EN ‐DE: slovar avtomatizacije in robotike Riemannsches Integral Riemann integral Ringraumströmung annular flow Ringströmung annular flow Ringtransformator doughnut‐type transformer Ritzsche Methode Rayleigh‐Ritz method Ritz‐Verfahren Rayleigh‐Ritz method Robocarrier robocarrier, surface‐mobile robot Robofahrzeug robot vehicle Roboter [industrial] robot Roboter robot, industrial robot, IR Roboter (Industrieroboter) mit fünf Freiheitsgraden robot with five degrees of freedom, industrial robot with five d Roboter außer Betrieb robot out of operation Roboter für Behälterauswahl bin‐picking robot Roboter für die Montage von Bauteilen robot for assembly of components Roboter für die Schwerindustrie robot for heavy industry Roboter für explosionsgefährdete Räume robot for explosion endangered rooms Roboter für EX‐Räume robot for explosion endangered rooms Roboter für Falzpresse robot for shaving press Roboter für Hilfsoperationen robot for auxiliary operations Roboter für intelligentes Schweißen robot for intelligent welding Roboter für Kupplungsmontage coupling assembly robot Roboter für nukleare Probleme robot for nuclear problems Roboter für Sandstrahlbearbeitungen robot for sand‐blasting Roboter für Unterwasserarbeiten underwater robot Roboter für Verdrahtungsprüfungen robot for wiring tests Roboter Herstellung manufacture of robot, production of industrial robot Roboter in Betrieb robot in operation, robot working Roboter mit acht Werkzeugwechseln robot with eight tool changes Roboter mit amerikanischen Normen robot with American standard Roboter mit Bahnsteuerung robot with path control Roboter mit Erkennungsorgan robot with perception part Roboter mit europäischen Normen robot with European standards Roboter mit fotoelektrischem Sensor robot with photoelectric sensor Roboter mit gleichen Funktionen robots with equal functions Roboter mit großer Operationszahl many‐operations robot Roboter mit hoher Geschwindigkeit high‐speed robot Roboter mit künstlicher Intelligenz robot with artificial intelligence Roboter mit mechanischen Unterbaugruppen robot with mechanic subassemblies Roboter mit Netzwerksteuerungssystem robot with network control system Roboter mit numerischer Struktur robot with numerical structure Roboter mit Positionssteuerungssystem robot with position control system Roboter mit Punkt‐zu‐Punkt‐Steuerung robot with point‐to‐point control Roboter mit sechs Achsen six‐axis robot Roboter mit sechs Werkzeugen robot with six tools Roboter mit Standardelementen (standardisierten Bauelemenrobot with standard elements Roboter mit Tastsinn robot with tactile sense Roboter mit verbesserter Präzision robot with improved precision Roboter mit vier Achsen robot with four axles Roboter mit vier Freiheitsgraden robot with four degrees of freedom Roboter mit Wahrnehmung robot with tactile sense Roboter mit Wahrnehmungssystem robot with perception system Roboter mit Zentraleinheit robot with central processing unit Roboter Wirkglied effector Roboter zur Säuberung von Bauteilen parts cleaning robot Roboter) first development project (for manipulators, robots) Roboter‐2‐Achse Z‐axis of [industrial] robot Roboterabbau demounting of robot, dismounting of robots Roboterabfrageeinrichtung robot interrogation unit roboterabhängig robot‐dependent roboterabhängige Komponente component dependent on robot roboterabhängige Positioniergenauigkeit robot‐dependent positioning exactitude roboterabhängiges Reglersystem control system dependent on robot roboterabhängiges Stellglied final control element dependent on robot Roboterablauf Programmierung trace programming of IR Roboterablaufprogramm robot sequence program Roboterabmessungen robot dimensions Roboterabnahmeprüfung robot acceptance checking Roboterabschaltkreis disconnection circuit of robot Roboterabschaltvorrichtung switching‐off equipment of robot Roboterabsolutposition f. Absolutposition feines Roboters absolute position of robot Roboterachsantrieb axis drive of industrial robot, robot axis drive Roboterachse robot axis Roboterachskombinationen robot axis combinations, axis combinations of industrial robot Roboterachsregelung robot axis regulation Roboteraktion robot action Roboteraktionsplan robots operation plan stran 231 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboteraktionssystem robot action system Roboteraktor actuator of robot Roboteraktuator actuator of robot Roboteralgorithmus robot algorithm Roboteranalyseprogramm robot analysis program Roboteranforderung robot demand Roboteranlage robot equipment Roboteranordnung robot arrangement, industrial robot arrangement Roboteranordnungsvariante robot arrangement variant Roboteranpassung robot adaptation Roboteranschaffungskosten pi robot prime cost Roboteranschauungsmodell robot demonstration model Roboteranschluss robot connection, IR connection Roboteranschlusswert robot connection value Roboterantrieb [industrial] robot drive Roboterantrieb robot drive, industrial robot drive Roboterantrieb mit einstellbarer Geschwindigkeit robot drive with adjustable speed Roboterantriebsart robot kind of drive, IR kind of drive Roboterantriebsbeschleunigung acceleration of robot drive Roboterantriebsbewegung robot drive movement Roboterantriebsdynamik drive dynamics of robot Roboterantriebsgeschwindigkeit speed of robot drive Roboterantriebskosten pl costs of robot drive Roboterantriebsmasse robot drive mass Roboterantriebsmoment robot drive moment Roboterantriebsweg path of robot drive Roboterantriebswerte drive data of robot, drive data of industrial robot Roboterantriebswirkungsgrad robot drive efficiency Roboteranwender robot user, industrial robot user Roboteranwendung robot use, robot application Roboteranwendungsgebiet field of application for robots Roboterarbeitsgeschwindigkeit robot working speed Roboterarbeitsorganisation robot operating schedule Roboterarbeitsplatz robot workplace Roboterarbeitsprogramm working program of robot Roboterarbeitspunkt robot working point Roboterarbeitsraum robot working room Roboterarbeitsseite robot operating side Roboterarbeitstrajektorie robot working trajectory Roboterarbeitswiderstand dynamic resistance of a robot Roboterarm robot arm, arm of robot, robot lever Roboterarm mit automatischer Verschlusseinrichtung robot arm with automatic shutter Roboterarmaturen robot fittings Roboterarmbewegung robot arm movement, robot lever movement Roboterarmbewegungen robot arm movements ac‐ Roboterarmdrehgelenk robot lever swivel joint Roboterarmelastizität r* robot arm elasticity Roboterarmelement robot arm element Roboterarmfühler robot arm sensor Roboterarmgenauigkeit L Genauigkeit eines Roboterarms robot arm precision Roboterarmmontage f. Montage mittels Roboterarms robot arm assembly Roboterarmposition t position of robot arm (lever), position of industrial robot arm Roboterarmpositionierung robot arm positioning Roboterarmprogrammierung robot arm programming Roboterarmstellung position of robot arm (lever), position of industrial robot arm Roboterarmverschiebung robot arm shifting, arm shifting] of robot Roboteraufbau robot assembly Roboteraufgabenbeschreibung robot task description Roboteraufgabenbeschreibung i Aufgabenbeschreibung für ei robot task description Roboterauge robot eye Roboterausgabeeinrichtung robot output device Roboterausgabekanal robot output channel, IR output channel Roboterauslastung robot utilization, industrial robot utilization Roboterausrüstung robots equipment, equipment of robots Roboterausstattung robots equipment, equipment of robots Roboterauswahlkriterien choice criterions for robots Roboterautisierung robot automation Roboterautomatisierung robot automation Roboterbahn robot path Roboterbahndefinition definition of robot path Roboterbahnelemente path elements of industrial robot Roboterbahnfehler path error of IR Roboterbahnkoordinate coordinate of robot path Roboterbahnoptimierung robot path optimization Roboterbahnposition path position of [industrial] robot, path position of IR Roboterbahnprogramm path program of IR stran 232 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboterbahnrechner robot path computer Roboterbahnsegmente robot path segments Roboterbahnsteuerung path control of [industrial] robot, path control of IR Roboterbasis robot base, IR base Roboterbasisstruktur basic structure of robot Roboterbau m. Industrieroboterbau manufacture of robot, production of industrial robot Roboterbauelement robot component Roboterbaugruppenmontage robot assembly mounting Roboterbaukasten robot building‐block, industrial robot assembly unit Roboterbaukasten zur Montagerealisierung robot assembly unit for assembly realization, industrial robot Roboterbaukastensystem robot building‐block system Roboterbaukastensystem robots robot building‐block system Roboterbaustein robot component Roboterbeanspruchung load of robot, robot stress Roboterbedienelement operator element of robot Roboterbedienkomfort operator comfort of robot Roboterbedienprogramm robot service program Roboterbedienung robot operator attenuation Roboterbedienungsfeld robot control panel, robot patch panel Roboterbedienungsseite robot operating side Roboterbefehl robot command, industrial robot command Roboterberechnungsaufwand robot calculation expense Roboterbereich robot range Roboterberührungssensor robot contact sensor, IR contact sensor Roboterbeschichten robot coating, coating by robot Roboterbeschleunigung robot acceleration Roboterbeschleunigungsbetrag robot acceleration value Roboterbeschleunigungsphase acceleration phase of robot Roboterbeschleunigungswert robot acceleration value Roboterbestandteil robot component Roboterbestimmung robot definition, robot designation roboterbestückte Fertigungszelle manufacturing cell equipped with robot Roboterbetriebsanleitung operating instruction for robot Roboterbetriebsbedingungen robot operating conditions Roboterbetriebskosten pl operating costs of robot Roboterbetriebskosten pl operating data of robots Roboterbetriebsschalter operating switch of robot Roboterbetriebssicherheit operation safety of industrial robot, reliability in service of ind Roboterbetriebsspannung operating voltage of robot Roboterbetriebsverhalten robot operation performance Roboterbewegung robot movement, robot motion Roboterbewegung von Werkzeugmaschine zu Werkzeugmasc robot movement from machine tool to machine tool Roboterbewegung von Werkzeugmaschine zum Lager robot movement from machine tool to store Roboterbewegungsablauf sequence of robot movements Roboterbewegungsbahn robot movement path, robot trajectory, industrial robot trajec Roboterbewegungsbefehl robot movement instruction Roboterbewegungsgleichung robot movement equation, robot motion equation Roboterbewegungskontrolle robot movement checking, robot motion checking Roboterbewegungsoptimierung robot movement optimization Roboterbewegungsprogrammierung robot movement programming Roboterbewegungsschritt robot movement step, industrial robot movement step Roboterbewegungsstopp robot movement stop Roboterbewegungsstufe movement stage of robot Roboterbewegungszyklus movement cycle of IR, robot movement cycle Roboterbild robot image Roboterbildinformation robot image information Roboter‐Bio‐Hand bio‐hand of IR, robot bio‐hand Roboterblockdiagramm block diagram of robot Roboterbohrmontage robot drill assembly Roboterbunker bunker of robot, robot bunker Roboterbussteuerung robot bus control, IR bus control Roboterdämpfer robot antivibrator Roboterdatei robot file Roboterdaten robot parameters, robot data, data of industrial robot Roboterdatenspeicher memory for robot data Roboterdatenspeicherung robot data storage Roboterdatentransport robot data transport Roboterdefektanalyse robot defect analysis Roboterdefektauswirkung robot defect effect Roboterdefinition r robot definition, robot designation Roboterdemontage demounting of robot, dismounting of robots Roboterdiagnose robot diagnostic Roboterdiagnosehilfen diagnostic aids of robot Roboterdiagnosesystem diagnostic system of robot Roboterdialog robot dialogue Roboterdialogprogrammierung conversational programming of industrial robot, dialogue prog stran 233 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboterdiskette Roboterdisplay Roboterdreheinheit Roboterdrehgelenk Roboterdrehgelenkachse Roboterdrehständer Roboterdruckluftleitung Roboterduplexbetrieb Roboterdurchlaufzeit Roboterdynamik Robotereaktionsgeschwindigkeit Robotereffektor Robotereffektorkoordinaten Robotereffektormagazin Robotereigenfrequenz Robotereinbeziehung Robotereinbeziehung Robotereinbeziehung Robotereinbeziehung Robotereinbeziehung Robotereingabeeinrichtung Robotereingangsleistung Robotereinheit Robotereinrichtung Robotereinsatz Robotereinsatz Robotereinsatz Robotereinsatz Robotereinsatz Robotereinsatz Robotereinsatzbedingung Robotereinsatzbereich Robotereinsatzcharakteristik Robotereinsatzkomponente Robotereinsatzorganisation Robotereinsatztechnik Robotereinsatzvariante Robotereinsatzvorbereitung Robotereinteilung Robotereinzelmaschine Roboterelektronik Roboterelement Roboter‐Endeinrichtung Roboterendkörper Roboterendschalter Roboterentfernungsbestimmung Roboterentgraten Roboterentwicklung Roboterentwicklungsplan Roboterentwicklungsprojekt Roboterentwicklungsstufe Roboterentwurf Robotererkennungseinrichtung Robotererkennungsproblem Robotererkennungssoftware Robotererkennungssystem Roboterersatzteil Roboterfähigkeit Roboterfahrzeug Roboterfamilie Roboterfarberkennung Roboterfehler Roboterfehleranzeige Roboterfehlerbeseitigung Roboterfehlerdiagramm Roboterfehlererkennung Roboterfehlermeldung Roboterfehlerrate Roboterfehlerschutz Roboterfehlersignal Roboterfeinbewegung Roboterfeinpositionierung Roboterfertigmontage Roboterfertigungsablauf Roboterfertigungsprogramm Roboterfertigungsstückzahl robot diskette robot display robot rotation unit rotation joint of robot swivel joint axis of robot rotating support of robot robot compressed air line robot duplex operation robot turnaround time robot dynamics action speed of robot, robot action speed robot effector, effector of Industrial robot robot effector coordinates effector magazine of robot natural frequency of robot robot operation, industrial robot operation, application of rob applications of robots industrial robot operation robot operation use of robots robot input device input power of robot robot unit robot equipment applications of robots robot operation, industrial robot operation, application of rob robots application, industrial robots application industrial robot operation robot operation use of robots robot application condition robot use region, use region of industrial robot robot application characteristic robot application component robot operating schedule robot application technique robot application variant preparation of robot use robot classification robot single machine robot electronics, industrial robot electronics robot element robot final installation final body of robot limit switch of robot robot distance identification robot deburring, deburring by robot robot development robots development plan robots development project robot development stage robot design, robot [hardware] construction robot identification device robot identification problem robot identification software robot identification system, IR identification system robot spare part capability of robot robot vehicle family of robots robot colour identification robot fault robot error indication, fault indication of robot robot error deletion robot faults diagram robot error detection, fault detection of robot robot error message robot error rate, fault rate of robot robot error protection robot error signal, industrial robot error signal fine motion (movement) of robot fine positioning of robot, fine positioning of industrial robot end assembly by means of the industrial robot robot manufacturing sequence, manufacturing sequence by m robot manufacturing program production rate (of robot) stran 234 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboterfinger robot finger Roboterfingergelenkzahl number of robot finger joints Roboterfingersystem robot finger system Roboterfirma company of robots Roboterflexibilität i IR‐Flexibilität robot flexibility, IR flexibility Roboterflexibilitätsgrad degree of robot flexibility Roboterfolgeprogrammierung robot sequential programming Roboterfolgesteuerung robot sequential control Roboterfolgezustand robot sequence state Roboterform robot form Roboterformerkennung robot form identification Roboterforschung robot research, industrial robot research Roboterforschungslabor robot research workshop Roboterfreiheitsgrad freedom degree of robot, freedom degree of industrial robot Roboterfrontplatte robot front panel Roboterfügen robot jointing Roboterfügeoperation robot Jointing operation, IR jointing operation Roboterfügevorgang jointing process of [industrial] robot Roboterfühler robot arm sensor Roboterführung robot guide Roboterfunktion robot function Roboterfunktionskriterien robots functional criteria Roboterfunktionsmöglichkeit robot operating possibility Roboterg reif kraft robot grip power, grip power of industrial robot robotergebundene Einrichtung robot‐attached device, industrial robot‐attached device robotergebundenes Werkzeug robot‐attached tool, industrial robot attached tool robotergeführte Spritzpistole robot‐guided spray gun robotergeführter Greifer robot‐guided gripper Robotergehäuse robot case Robotergelenk robot joint Robotergelenkbewegung robot joint movement Robotergelenkeinheit robot joint unit, IR joint unit Robotergelenkkoordinate robot joint coordinate Robotergelenkspiel robot joint clearance Robotergelenkwinkel joint angle of robot Robotergenauigkeit accuracy of robot, robot precision Robotergeneration robot generation, industrial robot generation Robotergeometrie robot geometry Robotergerätefehler robot device error robotergerechte Fügeflächengestaltung modelling of joint surface suitable to robot robotergerechte Informationsmenge information quantity suitable to robot robotergerechte Konstruktion construction suitable to robot robotergerechte Lösung solution according to robot robotergerechte Produktion production suitable to robot robotergerechte Schweißkonstruktion robot‐like welding construction robotergerechter Entwicklungsprozess development process suitable to robot robotergerechtes Konstruieren construction suitable to robot robotergerechtes Verbindungselement linkage element according to robot Robotergesamtsystem total system of robot Robotergeschwindigkeit t IR‐Geschwindigkeit robot speed, industrial robot speed Robotergestaltung robot portrait Robotergestell robot frame Robotergestellelement robot frame element, frame element of industrial robot Robotergestellsystematik robot frame systematics robotergesteuerter Prozess robot‐controlled process robotergestützte automatische Montage robot‐aided automatic assembly Robotergetriebe robot gear Robotergetriebeplan robot gear plan Robotergewicht robot weight Robotergewichtsdaten pi robot weight data Robotergleitgelenk sliding joint of robot Robotergravitationskraft gravitational force of robot Robotergreifer robot gripper, industrial robot gripper Robotergreiferführung robot gripper guide, industrial robot gripper guide Robotergreiferhandform shape of robot gripper hand Robotergreiferorientierung gripper orientation of robot Robotergreifersystem robot gripper system Robotergreifertyp robot gripper type, industrial robot gripper type Robotergreifkontrolle grip checking of robot Robotergreiforgan robot grip organ Robotergreifsystem robot grip system Robotergrobbewegung fr Grobbewegung eines Montagerobot gross motion of robot, gross movement of assembly robot Robotergrobposition coarse position of robot, coarse position of industrial robot Robotergrundbauelemente robot basic elements Robotergrundbaugruppe robot basic unit Robotergrundbewegung robot base movement stran 235 od 326 EN ‐DE: slovar avtomatizacije in robotike Robotergrundplatte robot base plate Robotergrundstruktur basic structure of robot Roboterhaltevorrichtung robot support, support of industrial robot Roboterhaltezange robot gripping pliers Roboterhand robot hand Roboterhand mit drei Freiheitsgraden robot hand with three degrees of freedom Roboterhand mit elastischen Fingern robot hand with elastic fingers Roboterhandantrieb hand drive of robot Roboterhandfinger finger of robot hand Roboterhandgelenk hand Joint of [industrial] robot robot handling time, handling time of IR Roboterhandhabezeit f. Handhabezeit feines IR Roboterhandhabungsprozess robot handling process Roboterhandprothese robot hand prosthesis Roboterhardware robot hardware, IR hardware Roboterhardwarekonstruktion robot design, robot [hardware] construction Roboterhardwarelösung [industrial] robot hardware solution Roboterhardwarelösung robot hardware solution, industrial robot hardware solution Roboterhardwarestruktur robot hardware structure Roboterhauptachse principal axis of robot Roboterhauptbaugruppe robot main group of parts, industrial robot main group of part Roboterhaupttechnologien main robots technologies, main technologies of robots Roboterhersteller producer of robots Roboterherstellungsprogramm robot manufacturing program Roboterherstellungswerk producer of robots Roboterhintergrundrechner robot background computer Roboterhubeinheit robot stroke unit Roboterindustrie industry of robots Roboterinformation robot information Roboterinformationsaufnahme robot information recording Roboterinformationselektronik robot information electronics Roboterinformationsfluss robot information flux, industrial robot information flux Roboterinformationsverarbeitung robot information processing Roboterinformationsverarbeitung robot information processing, IR information processing Roboterinitiator (Positionsgeber) robot cam (position indicator) Roboterinspektionssystem robot inspection system Roboterinstallation robot installation, industrial robot installation Roboterinstallationsrentabilität profitability of robots installation Roboterinstruktion robot instruction Roboterintegration robot integration roboterintegrierte technologische Einheit robot‐integrated technological unit roboterintegriertes Bearbeitungssystem robot‐integrated treatment system roboterintegriertes Montagesystem robot‐integrated assembly system Roboterintelligenz robot intelligence roboterinterner Temperaturregler robot‐intern temperature regulator roboterinternes Messgerät measuring device inserted into robot roboterisierte (durch Roboter ausgeführte) Arbeitsgänge operations executed by robots roboterisiertes Formelement roboterized form element Roboterisierung robotization Roboteristerung robotization Roboterkartensteuerung card for robot control Roboterkassetteneinrichtung device of robot cassette Roboterkategorie robot category Roboterkategorienbestimmung designation of robot category Roboterkennwerte robot parameters, robot data, data of industrial robot Roboterkennzeichnung robot marking, industrial robot marking Roboterkinematik robot kinematics roboterkinematisches Problem robot‐kinematic problem Roboterklassifikation robot classification Roboterklassifizierung robot classification Roboterknickarmbewegung buckling arm movement of robot Roboterkollisionsbedingung robot collision condition Roboterkollisionsraum collision room of robot, robot collision room Roboterkollisionsschutz robot collision protection, industrial robot collision protection Roboterkombination combination of robots Roboterkomplexibilität robot complexibility, IR complexibiiity Roboterkonfiguration robot configuration Roboterkonstruktion robot construction, industrial robot construction Roboterkonstruktion robot design, robot [hardware] construction Roboterkonstruktion mit mikrorechnerunterstütztem reißbrerobot construction with microcomputer‐aided and drawingbo Roboterkonstruktionsbüro engineering office for robots Roboterkontrolle robot checking], industrial robot check[ing] Roboterkontrollschirm checking screen of industrial robot, check screen of industrial Roboterkontrollsteuerungssystem robot checking control system Roboterkontrollsystem checking system of robot, check system of robot Roboterkoordinaten robot coordinates, industrial robot coordinates Roboterkoordinatenachse robot axis of coordinates stran 236 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboterkoordinatenberechnung Roboterkoordinatentransformation Roboterkopplung Roboterkorrekturdaten pl Roboterkraft Roboterkraftbestimmung Roboterkraftmessdose Roboterkraftsensor Roboterkundendienst Roboterlage Roboterlageerkennung Roboterlagerung Roboterlayout Roboterlebensdauer Roboterleistung Roboterleistungsaufnahme Roboterleistungselektronik Roboterleistungsfluss Roboterlösung Robotermagazin Robotermakrobewegung Robotermarkt Roboter‐Maschinen‐System Roboter‐Maschinen‐Zusammenarbeit Robotermaterial Robotermatrizenauswertung Robotermechanik Robotermehrzweckgreifer Robotermerkmal Robotermesseinrichtung Robotermessposition Robotermesswert Robotermikroprozessor Robotermikroprozessorsteuerung Robotermikrorechner Robotermodell Robotermodellierung Robotermodernisierung Robotermodul Robotermodulbaustein Robotermonitor Robotermontage Robotermontage Robotermontage einer Baugruppe Robotermontageablauf Robotermontagearbeitsplatz Robotermontagebahn Robotermontagebewegung Robotermontageebene Robotermontagefähigkeit robotermontagegerechte Darstellung robotermontagegerechte Information robotermontagegerechte Produktionskonstruktion robotermontagegerechte Strategie robotermontagegerechtes Bauelement robotermontagegerechtes Fügen Robotermontagegraph Robotermontagekonzept Robotermontagekosten pl Robotermontageoperation Robotermontageorganisation i robotermontageorientierte Bewertung Robotermontageplanung Robotermontageproblem Robotermontageprozess Robotermontagerichtung t Richtung einer Robotermontage Robotermontagestation Robotermontagesystem Robotermontageversuch Robotermontagezeit Robotermontagezustand Robotermontagezyklus robotermontangegerechter Standard Robotermonteur robotermontierte Lichtmaschine robotermontierte Maschine robot coordinates calculation robot coordinates transformation robot coupling robot correction data robot force robot force identification robot force measuring gage force sensor of industrial robot robot servicing, robot maintenance, IR servicing, robots servic robot position robot position identification, robot position distinguishing support of robot layout of an industrial robot life of robot robot performance, robot power power input of robot robot power electronics robot power flux, industrial robot power flux robot solution robot magazine, magazine of industrial robot robot macro‐movement, macro‐movement of industrial robot robot market, industrial robot market, IR market robot‐machine system robot‐machine cooperation robot material matrix evaluation of robot robot mechanics general‐purpose gripper of robot robot feature robot measuring device measuring position of robot robot measuring value microprocessor of [industrial] robot microprocessor control of industrial robot robot microcomputer robot model robot modeling modernization of robots module of robot robot module element monitor of robot robot mounting, robot assemblage, industrial robot mounting, robot assembly robot assembly mounting robot assembly sequence, mounting sequence by means of the montage station of robot, working station of robot robot assembly path robot mounting motion, industrial robot mounting motion plane of robot assembly capacity of robot assembly representation suitable to robot assembly information suitable to robot production construction suitable to robot assembly strategy suitable to robot assembly component suitable to robot assembly jointing suitable to robot assembly robot montage graph robot assembly draft robot assembly costs robot assemblage operation, IR assemblage operation robot assembly organization valuation oriented on robot assembly robot mounting planning, robot assembly planning assembly problem of [industrial] robot robot assembly process robot assembly direction robot assembly station robot assembly system robot assembly test, industrial assembly test time of robot assembly assembly state of [industrial] robot robot assembly cycle, industrial robot mounting cycle standard suitable to robot assembly robot fitter robot‐assembled dynamo robot‐assembled machine stran 237 od 326 EN ‐DE: slovar avtomatizacije in robotike robotermontierte Scheibe robotermontierte Verschraubung robotermontierte Welle robotermontierter Kühlschrank robotermontierter Motor robotermontierter Staubsauger robotermontiertes Fahrzeug robotermontiertes Gehäuse robotermontiertes Kugellager Robotermotor Robotermustererkennung Robotermusterfunktion Roboternachlaufsystem Roboternäherungssensor Roboternebenstation Roboternietung Roboternocken Roboter‐Not‐Aus‐Taster Roboternotschalter Roboternutzen Roboternutzungsfaktor Roboterobjekt Roboterobjekterfassung Roboterobjekterkennung Roboterobjektmasse Roboterobjektspeicher Roboteroperationsgenauigkeit Roboteroperationsgeschwindigkeit Roboter‐Operationskette Roboteroperationskriterien Roboteroperator Roboteroperatorenfolge Roboteroptimierung Roboteroptimierungsrechner Roboterordnungseinrichtung Roboterorientierung Roboterorientierungskode Roboterpalette Roboterparameter Roboterpatent Roboterperipherie Roboterpilotanlage Roboterplatzbedarf Roboter‐Playback Roboterporträt Roboterposition Roboterpositioniereinrichtung Roboterpositionierfehler Roboterpositioniergenauigkeit Roboterpositionierung Roboterpositionierungssystem Roboterpositionierzeit Roboterpositionsabweichung Roboterpositionsanzeige Roboterpositionsdaten pl Roboterprobebewegung Roboterprobebewegung r* Roboterproblem Roboterproblemprogrammierung Roboterproblemtechnik Roboterproduktionskosten pi Roboterproduktivität Roboterproduktmontage Roboterproduzent Roboterprogramm Roboterprogrammänderung Roboterprogrammausgabe Roboterprogrammgenerierung Roboterprogrammiereigenschaft Roboterprogrammierer Roboterprogrammierlauf Roboterprogrammiersystem Roboterprogrammierung Roboterprogrammierung in natürlicher Sprache Roboterprogrammierungsfehler Roboterprogrammierungsmethode robot‐assembled disk robot‐assembled screw cap robot‐assembled shaft robot‐assembled refrigerator robot‐assembled motor robot‐assembled vacuum cleaner robot‐assembled vehicle robot‐assembled housing robot‐assembled ball bearing robot motor robot master identification robot pattern function robot follow‐up system robot proximity sensor slave station of robot, robot slave station robot riveting, riveting by means of the industrial robot robot cam (position indicator) off‐emergency of industrial robot emergency switch (of industrial robot) robots gain working factor of industrial robot robot object robot object registration robot object recognition robot object mass, industrial robot object mass robot object memory operation accuracy of robot operation speed of robot robot operation chain, IR‐operation chain robot operational criteria robot operator robot operator sequence, operator sequence of industrial robo robot optimization computer of robot optimization robot order device robot orientation robot orientation code pallet of robot robot parameters, robot data, data of industrial robot robot patent robot periphery, IR periphery robot pilot plant robot floor space required, IR floor space required robot play‐back robot portrait robot position robot positioning device, industrial robot positioning device robot positioning error robot positioning accuracy, industrial robot positioning accura robot positioning robot positioning system robot positioning time robot position deviation position indication of IR position data of robot robot testing movement robot testing movement robot problem programming of robot problems robot problem technique robot manufacturing costs productivity of robots, efficiency of robots robot product assembly producer of robots robot program, industrial robot program modification of robot program robot program output robot program generation robot programming property robot programmer, industrial robot programmer robot programming pass robot programming system robot programming robot programming in natural language robot programming fault robot programming method stran 238 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboterprogrammierungsproblem Roboterprogrammierungssprache Roboterprogrammkode Roboterprogrammkodierung Roboterprogrammkompatibilität Roboterprogrammoperator Roboterprogrammpaket Roboterprogrammschritt Roboterprogrammspeicherung Roboterprogrammsteuerung Roboterprogrammsteuerungssystem Roboterprogrammsteuerungssystem robot Roboterprogrammsystem roboterprozessflexible Lösung roboterprozessflexible Montage roboterprozessflexibler Automat roboterprozessflexibles Montagesystem roboterprozessflexibles System Roboterprozessinformation Roboterprozessinformation Roboterprozessor Roboterprozessrechner Roboterprüfeinrichtung Roboterprüfprogramm Roboterpunktsteuerung Roboterraum Roboterraumbahn Roboterraumkurve Roboterreaktionsfähigkeit Roboterrechner Roboterrechnerarchitektur f Roboterrechnerdaten pl Roboterrechneroperation Roboterrechnerperipherie Roboterrechnersteuerung Roboterrechnersystem Roboterreferenzpunkt Roboterregel System Roboterregelabweichung Roboterregelalgorithmus Roboterregelsystem Roboterregelung Roboterregelungstechnologie Roboterregelungstechnologie Roboterregler Roboterregler Roboterreglersystem Roboterreibungskräfte Roboterrentabilitätsproblem Roboterreparatur Roboterrepetierbarkeit Roboterresolver Roboterrotationsachse Robotersatznummer Roboterschaltbrett Roboterschaltelement Roboterschaltinformation Roboterschaltschrank Roboterschalttafel Roboterschleifen Roboterschlitten Roboterschnittstelle Roboterschraubendreher Roboterschraubverbindung Roboterschrittmotor Roboterschubbewegung Roboterschubgelenk Roboterschultergelenk Roboterschweißbrenner Roboterschweißen Roboterschwenkeinheit Robotersensor Robotersensordaten pl Robotersensorik Robotersensorinformation Robotersensorsteuerung robot programming problem robot programming language robot program code robot program coding compatibility of robot program robot program operator program pack of robot robot program step, program step of robot robot program storage, 1R program storage robot program control robot program control system robot program control system robot program system, industrial robot program system process‐flexible solution by robots process‐flexible assemblage by robots process‐flexible automaton by robots robot process flexible assembly system process‐flexible system by robots robot process information robot process information, IR process information robot processor robot process computer robot test equipment checking program of robot, checking program of industrial rob point‐to‐point control of robot robot space robot space path robot space curve robot reactivity robot calculator, industrial robot calculator architecture of robot computer computer data of [industrial] robot operation of robot computer periphery of robot computer robot computer control robot computer system robot reference point robot regulating system, industrial robot regulating system robot control deviation robot regulating algorithm [industrial] robot regulating system robot regulation robot regulating technology robot regulating technology, IR regulating technology [industrial] robot regulator robot regulator, industrial robot regulator robot control system frictional forces of robot problem of robots profitability robot repair repeatability of robot, reproducibility of robot robot resolver rotation axis of [industrial] robot robot record number robot control panel robot switching element robot switching information robot control cabinet robot control panel robot grinding, grinding by robot robot sled, robot carriage robot interface robot screw driver robot screwed connection robot stepping motor robot sliding movement, thrust movement of robot sliding joint of robot shoulder joint of robot welding torch of robot welding by means of robot, welding by using of robot, robot w robot swivel unit robot sensor, industrial robot sensor sensor data of [industrial] robot robot sensorics information of robot sensor robot sensor control stran 239 od 326 EN ‐DE: slovar avtomatizacije in robotike Robotersensorsystem Roboterservice Roboterservoregler Robotersicherheitsraum Robotersichtsteuerung Robotersichtsystem Robotersignal Robotersoftware Robotersoftwarestruktur Robotersoftwarezentrum Robotersoli wert Robotersollposition Roboterspachsyntax Roboterspanneinrichtung Roboterspannelemente Roboterspeicher Roboterspeicher Roboterspeicher Roboterspeichereinrichtung Roboterspeicherplatz Roboterspeicherstation Roboterspeichertest Roboterspezialwerkzeug roboterspezifische Anweisung roboterspezifische Sprache roboterspezifischer Antrieb roboterspezifischer Befehl Robotersprachprozedur Robotersprachsemantik Roboterspritzkabine Roboterspritzkopf Roboterstandard Roboterstandardbahn Roboterstandort Roboterstapelung Roboterstapelverfahren Roboterstartposition Roboter‐Start‐Stopp‐Taster Roboterstation Roboterstellglieder npt Roboterstellsignal Robotersteuer kreis Robotersteueraggregat Robotersteueralgorithmus Robotersteuerband Robotersteuerdiskette Robotersteuereinheit Robotersteuereinheit Robotersteuereinheit Robotersteuerelektronik Robotersteuerfunktion Robotersteuergerät Robotersteuergerät Robotersteuergerät Robotersteuerimpuls Robotersteuerinformation Robotersteuerknüppel Robotersteuerkraft Robotersteuerprogramm Robotersteuersignal Robotersteuersprache Robotersteuertastatur Robotersteuerumfang Robotersteuerung Robotersteuerung Robotersteuerung mittels programmierbarer Automaten Robotersteuerung mittels programmierbarer Automaten Robotersteuerung mittels Steuerknüppels Robotersteuerungsart Robotersteuerungseingabe Robotersteuerungsfunktion Robotersteuerungsgehäuse Robotersteuerungskorrektur Robotersteuerungsoperation Robotersteuerungsstrategiealgorithmus Robotersteuerungssystem robot sensor system robot servicing, robot maintenance, IR servicing, robots servic robot servo regulator safety room of robot, robot safety room robot vision control robot visual system robot signal, signal of industrial robot robot software, IR software robot software structure robot software centre robot nominal value nominal position of robot robot language syntax robot clamping device robot chucking elements robot memory, robot store, IR memory, IR store robot memory robot store robot storage device, industrial robot storage device robot memory place robot memory station, industrial robot memory station storage test of robot robot special tool robot‐specific instruction robot‐specific language robot‐specific drive robot‐specific instruction robot language procedure robot language semantics robot spray chamber extruder head of industrial robot robot standard robot standard path location of robot, place (position) of robot robot blocking robot stack process start position of robot start‐stop probe of (industrial] robot robot station, industrial robot station robot final control elements robot actuating signal robot control circuit robot control aggregate robot control algorithm control tape of [industrial robot control diskette for robots robot control unit, control unit of industrial robot robot control unit control unit of industrial robot electronics of robot control robot control function, IR control function robot control unit, control unit of industrial robot robot control unit control unit of industrial robot robot control impulsion robot control information control column of robot robot control force robot control program robot control signal robot command language, IR command language robot control keyboard robot control circumference robot control robot control, industrial robot control robot control by means of programmable robot control by means of programmable automatons actuating rod for robot control, robot control by means of the control kind of industrial robot robot control input robot control function, IR control function robot control case robot control correction robot control operation, control operation of IR algorithm of robot control strategy control system for robots stran 240 od 326 EN ‐DE: slovar avtomatizacije in robotike Robotersteuerungstechnologien Roboterstiftmontage Roboterstillstandszeit Roboterstromversorgung Roboterstruktur Roboterstrukturgewicht Roboterstudie Roboterstudie Roboterstufe Robotersuchposition Robotersuchzeit Robotersyntheseprogramm Robotersystem zum Stofftransport Roboterszene Robotertaktsignal IR‐Taktsignal Robotertaktzeit Robotertechnik Robotertechnik Robotertechnik Robotertechniker robotertechnischer Komplex Robotertechnologie Roboterteilmontage Roboterteilsystem Robotertemperaturbestimmung Robotertest Robotertisch Robotertisch m. Tisch eines Industrieroboters Roboterträger Roboter‐träger Robotertragfähigkeit Roboterträgheitsmatrix Robotertrajektorie Robotertrajektorie Robotertrajektorieplanung Robotertranslationsachse Robotertyp Robotertypenzahl Roboterübernahmepunkt Roboterübertragungselement Roboterüberwachung Roboterüberwachungssystem Roboterumgebung Roboterumprogrammierung Roboterumwelt Roboterumweltdaten pl roboterunabhängige Komponente Roboteruniversalprogrammierer Roboterunterarm Roboteruntermontage roboterunterstützte Montageeinrichtung Roboteruntersuchung Robotervariante Roboterverbindungsglieder Roboterverfügbarkeit Roboterverhalten Roboterverschraubung Roboterversuch Roboterverteilung Roboterwachstumsrate Roboterwagen Roboterwandbefestigung Roboterwartung Roboterweginformation Roboterwegmesssystem Roboterweltkoordinaten Roboter‐Weltkoordinatentransformation Roboterwerkzeug Roboterwertetabelle Roboterwinkelgeschwindigkeit Roboterwirkleistungsrelais ft Roboterwirkzone Roboter‐X‐Achse Roboter‐Y‐Achse Roboterzählertest Roboterzentrifugalkraft control technologies for robots robot pin assembly (mounting) robot idle time robot power supply robot structure, industrial robot structure robot structure weight robot study robot study, industrial robot study stage of robot robot search position, search position of IR search time of robot robot synthesis program robot system for cloth (fabric) transport robot scene, scene of industrial robot robot cycle signal, industrial robot cycle signal robot cyclic time, cyclic time of IR robotics, industrial robot[s] technique robotics industrial robot[s] technique robot technician robot‐technical complex robot technology robot submounting partial system of robot, partial system of industrial robot, robo robot temperature identification robot test robot table, industrial robot table robot table, industrial robot table robot support, support of industrial robot robot support, support of industrial robot robot load‐carrying capacity, industrial robot load‐carrying ca inertia matrix of robot robot trajectory robot movement path, robot trajectory, industrial robot trajec robot trajectory planning translation axis of [industrial] robot robot type, industrial robot type robot type number, type number of robot robot transfer point robot transmission element robot supervision robot supervision system robot environment robot reprogramming, industrial robot reprogramming robot environment environment data of robot robot‐independent component universal programmer for robots forearm of robot, robot fore‐ robot submounting robot‐assisted assembly device robot investigation robot variant robot connecting joints availability of industrial robot robot performance robot bolting, industrial robot bolting robot test repartition of robots robot rate of growth robot vehicle wall mounting of robot robot servicing, robot maintenance, IR servicing, robots servic robot path information robot path measuring system, industrial robot path measuring robot world coordinates transformation of robot world coordinates robot tool, industrial robot tool robot value table angular velocity of robot active power relay of robot active region of robot X‐axis of [industrial] robot Y‐axis of [industrial] robot counter test of robot centrifugal force of robot stran 241 od 326 EN ‐DE: slovar avtomatizacije in robotike Roboterzentrum Roboterziel zustand Roboterzielposition Roboterzubringereinrichtung Roboterzuführung Roboterzusatz Prozessor Roboterzusatzfunktion Roboterzustand Roboterzustandsraum Roboterzustandssignal Roboterzuteileinrichtung Roboterzuverlässigkeit Roboterzwischen punkte Roboterzyklus Robotik Robotik Robotik Robotikprobleme Robotiksystem robotisierte Handhabung robotisierte Montage robotisierte Qualitätskontrolle robotisierte Speicherung robotisierter Zusammenbau robotisiertes Kontrollsystem robotisiertes Montagesystem Robotisierung Robotisierung von Arbeitsplätzen Robotisierung von Farbgebungen Robuste Regelung Röhrenarm Rohrleitungsdurchflussmesser Rohrleitungssystem Rollen eines Softgreifers Rollenführung Rollenführung feines Greifers Röntgenbeugungs‐Phasenanalyse Röntgenstrahlenbeugung Röntgenstrahlenfluoreszenzspektrometer Röntgenstrahlkontrolle Rotationsachse Rotationsachse eines Greifers Rotationsachse feines Industrieroboters Rotationsdruckluftmotor Rotationseinheit Rotationsgeschwindigkeit eines Roboters Rotationssensor rotationssymmetrisches Werkstück Rotationsteil Rotationsviskosimeter Rotationszentrum rotatorische Backenbewegung rotatorische Greiferbewegung rotatorische Robotergrundbewegung (IR‐Grundbewegung) rotatorischer Antrieb eines Manipulators rotatorischer Greifer rotatorischer Greiferantrieb rotatorischer Inkrementalgeber rotatorischer Manipulatorantrieb rotatorischer Positionierantrieb rotierender Effektor ROUTH‐Kriterium Routhsche Ungleichung Routhsches Kriterium ROUTH‐Tafel Routinekontrolle Routineoperation Routineoperationen Rück[kopplungs]kanal Rückanzeige Rückführgröße Rückführgröße Rückführübertragungsfunktion Rückführübertragungsfunktion Rückführung Rückführung robot centre, industrial robot centre robot target state target position of robot robot feed device, industrial robot feed device robot feeding, industrial robot feeding companion processor of robot, auxiliary processor of robot robot additional function robot state robot state space state signal of robot robot distribution device robot reliability intermediate points of robot robot cycle, IR cycle robotics, industrial robot[s] technique robotics industrial robot[s] technique robotic problems robotic system robotized handling robotized assemblage robotized quality checking robotized storage robotized assemblage robotized checking system robotized assemblage system robotization robotization of workplaces robotization of paintings robust control system tube arm pipeline flowmeter pipeline system Soft gripper rolls, rolls of soft gripper roll guide roll guide of gripper, gripper roll guide X‐ray diffraction phase analysis diffraction of X‐rays X‐ray fluorescence spectrometer X‐ray control rotation axis gripper rotation axis rotation axis of [industrial] robot rotation air motor, rotation pneumatic motor rotation unit rotation speed of robot rotation sensor rotationally symmetrical rotation part rotational viscosimeter rotation centre rotatoric jaw movement rotatoric gripper movement rotatoric base movement of [industrial] robot rotatoric manipulator drive rotatoric gripper rotatoric gripper drive rotatoric incremental sensor rotatoric manipulator drive rotatoric positioning drive rotary actuator ROUTH's stability criterion Routh inequality Routh criterion ROUTH array routine control routine operation non‐productive operations feedback channel back indication feedback variable variable feedback inverse transfer function return transfer function feedback back‐coupling stran 242 od 326 EN ‐DE: slovar avtomatizacije in robotike Rückführung Rückführung des pneumatischen Antriebes Rückführungselemente Rückführungskoeffizient rückführungsloses Steuersystem Rückführungsschaltung Rückführungsschleife Rückführungsschleife Rückführungsschleife (einer Robotersteuerung) Rückgang Rückgang Rückgang Rückgang rückgängig erstellen rückgängig machen rückgängige Wirkungen Rückgangswert rückgeführtes Signal rückgekoppelter Impulsgenerator rückgekoppeltes Schieberegister rückgestreute Leistung rückgestreutes Signal Rückkehr Rückkehrzeichen rückkoppelnd Rückkopplung Rückkopplung Rückkopplung Rückkopplungsbedingung Rückkopplungsbegrenzer Rückkopplungscharakteristik Rückkopplungsdetektor Rückkopplungseinstellung Rückkopplungskondensator Rückkopplungsleitung Rückkopplungsregelung Rückkopplungsregler Rückkopplungsregleranlage Rückkopplungsschaltung Rückkopplungssensor Rückkopplungsspannungsverhältnis rückkopplungsstabilisierter Gleichrichter rückkopplungsstabilisierter Verstärker Rückkopplungssteuerungssystem Rückkopplungsverstärker Rückkopplungsverzerrung Rückkopplungsverzögerung feedback limiter 270 Rückkoppungseffekt Rücklauf Rücklauf Rücklauf Rücklauf Rücklaufimpulse Rücklaufrichtung Rücklaufübertrag Rückleistungsrelais Rückmeldebefähigung Rückmeldebefähigung Rückmeldepriorität Rückmeldung eines Roboterbefehls Rückmeldungssteuerung Ruckmesser Rückschlagventil Rückschlagventil Rückschreibimpuls Rücksetzanweisung Rücksetzzeichen Rücksprung Rückstellautomat Rückstellimpuls Rückstellkonstante Rückstellkreis Rückstellmoment Rückstellung Rückstellung von Hand Rückstellvorgang inverse coupling pneumatic drive feedback feedback elements feedback factor unmonitored control system closed‐loop circuit control loop feedback loop feedback loop (of robot control) back stroke reversed motion return trace reverse run undo v undo v undoing actions resetting value feedback signal regenerative pulse generator feedback shift register backscattered power backscattering signal return backspace character, BS regenerative back‐coupling feedback inverse coupling back‐coupling condition feedback limiter backward transfer characteristic regenerative detector feedback adjustment feedback capacitor back‐coupling connection feedback control feedback controller feedback control system feedback circuit feedback sensor feedback voltage ratio feedback‐regulated rectifier feedback‐stabilized amplifier feedback control system regenerative amplifier distortion due to feedback feedback lag back‐coupling effect back stroke reversed motion return trace reverse run flyback pulses reverse direction end‐around carry reverse‐power relay acknowledge enable acknowledge enable, ACE acknowledgement priority answerback of robot instruction acknowledge control, ACC jerkmeter non‐return flap non‐return valve half‐write pulse backspace statement backspace character, BS return push‐down automaton reset pulse control constant reset circuit restoring torque reset[ing] manual reset adjustment recovery procedure stran 243 od 326 EN ‐DE: slovar avtomatizacije in robotike Rückstreuanalyse Rückstreumesseinrichtung im Zeitbereich Rückstreumessung Rückstreusignal Rückstreuung Rückstreuungscharakteristik Rückstreuungsverlauf Rückstreuvorgang Rückstrom Rückstrom Rückstromprinzip Rückstromprinzip Rücktrieb Rückvermischungsreaktor rückwärtige Differenzen Rückwärtsdifferenz rückwärtsgenommene Differenzen Rückwirkungsfreiheit Rückwirkungsfreiheit Rückwirkungskapazität Rufadresse Ruf‐Antwort‐System Rufaufzeichnung Rufbefehl (eines Roboterprogramms) Rufsignal Rufverteiler Ruhebelastung Ruhebereich Ruhedruck Ruhekontakt Ruhekontakt Ruhekontakt Ruhekontakt Ruhekontakt Ruhekontakt Ruhekontakt Ruhelage Ruhephase des Robotersteuerungssystems Ruhephase eines Manipulatorsystems Ruhephase eines Manipulatory stems Ruhephase eines Roboters Ruhestellung Ruhestrom Ruhestromauslöser Ruhestromschaltung Ruheträgermodulation Ruhewert Ruhezustand Rundtischantrieb Rundtischlagerung Rundungsfehler Rundungsmessgerät RUNGE‐KUTTA‐Verfahren Sägezahnstromgenerator Sägezahnumwandler Saitengeber Saitengeber Sammelaufzeichnung Sammelektrode Sammelektrode Sammelganggeschwindigkeit Sammelruf Sammelschaltung Samplingkreis Samplingoszillograf Samplingsynchronisation Sandstrahlen (von Werkstücken) Satch‐Betrieb Sattelpunkt Sättigung Sättigung Sättigungsbereich Sättigungsbereich Sättigungsdrossel Sättigungsgrad Sättigungsinchtlinearität backscattering analysis time‐domain backscatter[ing] measuring set backscattering measurement backscattering signal backscatter[ing] backscattering response backscattering response backscattering process back flow reverse current back‐current principle countercurrent principle back drive backmix reactor backward differences backward difference backward differences absence of feedback absence of interaction feedback collector capacitance call address call‐reply system call recording call instruction (of robot program) call signal call distributor static load[ing] non‐operation region stagnation pressure back contact normal contact rest contact break contact normally closed contact normally open contact resting contact equilibrium point dwell phase of robot control system dwell phase of manipulator system dwell phase of manipulator system rest phase of robot, dwell phase of robot rest position quiescent current rest‐current release circuit‐opening connection quiescent‐carrier modulation quiescent value quiescent state circular table drive, rotary attachment feed gear circular table bearing rounding error roundness measuring instrument Runge‐Kutta method saw‐tooth current generator saw‐tooth converter stringed transducer vibrating wire gauge gather write collecting electrode collector electrode accumulating speed all‐number calling, ANC collecting circuit sampling circuit sampling oscillograph sampling synchronization sandblasting (of s) batch mode saddle point saturating nonlinearity saturation zone of saturation saturation zone saturation reactor degree of saturation saturation non‐linearity stran 244 od 326 EN ‐DE: slovar avtomatizacije in robotike Sättigungspegel Sättigungsprozess Sättigungszone Sättigungszone Sättigungszustand saturiert saturiert Satz über die Linearität Satzband Satzbetrieb Satznummereines IR‐Programms Satzverarbeitung Satzverarbeitungszeit Satzverfahren Saugergreifeinheit Sauggreifeinheit Sauggreifer Saugkopf Saugkopfmanipulator Säuremesser Scanner Scanner schadhafter Modul Schadraumregelung Schallanregung Schallbrechung Schalldispersion Schalldruckverfahren Schallimpedanzmessung Schallinformation Schallsensor Schallsignal sonore Schallsignal sonore Schallwellenwiderstandsmessung Schaltalgebra Schaltalgebra Schaltanordnung Schaltcharakteristik Schalteinrichtung Schalteinrichtung Schaltelement Schaltelement Schaltelement Schaltelement eines Steuerungssystems Schaltelement eines Steuerungssystems Schalter Schalter Schalter mit selbsttätiger Wiedereinschaltung Schalteranordnung Schaltfehlerschutz Schaltfolge Schaltfrequenz Schaltfrequenz Schaltfunktion Schaltfunktion Schaltgerät Schaltgerät Schaltgeschwindigkeit Schaltgeschwindigkeit Schaltgeschwindigkeit Schaltgeschwindigkeit von Transistoren Schaltimpuls Schaltinformation Schaltkoeffizient Schaltkreis Schaltkreis Schaltkreis Schaltkreis für direkten Speicherzugriff Schaltkreisanalysator Schaltkreise für die Zeichenerkennung Schaltkreisentwicklung Schaltkreisentwurf Schaltkreisfehler Schaltkreisgeschwindigkeit Schaltkreislogik des Rechners Schaltkreisrauschmesser saturation level saturation process zone of saturation saturation zone saturation state saturated saturating linearity theorem connective batch operation record number of IR‐program record processing record processing time batch process suction grip unit suction grip unit suction gripper suction head suction head manipulator acidimeter scanner scanning unit faulty module noxious clearance regulation acoustic excitation acoustic refraction acoustic dispersion sound pressure method acoustic impedance measurement sound information sound sensor audio signal sound signal acoustic impedance measurement crisp logic switching algebra order of switching switching characteristic switchgear switching equipment circuit element switching element network element switching element of control system switching element of control system cut‐off cut‐off switch automatic reclosing circuit‐breaker switch arrangement protective device to prevent switching errors sequence of switches switching frequency switching frequency binary function logic function switchgear switching equipment circuit speed operation speed switching speed switching speed of transistors switching pulse switching information switching coefficient switching circuit circuit connection diagram circuit switching circuit for direct memory access, DMA switching cir circuit analyzer character recognition circuits circuit development design of switching circuits switching circuit failure circuit speed logic of the computer circuit noise meter stran 245 od 326 EN ‐DE: slovar avtomatizacije in robotike Schaltkreistester Schaltkriterium Schaltleistung eines Ausschalters Schaltlogik Schaltmittel Schaltplan Schaltpunkt Schaltpunkt commutation Schaltreihenfolge Schaltrichtungsbedingung Schaltschwelle Schaltsignal Schaltstelle Schalttafel Schalttafel Schalttafel Schalttafel Schalttafel für Glühlampensignalanlage Schalttafeldiagramm Schalttechnik Schalttechnologie Schalttransistor Schaltuhr Schaltung Schaltung Schaltung für automatische Vorspannung Schaltung mit Doppelverstärkung Schaltung mit Doppelverstärkung Schaltung mit geschlossener Schleife Schaltungs‐ und Programmtechnik Schaltungsabwandlung Schaltungsanalyse Schaltungsanalyseprogramm Schaltungsanforderungen Schaltungsdiagramm Schaltungsentwicklung Schaltungsentwurfstechnik schaltungsinnerer Emulator schaltungsintern schaltungsinterne Emulation schaltungsinterne Prüfung Schaltungskapazität Schaltungskenngröße Schaltungsknotenpunkt Schaltungskomplexität Schaltungslogik Schaltungsmodifizierung Schaltungsmodul Schaltungsoptimierung Schaltungsparameter Schaltungssimulation Schaltungstechnik Schaltungszuverlässigkeit Schaltverzug des Leistungsschalters Schaltwarte Schaltweg Schaltzyklus scharf scharf gebündelter Strahl scharfe Ausgangsgröße scharfe Eingangsgröße scharfe Logik scharfe Menge scharfe Relation (Beziehung) scharfer Impuls scharfer Wert Schätzwert Schautafel Scheibenspeicher Scheinadresse Scheinberührungsfläche Scheinwert Scheinwiderstand Scheinwiderstandsanpassung Scheitelfaktor Scheitelfaktor circuit tester trigger criterion breaking capacity of a circuit‐breaker switching logic circuit mean connection diagram switching point level change value order of switching direction switching condition switching threshold switching signal circuit point panel control board control panel switch board lamp signalling switchboard plugging chart switching technique switch technology (for computer devices) switching transistor clock relay circuit connection diagram circuit auto‐bias circuit double amplification circuit reflex circuit closed‐loop circuit circuit and program technique circuit modification worst‐case circuit analysis circuit analysis program circuit requirements connection diagram circuit development circuit design technique in‐circuit emulator in‐circuit in‐circuit emulation in‐circuit check circuit capacity circuit characteristic circuit node circuit complexity circuit logic circuit modification circuit module circuit optimization circuit parameter circuit simulation circuitry circuit reliability operation delay of a circuit‐breaker control room contact travel switching cycle crisp sharp beam crisp output crisp input crisp logic crisp set crisp relation sharp pulse crisp value estimated value graph chart slice memory dummy address apparent contact surface apparent value impedance impedance matching crest factor peak factor stran 246 od 326 EN ‐DE: slovar avtomatizacije in robotike Scheitelpunkt Scheitelspannung Scheitelwert Scheitelwert Scheitelwert des Scheitelwert einer Wechselgröße schematisches Modell Schenkel einer Zangengreifeinheit Scherensensor Scherenzange Schichtdickenmesser schieben Schieben Schieberegister Schiebetischantrieb Schiebetischpalette Schiebung der Zangengreifeinheit Schiebung eines Greiforgans schiedsrichtern Schirmfaktor Schlagen Schlagen Schlagen schlecht ausgerichtete Verbindung Schleifbearbeitung mit Roboter Schleife Schleifen durch Roboter Schleifenaufbau Schleifenindex Schleifennetz Schleifenregel Schleifenstruktur Schleifensystem Schleifenwiderstand Schleifenzerlegung Schleifroboter Schleuderwirkung Schleuderwirkung schließen schließen Schließen des Greiforgans Schließen eines Greifers (Roboterbefehl) Schließgeschwindigkeit (eines Greifers) Schließkontakt Schließkraft Schließrelais Schließungsimpuls Schließungsstromstoß Schließzeit Schlittenbewegung Schlittenbezugspunkt Schlupfregler Schlupfsteuerung mit logischem Schaltelement Schlüsselermittlereinheit Schlüsselermittlereinheit schlüsselfertiges System Schlussfolgerung Schlussfolgerungsverfahren Schlußgleichung Schlüssler Schlüssler Schlüssler Schlußzeichenrelais conversation Schmalband‐Breitband‐Pegelmesser Schmalbandfrequenzbereich Schmalbandregler Schmalbandsignal Schmalbandverstärker schmale Streifengeometrie schmaler Torimpuls Schmallinienemission Schmalwinkelkoordinator Schmeizsicherung Schmidtsches Orthonormalisierungsverfahren Schmiedemanipulator Schnappbetätigung peak point peak voltage crest value peak value peak making current amplitude of an alternating quantity schematic model thigh of a pincer grip unit shearing sensor shear tongs coat thickness gauge shift v shift[ing] shift register receding table drive receding table pallet displacement of pincers displacement of grip organ arbitrate v screen factor beat[ing] pulsing pulsation misaligned joint grinding operation with robot loop[ed] circuit robot grinding, grinding by robot loop structure cycle index loop network loop rule loop structure loop dialling system loop resistance loop resolution grinding robot centrifugal efficiency centrifugal force close v bar v closing of grip organ gripper termination, gripper closing (robot command) closing speed (of gripper) make contact closing force closing relay make impulse make impulse closing time slide movement slide reference point slip regulator slip control with logical control element code generating unit code investigation unit turnkey system conclusion inference closing equation coder encoder code equipment clearing relay narrow‐wide band level indicateur narrow‐band frequency range narrow‐band controller narrow‐band signal narrow‐band amplifier narrow‐stripe geometry narrow gate pulse narrow line emission narrow‐angle coordinator safety fuse Schmidt orthonormalization form manipulator snap actuation stran 247 od 326 EN ‐DE: slovar avtomatizacije in robotike Schnappeinschaltung Schnappkontakte Schnappschalter Schnappschalter Schnappschalter Schnappwirkung Schneckenmanipulator Schneckenradantrieb Schneidenankerrelais Schneideroboter schnell veränderliche Variable schnellansprechender Laserstrahlenempfänger schnellansprechendes Relais Schnellauslöser schnelle Auslösung schnelle Datenübertragung schnelle Datenübertragung schnelle Datenübertragung schnelle Positionierung schnelle Roboterachsregelung schnelle Verzögerung Schnelleinschaltung schneller Durchflussmesser schneller Koinzidenzkreis schneller Zeracker schnelles Ansprechen von Fernsteuerungssystemen schnelles Inversionssystem schnelles Positionierungssystem schnelles Signal Schnellfilter Schnellfolgesystem Schnellhalt Schnellhalt Schnellkontakt Schnellpositioniersystem Schnellrechner Schnellregelung Schnellregler Schnellregler Schnellroboter Schnellschütz Schnellschütz Schnellsteuerung schnellwirkende Steuerung schnellwirkender Koinzidenzkreis schnellwirkender Regler schnellwirkender Regler schnellwirkendes Relais Schnellwirkung Schnellzerhacker Schnittbild Schnittbildoptimierung Schnittfrequenz Schnittfrequenz Schnittpunkt Schnittpunkt Schnittstelle Schnittstelle zwischen Roboter und Objekt Schnittstellenbausatz Schnittstellenbaustein Schnittstellengestaltung Schnittstellenkanal Schnittstellenkenndaten pl Schnittstellen‐Logikschaltung Schnittstellenmodul Schnittstellenschaltung Schnittstellenstandard Schnittstellen‐Steuerbaustein Schnittstellensteuerung Schnittstellentechnik Schnittzahlminimierung Schraubachse Schraubbewegung eines Roboterantriebs schrauben (durch Roboter) Schraubendreher eines Roboters Schraubenfügen snap closing snap‐action contacts quick‐action switch snap‐action switch snap‐switch snap action worm manipulator worm‐wheel drive knife‐edge relay cutting robot high‐frequency variable fast response laser receiver fast‐acting relay instantaneous electromagnetic release quick release fast data transmission high‐data rate high‐speed data transmission quick positioning quick robot axis regulation rapid deceleration quick‐make fast response flowmeter fast coincidence circuit fast chopper high‐speed response of remote control systems rapid inversion system quick positioning system fast signal rapid filter high‐speed servomechanism fast stop rapid stop instantaneous contact quick positioning system high‐speed computer high‐speed control quick‐acting regulator high‐speed action controller quick robot high‐speed contactor high‐breakingcapacity contactor high‐speed control rapid‐action control fast coincidence circuit quick‐acting regulator high‐speed action controller fast‐acting relay snap action fast chopper split image split‐image optimization cut‐off frequency critical frequency intercept point cross point interface interface between robot and object interfacing kit interface module construction of cutting site interface channel interfacing characteristics interface logic interface module interface circuit interface standard interface controller interface control interfacing technique minimization of tear variables screwed axis screwed motion of robot drive screw to (by robot) robot screw driver screw jointing stran 248 od 326 EN ‐DE: slovar avtomatizacije in robotike Schraubenlinienabtastung Schraubenverbindung Schraubung eines Greiforgans schreibender Impulszähler schreibendes Maximumwerk Schreiber Schreib‐Freigabesignal Schreibimpuls Schreiboperation Schreibsteuerung Schreibtaktimpuls Schreibwerk schreitender Roboter Schreitroboter Schriftzeichenerkennung Schriftzeichenunterscheidung Schritt Schrittbetrieb Schrittbetrieb Schrittfür‐ Schritt‐Steuerung Schrittfür‐ Schritt‐Steuerung Schritt‐für‐Schritt‐System Schrittkorrektur einer Robotersteuerung Schrittmacher Schrittmotor Schrittmotor Schrittmotor Schrittregelung Schrittregelung Schrittregler Schrittschaltoperation Schrittschaltwerk Schrittwähler für selbsttätige Operationen schrittweise Addition schrittweise Integration schrittweise Operation schrittweise Operation schrittweiser Vorschub Schrittweitenparameter Schrittwiederanlauf Schrittwirkung Schubachse feines IR Schubbewegung eines Robotergreifers Schubbewegung in Richtung der u‐Achse Schubbewegung in Richtung der v‐Achse Schubgelenk einer Zangengreifeinheit Schubweg eines Greiferarms schubweise Verarbeitung schubweise Versorgung Schüttfaktor Schütz Schutz bei Einphasenerdschluß Schütz mit Relais Schutz von Gleichstromfernleitungen Schutzeinrichtung Schutzeinrichtung Schutzeinrichtungsbetätigung Schutzfunktion Schutzgaskontaktschütz Schutzhandlung Schutzprüfung Schutzsystem Schutzsystem Schutzvorrichtung Schutzwiderstand schwache Kopplung schwache Kopplung Schwächungsgrad Schwächungsgrad schwankendes Signal Schwankung einer Funktion Schwankungen der Messgeräteanzeigen schwarzer Kasten Schwarz‐Weiß‐Sensor Schwebekörperdurchflussmesser schwebende Unterbrechung helical scanning bolted joint, screwed connection screw motion of grip organ impulse recorder maximum recording attachment X‐Y‐recorder write enable signal write pulse write operation write control write pulse print unit pedipulator, walking robot pedipulator, walking robot character recognition character recognition step single‐step mode single‐step operation; step‐by‐step control stepping control step‐by‐step system step correction of robot control pacemaker pecking motor stepping motor repeat motor step‐by‐step control stepping control step[ping] controller stepping switch operation stepping distributor step selectors for automatic operations iterative addition stepwise integration single‐step mode single‐step operation; intermitted feed incrementation parameter step restart step action sliding axis of IR gripper sliding movement, robot gripper sliding movement u‐sliding movement v‐sliding movement pincer sliding joint gripper sliding route batch processing pulsed supply bulk factor contactor single‐phase earth‐fault protection set relay fitted contactor protection of direct current supply lines protection facility protective equipment protective equipment operation protective function protective gas contactor protective action protection check protection system protective system protective equipment protective resistance loose coupling weak coupling attenuation degree degree of attenuation fluctuating signal function oscillation meter reading variations black box black‐and‐white sensor suspended body flowmeter pending interruption stran 249 od 326 EN ‐DE: slovar avtomatizacije in robotike Schwebung Schwebung Schwebung Schwebungsfrequenz Schwebungslücke Schwebungsnull Schwebungsnullmesser Schweißapparat Schweißen in Kammern mit kontrollierter Schweißen in kontrollierter Atmosphäre Schweißen mittels Roboters Schweißnaht Schweißroboter Schweißroboter für Lichtbogenschweißtechnik Schweißroboter‐Bewegungszyklus Schweißroboterpositionierung Schweißteil Schweißteilaufnahme Schweißung mit pulsierendem Laser Schweißverfahrenautomatisierung Schweißwerkzeug Schweißwerkzeugführung Schweißzange Schweißzangeneffektor Schwellendetektor Schwelleneffekt Schwellenempfindlichkeit Schwellenfeld Schwellenfrequenz Schwellenfunktion Schwellennetzwerk Schwellensignal Schwellenwert Schwellspannung Schwellwertgeber Schwellwertgeber Schwellwertlogik Schwellwertschaltung Schwenkachse Schwenkarmmanipulator schwenkbare Schubachse eines IR schwenkbarer Sensor Schwenkbereich Schwenkbewegung eines Greifers Schwenkeinheit Schwenkeinheit eines Industrieroboters Schwenkeinheit feines Industrieroboters Schwenkeinheit mit Linearantrieb schwenken Schwenkkontaktgeschwindigkeitsregler Schwenkmanipulator Schwenkmechanismus Schwenkmodul Schwenkvorrichtung Schwerindustrieroboter Schwerkraftberichtigung Schwerkraftbeschleunigung Schwerkraftbeschleunigung Schwerkraftförderer Schwerpunkt der größten Fläche Schwerpunktermittlung Schwerpunktmethode Schwerpunktmethode Schwerpunktmethode Schwerpunktsummenmethode Schwierigkeitsgrad Schwimmerdruckmesser Schwimmerdurchflussmesser Schwimmerhöheregelungsgeber schwimmerloser Niveauregler Schwimmermanometer Schwimmregelung Schwimmregelung Schwimmspannung Schwingeinrichtung schwingen beat[ing] pulsing pulsation beat frequency zero beat zero beat zero beat indicator wavemeter welding set controlled‐atmosphere welding controlled‐atmosphere welding welding by means of robot, welding by using of robot, robot w welding seam welding robot welding robot for arc welding technique welding robot movement cycle welding robot positioning welded part, welding part welding part reception pulsed laser welding welding procedure automation welding tool welding tool guide welding tongs, welding pliers effector of welding tongs, effector of welding pliers threshold detector threshold effect threshold sensitivity threshold field threshold frequency threshold function threshold network threshold signal threshold threshold voltage sector‐alignment indicator threshold value indicator threshold logic threshold circuit swiveling axis swinging arm manipulator, pivoted arm manipulator pivoting sliding axis of IR pivoting sensor swiveling range swivel motion (movement) of gripper swivel unit robot swivel unit robot swivel unit swiveling unit with linear drive yaw to rocking‐contact speed regulator pivoted manipulator swivel mechanism swivel module slewable device robot for heavy industry gravity correction gravitational acceleration gravity acceleration gravity conveyor center of largest area defuzzification determination of centre of gravity, centre of gravity search Center of area (COA) defuzzification center of gravity (COG), defuzzification centroid defuzzification method center of sums (COS) defuzzification coefficient of difficulty float‐operated pressure gauge float‐operated flowmeter float level gauge floatless liquid‐level controller float‐operated pressure gauge floating control null offset floating potential oscillating mechanism pendulate v stran 250 od 326 EN ‐DE: slovar avtomatizacije in robotike schwingen schwingender Regelkreis schwingendes Greifersystem Schwingfähigkeit Schwingfähigkeit Schwingfähigkeit des Systems Schwingfall) Schwinggrenzfrequenz Schwinggröße Schwingindex Schwingkontakt Schwingkreis Schwingkreis Schwingkreiseinstellung circuit Schwingkreiseinstellung circuit Schwingmechanismus Schwingregler Schwingregler Schwingregler Schwingrelais Schwingung Schwingung Schwingungsanalysator Schwingungsanalyse Schwingungsbauch Schwingungsbewegung Schwingungsdämpfer Schwingungsenergie Schwingungserreger Schwingungserregung Schwingungsforschung Schwingungsfrequenz Schwingungsfunktion Schwingungsglied Schwingungsmodell Schwingungsphase Schwingungsspektrumanalysator Schwingungssynchronisation Schwingungsübergang Schwingungsvorgang Schwingungszustand Schwundregelung Schwungradsynchronisation S‐Ebene sechsachsiger Fernmanipulator Sechsexzesskode Sechsüberschußkode Segmentadresse Segmentbasis Segmentbasisadresse Segmentgrenze segmentieren segmentierte Kodierungskennlinie Segmentierung Segmentverwaltung seigern seinesgleichen Seitenbandübertragung Seitensteuerung Sekantenmethode Sekundärauslöser Sekundärradar Sekundärregelung Sekundärspeichersystem Sekundärverfahren Selbstabgleich Selbstabgleich selbstabgleichend selbstabgleichende Brückenschaltung selbstabgleichender magnetischer Verstärker selbstabgleichendes Potentiometer selbstablaufendes Schweißen selbstabstimmendes Modell selbstadaptiertes Greiforgan selbstadjungiertes System selbständige Handhabetechnik swing v oscillating control servomechanism oscillatory gripper system oscillation capability property to oscillate oscillation system property underdamped system maximum frequency of oscillation oscillating quantity index of oscillation oscillating contact oscillating circuit resonator circuit circuit adjustment circuit setting oscillating mechanism oscillating controller oscillating regulator vibrating controller oscillating relay oscillation oscillatory motion vibration analyzer analysis of oscillation antinode oscillatory motion vibration damper vibration energy vibration generator oscillation excitation vibration research oscillation frequency oscillation function oscillation element transient analyzer oscillating phase vibration spectrum analyzer oscillation synchronization vibrational transition oscillating process oscillating regime fading control flywheel synchronization s‐plane six‐axial distance manipulator excess‐six‐code excess‐six‐code segment address segment base segment base address segment boundary segment v segmented encoding law segmentation segment management upgrade v peer adj side‐band transmission side control secants method secondary trip secondary radar secondary regulation secondary storage system secondary method automatic balancing automatic compensation self‐balancing balancing bridge circuit self‐balancing magnetic amplifier self‐balancing potentiometer automatic [machine] welding self‐adjusting model self‐adapted grip organ self‐adjoint system unaided handling technique, independent technique stran 251 od 326 EN ‐DE: slovar avtomatizacije in robotike selbständige Robotereinheit selbständiger rechnergesteuerter Manipulator selbständiges Programm Selbstanlasser Selbstanlassung selbstanpassende Drehzahlregelung selbstanpassende Regelung selbstanpassende Struktur selbstanpassender Prozess selbstanpassungsfähige Handhabeeinrichtung selbstanpassungsfühige Handhabeeinrichtung Selbstanpassungsmodell Selbstanpassungssystem Selbstanregung Selbstanregung Selbstanschluss automatique Selbstausgleich Selbstausgleich Selbstausgleich Selbstausgleich Selbstausgleicher selbstausrichtend selbstbezügliches Modell Selbstdiagnosefähigkeit Selbstdiagnosemethode selbstduale Funktion selbsteinstellend selbsteinstellende Lamelle eines Greifers selbsteinstellende Stifte eines Greifers selbsteinstellender Dreipunktgreifer selbsteinstellendes Modell selbsteinstellendes System selbsteinstellendes System Selbsteinstellung selbsterhaltende Schwingung optimization s 1181 selbsterregte Schwingung Selbsterregung Selbsterregung Selbstfokussierung Selbstfokussierungseffkt selbsthaltend aufschalten Selbsthaltestromkreis Selbstinduktionswert Selbstinduktivität Selbstkontrolle Selbstkontrolle Selbstkontrolle Selbstkontrolle Selbstkontrolle selbstkorrigierender Kode selbstkorrigierender Speicher selbstkorrigierendes System selbstlernend selbstlernender Roboter (der dritten Generation) selbstlernendes System selbstoptimierende Regelung selbstoptimierendes System selbstoptimierendes System selbstorganisierender Automat Selbstprogrammierung Selbstprogrammierung selbstprüfend selbstprüfend selbstprüfend selbstprüfend Selbstprüfmethode Selbstprüfung Selbstprüfung Selbstprüfungselektronik Selbstregelstrecke Selbstregelung Selbstregelungsfaktor Selbstregler Selbstregulierungsgeschwindigkeit Selbstreproduktion selbstreproduzierendes System independent robot unit autonomous computer‐controlled manipulator stand‐alone program self‐starter automatic start[‐up] adaptive speed regulation self‐adaptive control adaptive architecture adaptive process self‐adaptable manipulation equipment self‐adaptable manipulation equipment auto‐adaptive model goal‐seeking system autoexcitation self‐excitation automatic connection self‐recovery self‐regulation hunting parasitic oscillations automatic regulator self‐aligning AR model, auto‐regressive model self‐diagnostic ability self‐diagnostic method self‐binary function self‐adjusting self‐adjusting lamina of gripper self‐adjusting pins of gripper self‐adjusting three‐point gripper self‐adjusting model adaptive control system self‐adjusting system self‐adjustment self‐sustained pulsation self‐excited oscillation autoexcitation self‐excitation self‐focusing self‐focusing effect latch v self‐holding circuit value of self‐inductance self‐inductance automatic check[ing] self‐check automatic test[ing] self‐test automatic inspection error‐correcting code self‐correcting memory self‐correcting system self‐learning self‐learning robot (of third generation) self‐learning system self‐optimizing control automatically taught system self‐teaching system of automatic optimization self‐organizing automaton automatic programming self‐programming self‐checking self‐testing auto‐checking auto‐testing adj self‐test method self‐check self‐test self‐test electronics self‐regulating controlled system self‐regulation coefficent of inherent regulation automatic controller inherent regulation rate self‐reproduction self‐reproducting system stran 252 od 326 EN ‐DE: slovar avtomatizacije in robotike Selbstrückstellung selbstschreibendes selbstschreibendes Selbstschwingungsglied Selbstschwingungssystem Selbstschwingungssystem Selbststabilisierung selbststartender Synchronmotor Selbststeuerung Selbsttaktierung Selbsttaktierungssystem selbsttätig selbsttätig selbsttätig arbeitend selbsttätige selbsttätige selbsttätige Auswuchtmaschine selbsttätige Datenvermittlung selbsttätige Datenvermittlung selbsttätige Elektroantriebssteuerung selbsttätige Folgesteuerung selbsttätige Förderung selbsttätige Kodierung selbsttätige Korrelationsfunktion selbsttätige Korrelationsfunktion selbsttätige Messeinheit selbsttätige Nachführung selbsttätige Nulleinstellung selbsttätige Nulleinstellung selbsttätige Regelung selbsttätige Regelung selbsttätige Regelung selbsttätige Regelung selbsttätige Regelung der Gasverteilung selbsttätige Rückstellung selbsttätige Sperrung selbsttätige Sperrung selbsttätige Sperrung selbsttätige Steuerungseinrichtung selbsttätige Umspeicherung selbsttätige Wiedereinschaltung selbsttätiger (automatischer) Kreislauf selbsttätiger Ausgleicher selbsttätiger Betriebskorrelator selbsttätiger Energiefluss selbsttätiger Informationsfluss selbsttätiger Informationsfluss selbsttätiger Netzwerkanalysator selbsttätiger Netzwerkanalysator selbsttätiger programmgesteuerter Roboter selbsttätiger Roboter selbsttätiger Unterbrecher automatique selbsttätiger Wechselstromkompensator alternatif selbsttätiger Werkstückfluss selbsttätiger Werktückfluss selbsttätiger Werktückfluss selbsttätiger Werkzeugfluss selbsttätiges komplexes Regelungssystem selbsttätiges Lesen selbsttätiges Regelsystem selbsttätiges Regelsystem selbsttätiges Regelungssystem selbsttätiges Steuerventil selbsttätiges Suchen selbsttätiges Ventil Selbsttestelektronik Selbstüberwachungsstellglied Selbstunterbrecher Selbstunterbrechungsschaltung selbstversorgtes Gerät Selbstwählfernsprechsystem selektieren (Werkstück) Selektionsmethode selektives Bandfilter Selektivitätskurve Selektivregelung automatic resetting automatic recorder recording meter autooscillation link autooscillation system self‐sustained oscillation system ultrastability self‐starting synchronous motor self‐gating self‐clocking self‐clocking system automatic self‐acting automatically operating automatic arc welding equipment automatic arc welding machine automatic balancing machine automatic data exchange automatic data exchange, ADE automatic control system for electric drive automatic sequence control automatic conveying automatic coding autocorrelation function self‐correlation function self‐operated measuring unit automatic tracking automatic zero balancing automatic zero adjustment auto control automatic control self‐regulation automatic regulation gas distribution automatic control automatic resetting automatic blocking automatic interlocking automatic lockout automatic control device automatic address substitution automatic reclosing automatic cycle automatic regulator automatic process correlator automatic energy flux automatic flow of information automatic flow of informations automatic network analyzer automatic network analyzer, ANA automatic program‐controlled robot automatically operated robot automatic breaker automatic alternating‐current compensator automatic work flow, automatic parts flow automatic work flow automatic parts flow automatic tool flow complex automatic control system automatic reading automatic closed‐loop control system automatic monitored control system automatic control system automatic control valve automatic search automatic valve self‐test electronics automatic checking actuating unit automatic cut‐out self‐interrupting circuit self‐powered device dial telephone system select to (work piece) selection method band‐selective filter selectivity characteristic selective adjustment stran 253 od 326 EN ‐DE: slovar avtomatizacije in robotike Selektivschütz Selektivschutzrelais Selektivschutzsystem Selektivsteuerung Selektivverstärker Selektor Selektorkanal Selektorsystem Selektorsystem Selsyn Selsyn Selsyn mit zwei Geschwindigkeiten Selsynnullstellungsgerät Selsynsteuerung Selsynsynchronsystem Semantik feiner Robotersprache semantische Sprachanalyse Semidefinitheit Semiduplex‐Lichtwellenleiterübertragung semipermanent semipermanente Daten pl Sende[r]modul Sendeanforderung Sendedaten pl Sendeverzerrung sensible Daten pl sensibler Sensor Sensor (erkennendes Element zur Informationsgewinnung Sensor (Fühler) mit Impulsemission (für Roboter) Sensor eines Industrieroboters Sensor für drei Kraftkomponenten Sensor für Identifikation fester Objekte Sensor für Kraftmomente Sensor für Spannungen Sensor mit hohem Auflösevermögen Sensor mit Laserstrahlen Sensor mit Laserstrahlen Sensor mit Lumineszenzdiode und Fototransistor Sensor mit Lumineszenzdiode und Fototransistor Sensor mit optischer Faser Sensor mit Optokopf (optischem Kopf) (für Roboter) Sensor raster Sensorabstand Sensorabtastgerät Sensorabtastung Sensoraktion Sensorangebot Sensoranordnung Sensoranzahl Sensorarm Sensoraufbau Sensorausrüstung Sensorbaueinheit Sensorbauelement Sensorbauelement Sensorbauelement Sensorbefehl Sensorblock Sensordaten eines Industrieroboters Sensordaten pl Sensordatenauswertung Sensordatenerfassung Sensordatenverarbeitung Sensoreigenschaft Sensoreinsatz Sensoreinsatzbereich Sensorelement Sensoren auf der Handoberfläche Sensorentwicklung Sensorentwicklung Sensorentwurf Sensorerkennungsproblem Sensorfaser Sensorführung Sensorfunktion sensorgeführte Greiferbewegung discriminating relay discriminating relay discriminating protective system selective control selective amplifier selector selector channel gating system selector system selsyn synchro dual speed synchro system instrument for selsyn zeroing selsyn control selsyn‐type synchronous system robot language semantics semantic language analysis semidefiniteness semiduplex optical fiber transmission semipermanent semipermanent data transmitter module request to send transmit data transmitting distortion sensible data sensible sensor sensor sensor with pulse emission (for robots), detection element wit robot sensor, industrial robot sensor sensor for three force components sensor for identification of solid objects sensor for force moments voltage sensor sensor with great resolving power laser beam sensor laser‐beam sensor sensor with luminescence diode and photo transistor sensor with luminescence diode and phototransistor sensor with optical fibre sensor with opto‐head sensor raster sensor distance sensor scanning device sensor scanning sensor action sensor supply sensor arrangement number of sensors sensor arm sensor structure sensor equipment sensor construction unit sensor component, sensor part sensor component sensor part sensor instruction sensor block sensor data of [industrial] robot sensor data sensor data evaluation sensor data acquisition sensor data processing sensor property sensor application application area of sensor sensor element, sensorial element sensors on hand surface development of sensor sensor design sensor design sensor identification problem sensor fibre sensor guide sensor function sensor‐guided gripper movement stran 254 od 326 EN ‐DE: slovar avtomatizacije in robotike sensorgeführte Roboterbewegung sensorgeführte Robotersteuerung sensorgeführte Steuerung sensorgeführter Industrieroboter sensorgeführter Montageroboter sensorgeführter Roboterarm sensorgeführter Schweißautomat sensorgeführter Schweißroboter Sensorgenauigkeit Sensorgeneration Sensorgeometrie Sensorgerät sensorgeschaltete Schwingbewegung sensorgeschaltete Schwingbewegung sensorgesteuert sensorgesteuerte Achse sensorgesteuerte Feinbewegung sensorgesteuerte Feinbewegung sensorgesteuerte flexible Backenprofile sensorgesteuerte Positionierung sensorgesteuerte Robotereinrichtung sensorgesteuerte Robotererkennungseinrichtung sensorgesteuerte Roboterhardware (IR‐Hardware) sensorgesteuerter Fügemechanismus sensorgesteuerter Industrieroboter sensorgesteuerter Manipulator sensorgesteuerter Montagegreifer sensorgesteuerter Montageroboter sensorgesteuerter Roboterarm (Industrieroboterarm) sensorgesteuerter Wechsel‐g reifer sensorgesteuerter Wechselgreifer sensorgesteuertes Backenprofil sensorgesteuertes Fügen sensorgesteuertes Element sensorgesteuertes Fügen sensorgesteuertes Robotergerät sensorgestützter Roboter Sensorik Sensorikanwendung Sensorikanwendung Sensorimpuls Sensorindustrie Sensorinformation sensorischer Geber sensorischer Kontaktgeber sensorisches Element sensorisches Gerät sensorisches System sensorisierter Finger sensorisiertes Fügen sensorisiertes System Sensorkanal Sensorkontakt Sensorkontaktfläche Sensorkopf Sensorkörper Sensorkraftaufnehmer Sensorkrafterfassung Sensorlageinformation sensorloses Online‐Überwachungssystem Sensormatrix Sensormessung Sensormodelle Sensormoment Sensormomenterfassung Sensormustererkennung Sensorobjektidentifizierung Sensorpotentiometer Sensorprinzip Sensorprozessor Sensorrauschsignal Sensorrohr Sensorschicht Sensorsichtsystem Sensorsignal Sensorspannung Sensorstatus sensor‐guided robot movement sensor‐guided control, sensor‐guided robot control sensor‐guided control, sensor‐guided robot control sensor‐guided industrial robot sensor‐guided assembly robot sensor‐guided robot arm sensor‐guided welding automation sensor‐guided welding robot sensor accuracy generation of sensors sensor geometry sensorial device, sensor device sensor‐connected oscillatory motion sensor‐connected oscillatory motion sensor‐controlled sensor‐controlled axis sensor‐controlled fine motion sensor‐controlled fine motion (movement) sensor‐controlled flexible jaw profiles sensor‐controlled positioning sensor‐controlled robot device sensor‐controlled robot identification device sensor‐controlled robot hardware sensor‐controlled joint mechanism sensor‐controlled industrial robot sensor‐controlled manipulator sensor‐controlled assembly gripper sensor‐controlled assembly robot sensor‐controlled industrial robot arm, sensor‐controlled robo sensor‐controlled change gripper sensor‐controlled change gripper sensor‐controlled jaw profile sensor‐controlled element sensor‐controlled joint[ing] sensor‐controlled robot device sensor‐based robot sensor technique, sensorics application of sensor technique, application of sensorics application of sensor technique; sensor pulse sensor industry sensor information sensorial transmitter sensorial contact transducer (transmitter) sensor element, sensorial element sensorial device, sensor device sensor system sensorized finger sensorized jointing sensorized system sensor channel sensor contact sensor contact surface Sensor head sensor body force receiver of sensor sensor force acquisition sensor position information sensorless online monitoring system sensor matrix sensor measurement sensor models sensor moment sensor moment acquisition sensor pattern recognition sensor object identification sensor potentiometer sensor principle sensor processor sensor noise signal sensor pipe, sensor tube sensor layer sensor visual system sensor signal sensor voltage sensor state (status) stran 255 od 326 EN ‐DE: slovar avtomatizacije in robotike Sensorsteuerung Sensorsystem Sensortaste Sensortechnik Sensortechnik‐Applikation Sensortechnik‐Applikation Sensorteilinformation Sensortyp Sensorüberwachung Sensorüberwachung der Robotergreifkraft Sensorverarbeitung der Information Sensorzeile Sensorzustand separates Modul Separation Separation Separationsprinzip separierte Daten pl sequentiell sequentiell sequentielle Basiszugriffsmethode sequentielle Basiszugriffsmethode sequentielle Berechnung sequentielle Logik sequentielle Steuerung sequentielle Steuerung sequentielle Steuerung sequentielle Verarbeitung sequentieller Automat sequentieller Betrieb sequential processing 568 sequentieller digitaler Servomechanismus sequentieller Entscheidungsprozess sequentielles Korrekturglied Sequenzanalyse seriell seriell serielle Datenleitung serielle Übertragung serielle Übertragung serieller Dateneingang serieller Datenkanal serieller Zugriff Serienadder Serienaddierer Serienkompensationsnetzwerk Serienkondensator Serien‐Parallel‐Arithmetik serienparalleles System Serienprinzip Serienproduktion Serienproduktion Serienproduktion Serienrechenwerk Serienresonanz Serienschalter Serienschalter Serienschaltung Serienschaltung Serienschaltung der Glieder im Regelkreis Serienschaltung der Regelkreisglieder Serienstabilisierung Serienübertragung Serienübertragung serienweise Informationsübertragung serienweiser Zugriff Servicefunktion Serviceprozessor Servoanalysator servobetrieben Servogerätausgangssignal servohydraulischer Manipulatorantrieb servohydraulischer Manipulatorantrieb servohydraulique servohydraulischer Roboterantrieb Servomechanismus für Dauerbetrieb Servomechanismus für Dauerbetrieb Servomechanismus zweiter Ordnung sensor control sensor system sensor key sensor technique, sensorics application of sensor technique, application of sensorics application of sensor technique; sensor partial information sensor type sensor survey sensor survey of robot grip force sensor processing of information sensor line sensor state (status) separate module separation separating separation principle separated data sequential serial basic sequential access method basic sequential access method, BSAM sequential calculation sequential logic run‐off control series control sequential control sequential processing sequential automaton sequential operation sequential digital servomechanism sequential decision process sequential correcting element sequential analysis sequential serial serial data line serial transfer serial transmission serial data input serial data channel serial access serial adder serial adder tandem compensation network series capacitor serial‐parallel arithmetic series‐parallel system serial principle production in series serial production series manufacture serial arithmetic unit series resonance commutation switch change‐over gate cascade connection series connection linear combination of control‐loop elements linear combination of control‐loop elements series stabilization serial transfer serial transmission series transmissions of informations serial access service function service processor servoanalyzer servo‐driven servo‐output signal Servo hydraulic manipulator drive servo‐hydraulic manipulator drive Servo hydraulic robot drive Servo mechanism for continuous operation servomechanism for continuous operation second‐order servo stran 256 od 326 EN ‐DE: slovar avtomatizacije in robotike Servomotor Servomotor Servomotor mit fortschreitender Bewegung Servomotor mit Kurbelantrieb Servomultiplizierer Servopotentiometer Servoregler Servoregler Servoregler Servoregler Servoschalter Servoschleife Servosteuerung Servosystem Servosystem Servosystem Servosystem mit magnetischem Verstärker Servosystemstabilität Setzen eines Zählers Sheffer‐Funktion sich aufhebende Fehler sichere Reaktorregelung Sicherheit Sicherheit Sicherheit Sicherheit Sicherheit Sicherheit der Datenübertragung Sicherheitsanforderungen für Roboter Sicherheitsfaktor Sicherheitsfaktor Sicherheitsfunktion Sicherheitsgurt mit automatischer Aufhängung Sicherheitskreis Sicherheitsprogramm Sicherheitsregler Sicherheitsrelais Sicherheitssensor Sicherheitssperre Sicherheitssystem in unvermaschter Sicherheitssystem in unvermaschter Sicherheitstechnik sicherheitstechnische Einrichtung Sicherheitsventil Sicherheitsventil mit Gewichtshebel Sicherheitsverriegelung Sicherheitsvorrichtung (eines Roboters) Sicherung Sicherung gegen Störung Sicherungsautomat Sichtgerät Sichtgerät Sichtkontrolle Sichtkontrolle Sichtorientierung Sichtsensor Sichtsensorsystem Sichtsystem Sichtsystemgeneration Sichtsystemstruktur Siebdruckverfahren (mittels Roboter) Siebung Signal aus der Peripherie Signal automatischer Blockierung Signal eines Industrieroboters Signal mit hohem Pegel Signal mit niedrigem Pegel Signal zum Übertrag Signalabsonderung aus dem Rauschen Signalabtastung Signalanalyse Signalaufbereitung Signalauswahl Signalauswähler Signalauswertung Signalbandbreite power cylinder servomotor prograssive motion servomotor level power cylinder servomultiplier servopotentiometer servo regulator follow‐up controller servofollower servoregulator servo switch servoloop servocontrol Servo system follow‐up system servosystem magnetic amplifier servosystem servostability set of counter Sheffer's function compensating errors safe reactor control dependability safety eqiupment dependability equipment safety reliability safety in data transmission safety requirements for robots factor of safety safety factor safety function safety belt with automatic suspension safety circuit safety program safety regulator safety relay safety sensor safety interlock non‐interacting safety system single‐loop safety system safety technology safety‐technical device safety valve level safety valve safety interlock safety device (of robot) safety fuse antiblocking device automatic cut‐out display device display unit visual check[ing] visual checking view orientation visual sensor visual sensor system visual system visual system generation visual system structure silk screen process (by robot) filtering peripheral signal signal of automatic blocking robot signal, signal of industrial robot high‐level signal low‐level signal carry initiating signal detection of signal in noise signal scanning wave analysis signal conditioning signal selection signal selector signal evaluation signal bandwidth stran 257 od 326 EN ‐DE: slovar avtomatizacije in robotike Signalbehandlung Signalbehandlung Signalblock Signalcharakter Signaldämpfung Signaldarstellung Signaldaten pl Signaldauer Signalentschlüsselung Signalerfassung Signalerkennung Signalflussbild Signalflussbild Signalfolge zum Belegen der Koppeleinheit Signalformung Signalgeber Signalgebung Signalgemisch Signalhauptleitung Signalhüllkurve signalisierter Roboterfehler Signalisierung Signalkode Signalkonverter Signalkopplung Signalkorrelation Signallampe Signallampe Signalleitung Signallinearität Signalmuster Signalnachspürer Signalpegel Signalprobenabnahme Signal‐Rausch‐Abstand Signal‐Rausch‐Verhältnis Signalschwelle Signalselektor Signalspeichersystem Signalstärkeregelung Signaltafel Signaltaste Signalübertragungsgeschwindigkeit Signalübertragungsstärke Signalumsetzer Signalverarbeitung Signalverarbeitung Signalverarbeitung feines IR Signalverfolger Signalverteiler Signalverzögerung Signalverzögerungszeit Signalwandler Signalwandlungseinrichtung Signifikanzkriterium Signifikanzniveau Signifikanzuntersuchung Signum‐Funktion Simplexalgorithmus Simplexbetrieb Simplexkanal Simplexkriterium Simplexmethode Simplexmethode Simplexverfahren Simplexverfahren Simpsonsche Formel Simpsonsche Regel Simulation Simulation Simulation eines kybernetischen Systems Simulation eines physikalischen Vorgangs Simulation nichtlinearer Gleichungen Simulationsergebnis Simulationsprogramm für Montage Simulationsprozessor signal handling signal processing signal block signal character damping of a signal signal representation signal data signal duration signal decoding signal acquisition signal recognition block diagram functional block diagram capture interface sequence signal conditioning signal generator signalling composite signal signal main line amplitude envelope signalized robot error signalling signal code signal converter signal coupling signal correlation indicating lamp check indicator signal line linearity of signal signal sample signal tracer signal level sampling [action] signal‐to‐noise ratio signal‐to‐noise ratio signal threshold signal selector signal storage system signal strength adjustment annunciator board signal button signal transmission speed signal transmission level signal converter signal handling signal processing signal processing of IR signal tracer signal distributor signal delay signal delay time signal converter signal conversion equipment significance criterion level of significance significance study Signum function simplex algorithm simplex operation simplex channel simplex criterion simplex method simplex technique simplex method simplex technique Simpson's rule Simpson's rule simulation computer simulation simulation of cybernetic system simulation of physical phenomenon simulation of non‐linear equation simulation result assembly simulation program simulator processor stran 258 od 326 EN ‐DE: slovar avtomatizacije in robotike Simulationsprüfung Simulationsrechnung Simulationssprache Simulationssystem Simulationstechnik Simulationsverfahren Simulationsverfahren für Montage Simulationsvorteil Simulator Simulator einer Robotersoftware Simulatorsteuerung simulieren simulierter Entwurf simulierter Roboter simuliertes Programm Simulierung typischer Nichtlinearitäten simultan simultan zur Aufgabenbearbeitung durchgeführte Simultanbewegungen simultane Ausführung simultane Mehrfachoptimierung simultane Trennung Simultansteuerung in Verteilungsnetzen Simultanverarbeitung Singleton Singleton singuläre Matrix singuläre Trajektorie singulärer Automat singulärer Punkt Sinus Sinusantwort sinusförmige Modulation sinusförmiges Eingangssignal Sinusfunktion Sinusfunktion Sinus‐Kosinus‐Potentiometer Sinussignalgenerator Sinusstörung Situationsanzeige Skalar skalare Achse skalare Feldtheorie skalare Größe skalares Variationsproblem Skalarfunktion Skalarprodukt Skale Skalendurchlaufzeit Skaleneinheit Skaleneinstellung Skalenendwert Skalenintervall Skalenscheibe Skalenteilung Slave‐arm Slave‐Prozessor Slave‐Prozessor Slave‐Prozessor Slave‐Roboterarm S‐Norm s‐Norm s‐Norm s‐Norm Sofortbildsystem sofortiger Zugriff sofortiger Zugriff Sofortmaßnahme Sofortverarbeitung Softgreiferglied Softgreiferkraft Softgreiferrollen Softgripper‐Prinzip Software Software eines Industrieroboters Software eines Montageroboters simulation testing simulation computation simulation language simulation system simulation techniques simulation procedure assembly simulation process simulation advantage, advantage of assembly simulation simulator simulator of robot software simulator control simulate v simulated design simulated robot simulated program typical non‐linearity simulation simultaneous concurrent testing simultaneous movements simultaneous executing multiple simultaneous optimization multielement separation simultaneous control in distribution networks simultaneous processing fuzzy singleton, singleton singleton singular matrix singular trajectory singular automaton singular point sine sine response sinusoidal modulation sinusoidal input sine function sine‐function sine‐cosine potentiometer sinusoidal signal generator sinusoidal disturbance situation display scalar quantity scalar axis scalar fielad theory scalar quantity scalar variational problem scalar function scalar product scale scale time scale unit scale positioning full‐scale value scale interval calibrated dial scale division slave robot arm support processor support processor, slave processor slave processor slave robot arm s‐norm, triangular conorm, t‐conorm s‐norm t‐conorm triangular conorm immediate image system immediate access instantaneous access emergency measure real‐time processing element of soft gripper, soft‐gripper element Soft gripper force, force of soft gripper Soft gripper rolls, rolls of soft gripper Soft gripper principle software robot software, IR software assembly robot software stran 259 od 326 EN ‐DE: slovar avtomatizacije in robotike Software eines Plattensystems Software für Bildanalyse Softwareanforderung Softwareanwendung Softwareapplikation Softwareausstattung Software‐Diagnose Software‐Entwicklungssystem Software‐Fehlersuche Software‐Forschung software‐gesteuert softwaregestütztes Erkennungssystem softwaregestütztes Erkennungssystem software Softwareprojekt Software‐Robotersteuerung Software‐Struktur Softwaresystem mit Steuer Programm Softwaresystemrücksetzen Softwaresystemrücksetzen Softwaresystemrücksetzen Softwaretechnik Softwaretechnik Solenoidantrieb Solenoidservomechanismus Solenoidventil Soll‐Bahn Solleistung Sollgeschwindigkeit Soll‐Istwert‐Vergleich Sollmuster einer Objekterkennung Sollstrom Sollwert Sollwert Sollwert Sollwert Sollwert Sollwert Sollwert Sollwert Sollwert Sollwert der Regelgröße Sollwertänderung Sollwertbereich Sollwerteinsteller Sollwerteinsteller Sollwerteinstellung Sollwertfolge Sollwertgeber consigne Sollwertvergleich Sonderausrüstung Sonderbefehl Sonderfunktion Sondermaschineneinsatz Sonderspeicher Sortiereinrichtung sortieren sortieren Sortierhilfen Sortierprozess Sortiervorgang Spaltbreiteneinstellung Spaltenanzeiger Spaltenvektor Spaltungsimpuls spanende Bearbeitung spanlose Kaltverformung Spannelemente spannen spannen Spannfutter Spannkraft Spannmittel Spanntechnik Spannung in Flußrichtung Spannungsabfall Spannungsabfragegruppe disk system software image analysis software software request software application software application software package software diagnostic software development system software diagnostic software research software‐controlled Software‐aided identification system softwareaided identification system software project software robot control software architecture software system with control program backspace of software system, reset of software system backspace of software system reset of software system software technique software technique solenoid actuator solenoid servomechanism solenoid valve nominal path demand power velocity rating nominal‐actual value comparison nominal design of object identification rated current command command input desired value index value nominal value reference input reference variable required value set value final control condition desired value change range of set value director set‐point adjuster set‐point adjustment sequence of nominal value set‐point adjuster nominal value comparison special equipment special instruction special function application of special machines zone (of a computer) sorting device classify v sort v sorting aids sorting process sorting process gap adjustment column indicating device column vector fission pulse machining chipless cold deformation clamping elements clamp to clamp v chuck progressing force holding tool clamping technique forward voltage voltage drop voltage inquiry group stran 260 od 326 EN ‐DE: slovar avtomatizacije in robotike spannungsabhängiger Widerstand Spannungsanalogon Spannungsauslösung Spannungsbegrenzer Spannungsbegrenzer Spannungsbereich Spannungsdeviator Spannungseichgerät Spannungserniedriger Spannungsfernmessung Spannungsfunktion Spannungsgegenkopplung spannungsgesteuerter Oszillator spannungsgesteuertes Bauelement Spannungsgrenzwerttest Spannungskomparator Spannungspegel Spannungsregelung Spannungsregler Spannungsregler Spannungsrichtung Spannungssensor Spannungssprung Spannungsstabilisator Spannungsstabilisator Spannungsstabilisierungssystem Spannungsteiler Spannungsteiler Spannungstheorie Spannungstheorie Spannungsverdoppler Spannungsverdopplungsschaltung Spannungsvergleicher Spannungsverstärker Spannungsverstärkung Speicher einer Ablaufsteuerung Speicher einer Ablaufsteuerung Speicher eines Industrieroboters Speicher eines Industrieroboters Speicher eines Industrieroboters Speicher für Fertigungsprogramm Speicher für Roboterdaten Speicher mit akustischem Laufzeitglied Speicheradapter Speicheraufbau Speicheraufbau Speicheraufbau Speicheraufbau Speicherausnutzung Speicherausnutzung Speicherbereich Speicherbereich Speicherbereichserweiterung Speicherbewegungsmedium Speicherbewegungsmittel Speicherbildgerät Speicherblock Speicherdaten pl Speicherdiskette Speicherelement Speicherelement mit Vormagnetisierung Speichererneuerung Speicherfähigkeit der Regelkreisglieder Speicherfunktion Speichergeschwindigkeit speichergesteuerter Manipulator Speicherherstellungstechnologie Speicherinhalt Speicherintegrator Speicherkapazität Speicherkondensator Speicherkonfiguration Speicher‐Manipulator‐Beziehung speichern Speichern einer Floppy‐Datei Speicheroperation varistor voltage analog shunt tripping overvoltage device voltage limiter voltage range stress deviator voltage calibrator negative booster voltage‐type telemetering (US) voltage function negative voltage feedback voltage‐controlled oscillator voltage‐driven device marginal voltage check voltage comparator voltage level voltage control voltage regulator voltage stabilizer voltage direction voltage sensor voltage jump voltage stabilizer constant‐voltage regulator voltage regulating system voltage divider potential divider theory of strain tension theory voltage doubler voltage‐doubling circuit voltage comparator booster voltage gain development control memory development control memory (store) robot memory robot memory, robot store, IR memory, IR store robot store manufacturing program memory memory for robot data acoustic delay line memory storage adapter, memory adapter memory assembly, store assembly memory assembly memory configuration store assembly memory efficiency storage efficiency memory zone memory area store zone extension, memory zone extension, store area exten storage movement medium storage movement medium store display unit memory block store data memory diskette memory element coincident flux device storage regeneration capacity of element of automatic control system storage function storage speed memory‐controlled manipulator, store‐controlled manipulato memory fabrication technology store contens store integrator memory capacity reservoir capacitor memory configuration memory‐manipulator relation, store‐manipulator relation store v storage of floppy file memory operation stran 261 od 326 EN ‐DE: slovar avtomatizacije in robotike Speicheroszillograf Speicherplatz Speicherplatz Speicherplatzbedarf Speicherplatzzahl Speicherprinzip Speicherprinzip Speicherprinzip speicherprogrammierbare Robotersteuerung speicherprogrammierte Steuerung speicherprogrammierte Steuerung speicherprogrammierte Steuerung speicherprogrammierte Steuerung speicherprogrammiertes Verfahren Speicherregister Speicherrückstellung auf Null Speicherschaltung Speicherschutzvorrichtung Speicherstation feines Industrieroboters Speichersteuerung Speichersteuerung Speicherstufe Speichersystem Speichersystem Speicherung mit wahlfreiem Zugriff Speichervermittlung Speicherverteilung Speicherverteilungskontrolle Speicherverteilungskontrolle Speicherverteilungskontrolle Speicherverwaltungseinheit Speicherwerk Speicherwerk Speicherwiederherstellung Speicherzone Speicherzone Speicherzugriffsschutz Speisedruck supporting function 598 Speiseenheit Speisefrequenz Speisefrequenz speisen Speiser Speiseregler Speiseschaltung Speisestrom Speisevorrichtung Speisewasserregelung Speisung Speisung des Reglers Speisungsunterbrechung Spektralanalysator Spektralanalyse Spektralanalyse in hydraulischen Systemen Spektralangaben Spektralbolometer Spektralcharakteristik Spektralcharakteristik spektrale Dämpfungskurve spektrale Emissionsfähigkeit spektrale Fehlerdichte spektrale Selektivität spektrale Verteilungscharakteristik spektrale Verteilungscharakteristik Spektralempfindlichkeit Spektralempfindlichkeit spektraler Absorptionsgrad spektraler Emissionsgrad Spektralfunktion Spektralindex Spektralkurve Spektralselektivität spektrochemische Messung mit Digitalzähler Spektrometer mit großer Spektrometer mit Proportionalzählrohr Spektrometer mit schneller Abtastung storage oscillograph memory location store location memory location demand, store location demand memory location number, store location number memory principle, store principle memory principle store principle memory‐programmable robot control, store‐programmable ro memory‐programmed control, store‐prog rammed control memory‐programmed control teach‐in control storeprogrammed control teach‐in process memory register memory return to zero memory circuit memory protection system robot memory station, industrial robot memory station memory control storage control accumulator stage memory system storage system random access storage message switching allocating memory distribution checking, store distribution checking memory distribution checking store distribution checking memory management unit store mechanism memory mechanism storage regeneration memory zone memory area memory access protection supply pressure supply block supplay frequency supply frequency drive v feed apparatus feed controller feeding circuit supply current feed[ing] system water supply control feed[ing] regulator supply dump spectrum analyzer spectrum analysis spectral analysis in hydraulic systems spectral information spectrobolometer spectral‐response characteristic spectralresponse curve spectral loss curve spectral emissivity spectral error density spectral selectivity spectral‐response characteristic spectralresponse curve spectral responsivity spectral response spectral absorptance spectral emissivity spectral function spectral index spectral curve spectral selectivity spectrochemical measurement with digital counter rapid‐scan spectrometer proportional counter spectrometer rapid‐scan spectrometer stran 262 od 326 EN ‐DE: slovar avtomatizacije in robotike Spektrum der angeregten Zustände Sperrbereich Sperrelais Sperrelais Sperrelais Sperrelais sperren Sperrfilter Sperrfilter Sperrichtung Sperrimpuls Sperrkennlinie Sperrkippsender Sperrkippsender Sperrklinkenrelais Sperrkondensator Sperrkreis Sperrkreis Sperrleitwert Sperrmagnet Sperrschalter Sperrschalter Sperrschaltung Sperrschaltung Sperrschaltung Sperrschichtgleichrichter Sperrschichtgleichrichter Sperrschichtkapazität Sperrschichtkapazität Sperrschütz Sperrschwinger Sperrschwinger Sperrsignal Sperrsignal Sperrsignal Sperrspannung Sperrstromkreis Sperrstromkreis Sperrung Sperrung Sperrung des Interruptsystems Sperrwiderstand Sperrzeit Sperrzustand Sperrzyklus Spezial[zweck]rechner Spezialanwendung Spezialbaustein Spezialbauuntergruppe Spezialbefehl Spezialfügemechanismus Spezialgreifer spezialisierter Baustein spezialisierter Manipulatoreinsatz spezialisierter Rechner Spezialmaschine Spezialschaltung Spezialschraubendreher Spezialtestprogramm Spezialtestprogramm Spezialwerkzeug Spezialzweck‐Logikschaltkreis speziell zugeschnittene Struktur spezielle Montageausrüstung Spezialkamera für Roboter spezielle Programmiersprachen spezielle Programmierstrategie spezielle Roboterprogrammierung spezielle Zustände spezieller Bildprozessor spezieller Roboterfinger spezieller Sensor Prozessor spezieller Sensorprozessor spezielles Greiforgan spezielles Prüfprogramm spezielles Prüfprogramm spezielles Softwareprogramm für einen Roboter excited state spectrum stop band blocking relay closing relay guard relay interlocking relay inhibit v band elimination filter band rejection filter blocking direction inhibit pulse blocking characteristic blocking generator blocking oscillator latched relay blocking capacitor band elimination filter band rejection filter back conductance blocking magnet gating switch holding key inhibiting circuit lock[ing] circuit time delay circuit barrier‐layer rectifier junction rectifier barrier capacity barrier‐layer capacitance blocking contactor blocking generator blocking oscillator cut‐off signal inhibiting signal disabling signal back voltage blocking circuit interlock circuit blocking interlock[ing] disabling of the interrupt system blocking resistance cut‐off time blocking state blocking period special‐purpose computer special application specialized device special sub‐assembly special instruction special jointing mechanism special gripper specialized device specialized manipulator use special‐purpose computer special machine special circuitry special screw driver special test program special test routine special tool special‐purpose logic chip dedicated structure special assembly equipment special programming languages special programming strategy special robot programming special states special image processor special grab member, special grabbing element special sensor processor special sensor processor special grab member, special grabbing element special test program special test routine special software program for robot stran 263 od 326 EN ‐DE: slovar avtomatizacije in robotike spezielles System Spezifikation einer Robotertrajektorie Spezifikationssprache spezifische Form eines Werkstücks spezifische Form feines Werkstücks spezifische Funktion spezifische Verwendung spezifischer Impuls spezifiziertes Datenbyte spezifiziertes Datenbyte sphäroidischer Arbeitsraum Spiegelbildbearbeitung Spiel spielarmes Robotergetriebe Spieleinstellung feines Greifers spielfreier Greiferantrieb spielfreies Robotergetriebe Spieltheorie Spieltheorie Spindelantrieb Spitze eines Greiforgans Spitzen‐ Datenübertragungsgeschwindigkeit f Spitzenamplitude Spitzenbelastung Spitzendruckmesser Spitzenenergie Spitzenflussdichte Spitzenfrequenz Spitzenkontakt Spitzenleistung Spitzensignal Spitzenspannung Spitzensperrspannung Spitzensperrspannung Spitzenstrom Spitzentechnologie Spitze‐Null‐Spannung Spitzenwert Spitzenwert Spitzenwert der magnetischen Erregung Spitzenzähler Spitzenzeit Spitze‐zu‐Spitze‐Amplitude Spitze‐zu‐Spitze‐Amplitude sprach gesteuerter Roboter Sprachanalyse Sprache eines Roboters Sprache für automatische mechanische Montage Sprache für automatische mechanische Montage Sprache zur Anwendungssteuerung Spracheingabe Sprachgrundsymbol Sprachoperation Sprachspeicher Sprachsyntax Springkontakt Spritzdruckgefäß eines Roboters Spritzgießen (von Plasten) Spritzgießen (von Plasten) Spritzkopf eines Industrieroboters Spritzmanipulator Spritzmanipulator Spritzroboter Spritzroboterzyklus Sprühpistoleneffektor Sprung Sprung Sprungantwort Sprungantwort sprungartige Änderung sprungartige Geschwindigkeitsänderung Sprungbefehl Sprungbefehl Sprungfunktion Sprungfunktion Sprungprogramm particular system specification of robot trajectory specification specific shape of work piece specific shape of specific function specific use specific impulse specified data byte specified data byte spheroid operating space mirror image operation (symmetrical switching) backlash robot gear with small play adjusting of gripper play, gripper play adjusting gripper drive free from play robot gear free from play theory of game game theory spindle drive grip organ point peak data transfer rate peak amplitude peak load peak pressure meter peak energy peak flux density peak frequency point contact maximum output peak signal peak voltage peak reverse voltage peak inverse voltage peak current top technology peak‐to‐zero voltage crest value peak value peak magnetizing force maximum demand indicator peak time double amplitude peak peak‐to‐peak amplitude language‐controlled robot language analysis robot language, IR language language for automatic mechanical assembly LAMA, language for automatic mechanical assembly application control language, ACL voice input basic symbol of programming language language operation language memory, language store language syntax instantaneous contact robot pressure tank injection moulding, moulding by injection (of plastic material) injection molding, molding by injection (US) extruder head of industrial robot manipulator for moulding by injection (of plastic material), US paint spray manipulator, paint spray handler paint spray robot paint spray robot cycle spray‐pistol effector jump step step response step response abrupt change step velocity input alternate instruction jump instruction jump function step function jump program stran 264 od 326 EN ‐DE: slovar avtomatizacije in robotike Sprungschalter grande vitesse Sprungschalter grande vitesse Sprungschalter grande vitesse Sprungvorschub Spulensteigungsmaß SRAM SRAM SRAM stabile Daten pl stabile Knotenpunktmenge stabile Regelung stabiler Knotenpunkt stabiler Zustand stabiler Zustand stabiler Zustand stabiles Bauelement stabiles Bauelement stabiles Bewegungsverhalten stabiles Bewegungsverhalten stabiles Element stabiles Element stabiles Leistungsniveau stabiles System Stabilisator stabilisierendes Rückkopplungsnetwerk Stabilisierschaltung stabilisierte Stromversorgung stabilisierte Stromversorgung stabilisierte Stromversorgung stabilisierter Gleichrichter stabilisierter Supraleiter Stabilisierung Stabilisierungsdauer Stabilisierungsstromkreis Stabilisierungssystem Stabilisierungszeit Stabilität Stabilität Stabilität automatischer Regelkreise Stabilität der geschlossenen Schleife Stabilität der periodischen Lösung Stabilität des offenen Regelkreises Stabilität im Großen Stabilität im Großen Stabilität im Kleinen Stabilität im Kleinen Stabilität Regeldifferenz Stabilitätsabschätzung Stabilitätsabschätzung Stabilitätsanalyse Stabilitätsanalyse Stabilitätsbedingungen Stabilitätsbedingungen erfüllende Lösung Stabilitätsbereichabgrenzung Stabilitätsfehler Stabilitätsgrad Stabilitätsgrad Stabilitätsgrenze Stabilitätsgrenze Stabilitätsgrenze Stabilitätskriterium Stabilitätskriterium Stabilitätskriterium Stabilitätskriterium von Hurwitz Stabilitätskriterium von Popow Stabilitätslinie Stabilitätslinie Stabilitätslösung Stabilitätsprüfeinrichtung Stabilitätsrand Stabilitätsrand der Amplitude Stabilitätsreserve Stabilitätsresrve der Amplitude Stabilitätsuntersuchung Stabilitätsuntersuchung Stabilitätsuntersuchung linearer Systeme quick‐action switch snap‐action switch snap‐switch intermitted feed coil pitch SRAM, static random access memory static random access memory SRAM stable data stable node point quantity stable control stable nodal point stable state steady state steady‐state regime stable component stable element stability behaviour of motion stable behavior of motion stable component stable element equilibrium power level stable system stabilizer stabilizing feedback network compensating network stabilized current supply regulated supply stabilized power supply regulated rectifier stabilized superconductor stabilization stabilization time stabilizing circuit stabilization system stabilization time stability static stability automatic control system stability closed‐loop stability periodic solution stability open‐loop stability stability in the large global stability stability in the small local stability steady‐state control error estimation of stability stability estimation analysis of stability stability analysis stability conditions solution satisfying stability conditions stability domain determination stability error degree of stability stability degree critical stability stability limit stability boundary stability criterion estimation of stability stability estimation Hurwitz stability criterion Popov stability criterion line of stability stability line steady‐state solution stability check device stability margin amplitude stability margin stability margin amplitude stability margin stability analysis analysis of stability linear system stability inverstigation stran 265 od 326 EN ‐DE: slovar avtomatizacije in robotike Stabilitätsuntersuchung nach Bode Stabilitätsuntersuchung nach Evans Stabilitätsuntersuchung nach Evans Stabilitätsuntersuchung nach Kochenburger Stabilitätsuntersuchung nach Nyquist Stabilitätsuntersuchung nach Nyquist Stabilitätsverhalten Stabilitätsverhalten von Zweifachregelkreisen Stabilitätswahrscheinlichkeit Stablängenbelastung Stadium Standard Standard Standardantwortspektrum Standardauslegung Standardausrüstung Standardblock Standardblock Standardbussystem Standardeinheit Standardeinheit Standardelemente Standardgerät Standardgleichgewichtspotential Standardgreifer Standardinterface standardisierte Ausrüstung standardisierte Elemente standardisierte Greiffläche standardisierte Makroinstruktion standardisierte Roboterelemente standardisierte Struktur standardisierter Aufbau standardisierter Baustein standardisierter Greifer standardisiertes Anwendungsprogramm standardisiertes Bausteinsystem standardisiertes Softwaresystem Standardkoordinatensystem i Standardmakroinstruktion Standardmethode Standardmodell Standardprogrammausstattung Standardregelkreis Standardregelkreis Standardresponsespektrum Standardschnittstelle Standardsoftware Standardsoftwareauswahl Standardvektor Standardvereinbarung Ständermanipulator Ständerroboter Standleitung Standsicherheit Stanzkode Stanzleistung Stapelbetrieb Stapelbetriebssystem Stapeljob Stapelmontage Stapelmontageprinzip Stapeln stapeln stapelorientierter Rechner Stapelpositionskoordinaten Stapelprogramm Stapelrechner Stapelsumme Stapelverarbeitung stapelweise Jobverarbeitung stapelweise verarbeiten Stark‐Schwach‐Regelung Stark‐Schwach‐Steuerung starre Begrenzung starre Kopplung Bode method method of Evans Evans method method of least squares method of Nyquist Nyquist method stability behaviour stability behaviour of two‐loop control systems probability of stability linear heat rate stage norm standard standard response spectrum standard design standard equipment standard block standard unit standard bus system standard block standard unit standard elements, standardized elements standard instrument standard equilibrium potential standard gripper, standardized gripper standard interface standardized equipment standard elements, standardized elements standardized grip surface standardized] macroinstruction standardized robot elements standardized structure standardized structure standardized device standard gripper, standardized gripper standardized application program standardized modular system standardized software system standard coordinate system standardized] macroinstruction standard method standard type standard software standard control circuit standard control loop standard response spectrum standard interface standard software standard software selection default vector default declaration (US) support manipulator support robot direct line static stability punch code punch capacity batch operation batch operating system batch job stacking assembly stacking assembly principle stacking store v stack‐oriented computer stacking position coordinates batch program stack computer batch total batch processing stacked job processing, batched job processing batch to high‐low control high‐low control rigid limitation proportional coupling stran 266 od 326 EN ‐DE: slovar avtomatizacije in robotike starre Rückkopplung starre Rückkopplung starre Verkettung starrer Finger Starrkörperkoordinate Starrkörperverschiebung Startbedingungen Startbedingungen Startbit Starten eines Roboterprogramms Startimpuls Startimpuls Startimpulsverhalten Startimpulswirkung Startknopf Startkontrolle Startkopfzeichen Startprogramm Startprogramm Startpunkt Startrampe Startrichtung Startsignal Start‐Stopp‐Betrieb Start‐Stopp‐Taster eines IR Start‐Stopp‐Übertragung Starttaste Starttextzeichen Startvektor Startwert Startwert Startzeit Station eines Industrieroboters stationär stationäre Lösung stationäre Regeldifferenz stationäre Robotermontage stationäre Schwingung stationäre stochastische Einwirkung stationäre stochastische Funktion stationäre Zustandsbedingungen stationärer Funktionsumformer stationärer Iterationsprozess stationärer Kennwert stationärer Miniroboter stationärer Programmträger stationärer Prozess stationärer Reaktor stationärer Zustand stationärer Zustand stationäres Breitbandrauschen stationäres Filter stationäres Verhalten permanent Stationärwert Stationsbestimmung Stationssteuerblock Stationssteuerblock statisch statische Analyse statische Belastung statische Berechnung statische Eichkurve statische Eichkurve statische Empfindlichkeit statische Genauigkeit statische Instabilität statische Lichtempfindlichkeit statische Lösung statische Magnetspeicherung statische Optimierung statische Reaktivität statische Reaktivität statische Schaltung statische Sichtanzeige statische Temperatur statische Umschalteinheit proportional feedback rigid feedback rigid linkage rigid finger rigid‐body coordinate rigid‐body displacement initial conditions starting conditions start bit start of robot program, starting of robot program initiating pulse release pulse starting‐pulse action starting‐pulse action start button launch control start heading character start routine starter, starting] program start point start‐up ramp start direction start signal, starting signal start‐stop operation start‐stop probe of (industrial] robot start‐stop transmission start key start text character start vector start value initial value start time robot station, industrial robot station stationary steady state solution steady state control error stationary robot assembly steady‐state oscillation stationary random action stationary random function steady‐state conditions stationary function converter stationary iterative process steady state characteristic stationary mini‐robot stationary program carrier stationary process stationary reactor steady state steady‐state regime broadband stationary noise time‐invariant filter stationary behaviour conservative value station identifikation station control block, SCB station control block static statics analysis static load[ing] static design static calibration curve static calibrating plot static sensitivity static accuracy static instability static luminous sensitivity static solution static magnetic storage static optimization static reactivity global reactivity static circuitry static display static temperature static switching unit stran 267 od 326 EN ‐DE: slovar avtomatizacije in robotike statische Zuordnung statischer Arbeitspunkt statischer Fehler statischer Fehler statischer Fehler statischer Regler statischer Regler statischer Speicher mit wahlfreiem Zugriff statischer Speicher mit wahlfreiem Zugriff statischer Speicher mit wahlfreiem Zugriff statischer Wirkungsgrad statischer Zustand statisches Analogongerät statisches Einrichtmaß statisches Gleichgewicht statisches Magnetlogikelement statisches System statisches Verhalten statisches Verhalten Statistik Statistikprogramm statistische Analyse statistische Analyse des Systems statistische Auswertung statistische Auswertung statistische Bewertungen statistische Eigenschaft statistische Kompensation statistische Linearisierung statistische Nichtgleichgewichtsmechanik statistische Schwingung statistische Variable statistische Verarbeitung statistische Verarbeitung statistischer Faktor statistischer Test statistisches Modell des Systems statistisches Programm Status Status Status der Geräteeinheit Status der Geräteeinheit Statusbit Statusbyte Statusrettungsschaltung Statuswechsel Statuswechsel Staudruck steckbar steckbar steckbar steckbar Stecker Steckkontakt Steckplan Steckrelais Steckverbindung Steckvorrichtung stehender Greiferständer Steifigkeitsgrad Steifigkeitskoeffizient Steigerung Steilheit Steilheit von Kennlinien Stellantrieb Stellantrieb stellbarer Kontakt Stellbereich Stelleinheit Stelleinheit Stelleinheit Stelleinheit Stelleinheit Stelleinheit positionneur Stelleinrichtung Stelleinrichtung static allocation quiescent point position[ing] error offset steady‐state error static controller static regulator SRAM, static random access memory static random access memory SRAM static efficiency static regime static analog device static setting dimension static balance static magnetic logic element static system static behaviour static performance statistics statistical program statistic analysis system statistical analysis statistical treatment statistical processing statistical estimations statistical property statistical compensation statistical linearization non‐equilibrium statistical mechanics random vibration statistical variable statistical treatment statistical processing statistical factor statistical test statistical model of system statistical program state status device status unit status status bit status byte status‐saving hardware status change state change stagnation pressure pluggable plug‐in plug‐type removable plug plug plugging chart plug‐in relay plug connection plug connection vertical gripper support degree of rigidity stiffness coefficient upgrade slope slope of characteristics actuator motor element adjustable contact correcting range actuating appliance actuating unit regulating element effector regulating unit executive device actuator final control element stran 268 od 326 EN ‐DE: slovar avtomatizacije in robotike Stelleinrichtung stellenbewerteter Kode Stellenergie stellengerechte Anordnung Stellenschreibweise Stellenverschiebung f Steller Stellgeschwindigkeit Stellgeschwindigkeit Stellgeschwindigkeit Stellgeschwindigkeit Stellgeschwindigkeit Stellgeschwindigkeit Stellglied Stellglied Stellglied Stellglied für automatische Kontrolle Stellglieder npi der Bewegungsachsen Stellgröße Stellgröße Stellgröße Stellgröße Stellgröße Stellgrößenänderung Stellgrößengesetz Stellknebel Stellknebel Stellkraftberechnung Stellkrafterzeugung für Roboterbewegung Stellmoment Stellmotor Stellmotor Stellmotor Stellmotor mit konstanter Geschwindigkeit Stellmotor mit Kurbelantrieb Stellorgan Stellorgan Stellorgan Stellorgan Stellorgan Stellorgan Stellort Stellrelais Stellservomechanismus Stellsignal Stellstrom Stellübertragungsfunktion Stellung des Steuergliedes stellungsabhängiger Kode Stellungsanzeiger Stellungskodierer Stellungsmelder Stellungsmessgerät Stellungsrückkopplung Stellungsservosteuerung stellungsunabhängiger Kode Stellwerk Stellwerk Stellwerk Stellwerk Stellzeug Sternschaltung stetig stetig geregeltes System stetig verlaufende selbsttätige Messung Stetigbahnsteuerung Stetigbahnsteuerung stetige Abhängigkeit stetige Annäherung stetige Flüssigkeitsstandmessung stetige Funktion stetige Größe stetige Kurve stetige Regelung stetige Regelung stetige Regelung actuating device weighted code adjusting energy after point alignment positional notation arithmetical shift final control element adjusting speed floating rate control rate floating speed regulation speed control speed actuator executive device final control element, correction device automatic checking actuating unit final control elements of movement axes actuating variable actuating variable, control medium, manipulated variable correcting variable manipulated variable actuating quantity corrective action law of regulating action positioner position mechanism adjusting forces calculation adjusting force generating (generation) of robot movement adjusting moment actuator power cylinder servomotor constant‐velocity servomotor level power cylinder final control element actuating appliance actuating unit regulating element effector regulating unit point of control valve positioner position control servomechanism actuating signal controlling flow actuating transfer function regulating unit position position‐dependent code position indicator position encoder positional checking position measuring instrument position feedback position servocontrol position‐independent code positioner correcting unit final control element position mechanism final control element star connection continuous continuous control system continuous automatic measurement continuous path control path control of [industrial] robot, path control of IR continuous dependence continuous approximation continuous liquid level measurement continuous function continuous variable continuous curve continuous control notchless control infinitely fine control stran 269 od 326 EN ‐DE: slovar avtomatizacije in robotike stetige Steuerung stetige Steuerung stetige Variable stetige Zufallsgröße stetiger Analysator stetiges Fernmessverfahren stetiges Reihenfolgeintervall stetiges selbsttätiges Visko[si]meter continue Stetigkeit Stetigkeitsbedingungen Stetigkeitsprüfung Steuer‐ und Anzeigetafel Steueralgorithmensimulation Steuerautomat Steuerband Steuerband Steuerband Steuerband Steuerband Steuerband eines Industrieroboters steuerbar steuerbare Achse steuerbare Koordinaten steuerbare Koordinaten fpt steuerbare Speicherzuweisung steuerbarer Näherungssensor steuerbares System Steuerbarkeit Steuerbarkeitsmatrix Steuerbefehl Steuerbefehl Steuerbewegung Steuerbus Steuercharakteristik Steuerdaten pl Steuerdaten pl Steuerdatengeneration Steuerdatengeneration r* Steuerdrehmelder Steuerdrehmelder‐Differentialgeber Steuerdrehmeldergeber Steuereingang Steuereingangsignal Steuereinheit Steuereinheit Steuereinheit Steuereinheit Steuereinheit Steuereinheit eines Industrieroboters Steuereinheit für die Außenstation Steuereinrichtung Steuereinrichtung Steuereinwirkung Steuerelektrode Steuerelektronik Steuerelement Steuerfläche Steuerfluss Steuerflussrechner Steuerfolge Steuerfunktion eines Industrieroboters Steuerfunktionsoperation Steuerfunktionsoperation Steuergatter Steuergerät Steuergerät Steuergerät Steuergerät Steuergitter Steuergitter Steuergittereinsatzspannung Steuergliedstellung Steuergröße Steuergröße Steuergröße Steuerhebel continuous control infinitely fine control continuous variable continuous random variable continuous analyzer continuous telemetring constant repetition interval continuous automatic visco[si]meter continuity continuity conditions persistency checking control and display panel control algorithm simulation control automaton control tape, pilot tape control tape control band pilot tape regulation band control tape of [industrial robot controllable controllable shaft controllable coordinates controllable coordinates storage assignment control controllable approximation sensor controllable system controllability controllability matrix control command control word controlling motion control bus control characteristic control information control data control data generation control data generation control synchro synchro‐control differential transmitter synchro‐control transmitter control input signal control input signal controller control device control unit robot control unit control unit of industrial robot robot control unit, control unit of industrial robot terminal control unit control equipment controlling system control action control electrode control electronics pilot cell control area control flux control‐flow computer control sequence robot control function, IR control function control function operation control function operation, CFO steering gate control appliance controller control device control unit control grid signal grid grid cut‐off voltage regulating unit position control quantity controlling quantity controlled variable control lever stran 270 od 326 EN ‐DE: slovar avtomatizacije in robotike Steuerimpuls Steuerimpuls Steuerimpuls Steuerimpuls eines Manipulators Steuerimpulsquelle Steuerinformation Steuerinformation Steuerinformation Steuerinstruktion Steuerkammer Steuerkapazität Steuerkarte Steuerkennlinie Steuerknüppel‐Robotersteuerung Steuerkode Steuerkontakt Steuerleistung Steuerleitung Steuerluft Steuermakro Steuermanipulator Steuermanipulator Steuermodus steuern Steuern (offene Wirkungskette) Steuern des Werkstoffübergangs Steuernachricht Steuernachricht steuernde Maschine Steuerobjekt Steuerobjekt Steuerpaneel Steuerpaneel Steuerparameter Steuerprogramm Steuerprogramm Steuerprogramm Steuerprogramm für Objektherstellung Steuerprogrammentwicklung Steuerprozessor Steuerpult Steuerpult Steuerpult Steuerquittungsschalter Steuerrechner Steuerrechner für Gelenk Steuerschalter Steuerschaltkreis für Mikroprogramm Steuerschaltkreis für Mikroprogramm Steuerschaltung Steuerschaltung Steuerschaltung Steuerscheibe Steuerschmelzleiter Steuerschütz Steuersignal Steuersignal Steuersignale für Roboter Steuersignalerzeugung Steuersignalsender Steuerspannung Steuerspeicher Steuerspeicher Steuersprache Steuersprache eines Industrieroboters Steuerstrom Steuerstromkreis Steuersymbol Steuertakt horloge Steuertastknopf Steuerteil Steuerübertragung Steuerübertragung Steuerumfang eines IR Steuerung Steuerung actuating pulse control pulse driving pulse manipulator control impulsion source of control pulses control information control information control data control command control chamber control capacitance control card control characteristic actuating rod for robot control, robot control by means of the control code control contact driving power control line control air control macro control manipulator regulating circuit control manipulator control mode control v open‐loop control control of metal transfer control message command message controlling machine controlled device controlled member control board control panel controlled variable control program master program steering program control program for object production control program development control processor benchboard console operation console acknowledging relay control computer joint control computer control switch microprogram control circuit microprogram control circuit, microprogram control switchin control circuit steering circuit driving circuit control dial initiating fuse element contactor actuating variable influencing variable control signals for robots control signal generation control transmitter control voltage control memory control store control language robot command language, IR command language drive current pilot circuit control symbol control clock [pulse] control scanning button control section control transfer transfer of control robot control circumference control guidance stran 271 od 326 EN ‐DE: slovar avtomatizacije in robotike Steuerung open‐loop control Steuerung guide Steuerungfür Manipulationssysteme control for manipulation systems Steuerung auf Mikroprozessorbasis microprocessor‐based control hardware control Steuerung der Gerätetechnik Steuerung des Montagebandes assembly‐line control Steuerung durch Tonsprachen tone language control Steuerung einer Greiferhand hand control of gripper Steuerung eines Elektroantriebes mittels Drehverstärker rotary amplifier control of electric drives Steuerung eines Industrieroboters robot control, industrial robot control Steuerung für Datenkanal data channel attachment Steuerung für Manipulationssysteme control for manipulation systems Steuerung mit LSI‐Bausteinen control by LSI‐modules, control by large scale integration mod Steuerung nach Lage positioning one‐line control Steuerung über eine einzelne Leitung Steuerung über nicht geschlossene Schleife non‐closed loop control Steuerung von gespeicherten Daten data storage control Steuerungsalgorithmus control algorithm Steuerungsalgorithmus m operation algorithm Steuerungsanforderungen control requirements Steuerungsanforderungen control needs Steuerungsanpassungsbaustein control adapter Steuerungsantrieb controlling motion Steuerungsart eines Industrieroboters control kind of industrial robot Steuerungsaufgabe control task control equipment Steuerungsausrüstung Steuerungsausschalter control cut‐off switch Steuerungsbaustein control module Steuerungsbereich control field Steuerungsdaten pl control data control decentralization Steuerungsdezentralisierung Steuerungsempfindlichkeit command resolution Steuerungserfordernisse control requirements Steuerungserfordernisse control needs Steuerungsfolge control sequence master mode steuerungsführende Betriebsart master device steuerungsführendes Gerät master steuerungsführendes Gerät Steuerungsfunktion steering function Steuerungshardware control hardware steuerungsinterne Funktion control‐internal function Steuerungsmerkmal eines Manipulators control feature of manipulator Steuerungsmodell control model Steuerungsmoment controlling torque Steuerungsmoment driving torque robot control operation, control operation of IR Steuerungsoperation eines IR Steuerungsoptimierung control optimization steuerungsorientierter Befehlssatz control‐oriented instruction set Steuerungsprotokoll control protocol control protocol Steuerungsprozedurvorschrift Steuerungsregel control convention Steuerungsregister control register Steuerungsrelaisstromkreis control relay circuit Steuerungssender control transmitter Steuerungssoftware control software Steuerungssystem eines Roboters control system of robot Steuerungssystem mit offener Schleife open‐loop[ed] control system Steuerungssystemaufbau construction of the control system control engineering Steuerungstechnik Steuerungstechnik control technique control‐technical equipment steuerungstechnische Ausrüstung steuerungstechnische Kopplung eines Maschinensystems control‐technical coupling of machine system steuerungstechnische Möglichkeiten control‐technical possibilities control‐technical connection steuerungstechnische Verknüpfung steuerungstechnischer Greiferaufwand control‐technical gripper expense steuerungstechnisches Merkmal control‐technical feature (of manipulator generation) steuerungstechnisches Merkmal (einer Manipulatorgeneratio control‐technical feature (of manipulator generation) Steuerungstechnologien control technologies Steuerungstechnologien für Automaten control technologies for automatons Steuerungstechnologien für Roboter control technologies for robots Steuerungsunterbrecher control cut‐off switch control interruption Steuerungsunterbrechung Steuerungsunterscheidungsvermögen command resolution Steuerungsvektor control vector control action Steuerungsverhalten Steuerungsvorschrift control convention stran 272 od 326 EN ‐DE: slovar avtomatizacije in robotike Steuerungswirkung Steuerungszentrale Steuerverfahrensnetzwerk Steuerverhältnis Steuerwicklung Steuerwortfolge Steuerwortspezifizierung Steuerworttechnik Steuerzeichen Steuerzone Steuerzustand Steuung von Rauschstörungen Stichprobe Stichproben pro Sekunde Stichprobenanalyse Stichprobenprüfung Stichprobenraum Stiftmontage durch Industrieroboter Stillsetzen eines Speichers Stillsetzen eines Speichers Stimmgabelsteuerung Stimmgabelsteuerung stochastisch stochastisch gestörtes System stochastische Approximation stochastische Einwirkung stochastische Elemente stochastische Funktion stochastische Hypothese stochastische Simulation stochastische Steuerung stochastische Variable stochastische Verteilung stochastischer stochastischer Automat stochastischer Prozess stochastischer Regelungsprozess stochastischer Vektor stochastisches Lernmodell stochastisches Optimierungsverfahren stochastisches System Stoppbefehl Stoppschalter Stoppzeit Stoppzyklus Störabstand Störanfälligkeit Störanfälligkeit Störbegrenzer parasites Storben Störbereich Störbereich Störbereich Störbeseitigung Störbewegungsstabilität Störeffekte Störeinwirkung Störeinwirkung Störeinwirkung Störeinwirkung stören störende Kraft störende Veränderliche störende Veränderliche störende Veränderliche störende Veränderliche Störfeldstärkemessgerät parasite Störfrequenz Störfunktion Störgeräusch Störgröße Störgröße Störgröße Störgröße Störgröße Störgröße control action central control station control process network control ratio control winding sequence of control word control word specification control‐word technique control character control field control state noise dispersion random sample samples per second sampling analysis sampling test sample space robot pin assembly (mounting) memory inactivation inactivation of a memory fork control tuning fork control random stochastically disturbed system stochastic approximation random action stochastic elements random function stochastic hypothesis stochastic simulation stochastic control stochastic variable random distribution stochastic process stochastic automaton stochastic process stochastic control process random vector stochastic learning model stochastic optimizing method stochastic system breakpoint halt (instruction) breakpoint switch stopping time stop cycle noise margin fault liability susceptibility of failure interference limiter strobing disturbance band range of disturbance disturbance range debugging stability of perturbed motion parasitics disturbance variable disturbing variable disturbance upset disturbance quantity noise v disturbing force disturbance variable disturbing variable disturbance upset disturbance quantity interference field strength measuring instrument parasitic frequency forcing function background noise disturbance input disturbance quantity (variable) disturbance variable disturbing variable disturbance upset disturbance quantity stran 273 od 326 EN ‐DE: slovar avtomatizacije in robotike Störgrößenaufschaltung Störgrößenaufschaltung Störgrößenbeobachtung Störgrößeneinfluß Störgrößeneinfluss Störimpuls Störimpuls Störimpuls Störkraft Störmeldeprogramm eines IR Störmeldung Störpegel Störpegelabstand Störpegelabstand störsicher Störsicherheit Störsignal Störsignal Störsignal Störsignale eines Roboterantriebs Störspannung Störspannungsspanne Störsperre Störspitze Störstellenleifähigkeit Störstellenleitung Störübertragungsfunktion Störuchproblem Störung Störung Störung Störung Störung Störung Störung Störung durch Einheitssprung Störungsanalyse Störungsanzeige Störungsaufklärung Störungsausbreitung Störungsauswertung Störungsbeseitigungseinrichtung Störungsdauer perturbation Störungseffekt Störungserfassung Störungsfehlerfunktion Störungsfortpflanzung störungsfrei Störungsgebiet Störungsgrad Störungskoeffizient Störungskompensation Störungskompensierung Störungskompensierung Störungslokalisierung Störungslokalisierung Störungsmeldung Störungsmessgerät Störungsrelais Störungssuche Störungssuche Störungssucher Störungstheorie Störungsursache Störungszustand Störunterdrückung Störverhalten Störvorgang Störvorgang Störvorgang Störvorgang Stoßbeschleunigung Stoßeinschaltstrom Stoßkurzschlußstrom Stoßspannungsschutz Stoßstromhalteprüfung disturbance variable compensation feed forward control disturbance observation influence of disturbance variable influence of disturbance variable disturb[ing] pulse interference pulse noise pulse disturbing force disturbance message program of IR alarm function disturbance level noise level noise ratio fail‐safe noise immunity disturbance signal jamming signal spurious signal disturbing signals of robot drive noise voltage noise margin noise gate interference peak impurity conductivity extrinsic conduction disturbance transfer function trouble‐location problem disturbance perturbation interference effect fault breakdown interference Coulomb friction [force] dry friction step unit disturbance disturbance analysis trouble indication disturbance analysis disaster propagation disturbance analysis clearing device disturbance time interference effect disturbance registration disturbance error function disaster propagation free of disturbances interference area degree of disturbance perturbation coefficient disturbance variable compensation disturbance feedforward disturbance superposition trouble location trouble location fault indication interference measuring apparatus interference relay trouble shooting failure detection fault finder perturbation theory cause of disturbance failure condition disturbance rejection disturbance response disturbance variable disturbing variable disturbance upset disturbance quantity impact acceleration peak making current instantaneous short‐circuit current impulse‐voltage protection impulse current withstand test stran 274 od 326 EN ‐DE: slovar avtomatizacije in robotike Stoßüberschlagspannung Stoßwelle Stoßwellenrücken Strahlablenkung Strahlabtastmethode Strahleinstellung Strahlenausbreitungsanalyse Strahlendosimeter Strahlenformierung Strahlenintensität Strahlenkopplung Strahlenmesser Strahlenmesskopf Strahlenmesssonde Strahlenmonitor Strahlennachweis Strahlungsdetektor rayonnement Strahlungsdetektor rayonnement Strahlungsdiagramm Strahlungsdosimeter strahlungsfest Strahlungsflussdichte Strahlungsindikator Strahlungsindikator Strahlungsmessdetektor Strahlungsmesser Strahlungsnullpegel Strahlungspyrometer Strahlungsvakuummeter Streckenschutz mit direktem Vergleich Streckenschutz mit Funkverbindung radiocommunication Streckenschutz mit indirektem Vergleich Streckensteuerung Streifen streifengesteuert streifengesteuert streng monoton streuen Streufrequenz Streukopplung Streulicht eines optischen Sensors Streuung Strobierung Strobimpuls Strobimpuls Strobimpulsgenerator Strobimpulsgenerator Strobometrie Stroboskop stroboskopisches Verfahren Strom von Handhabeobjekten Stromanzeiger in Brückenschaltung Stromaufweitung Stromausbeute Stromausfall Stromausfallinterrupt Strombegrenzung Strombegrenzungsregelung Strombelastbarkeit Stromdichte Stromempfindlichkeit Stromfernmessgerät Strom‐Frequenz‐Umsetzung Strom‐Frequenz‐Wandlung Stromgegenkopplung stromgesteuertes Anlassen stromgesteuertes Bauelement Stromgewinn Stromimpulsverstärker Stromkreis Stromkreis Stromkreis mit direkter Wirkungsrichtung Stromkreis mit Phasenverzögerung Stromkreisanpassung Stromkreisäquivalent Stromkreisrauschmesser impulse flashover voltage impulse wave impulse wavetail beam deflection beam‐scanning method beam control propagating beam analysis radiation dosimeter beam forming beam intensity beam coupling actinometer dosimetry probe dosimetry probe radiation monitor detection of radiation radiation indicator radiation detector radiation pattern radiation dosimeter radiation‐resistant radiant flux density radiation indicator radiation detector radiation measuring detector actinometer zero radiation level radiation pyrometer vacuum radiometer gauge pilot protection with direct comparison radio‐link protection pilot protection with indirect comparison section control tape tape controlled tape operated strongly monotonic scatter v scattering frequency parasitic connection diffused light of optical sensor variance strobing gate pulse gating pulse strobe‐pulse generator strobe‐pulse oscillator strobometry stroboscope stroboscopic method stream of handling objects bridge detector current spreading current efficiency power fail[ure] power failure interrupt current limit current‐limit control current‐carrying capacity current density current sensitivity current telemeter current‐to‐frequency conversion current‐to‐frequency conversion negative current feedback current‐limit starting current‐driven device current gain current pulse amplifier current circuit electric circuit direct action circuit lag network adaptation of circuits circuit analog circuit noise meter stran 275 od 326 EN ‐DE: slovar avtomatizacije in robotike Stromkreisunterbrecher Stromkreiwähler Stromquelle Stromregelung Stromregler Stromregler Stromrelais eines Roboters Stromrichterschutz Stromrichtung Stromrückkopplung Stromschutz Strom‐Spannungs‐Charakteristik Strom‐Spannungs‐Kennlinie Stromspitze Stromstabilisator Stromstabilisator Stromstoß Stromstoß Stromstoß Stromübertragungsverhältnis Strömung von Flüssigkeiten Strömungsdichte Strömungsrichtung Strömungssensor Stromverstärker Stromverstärkungsfaktor Strudelpunkt Struktur Struktur der Ziffern Struktur des Rechnersystems Struktur des Rechnersystems Struktur eines digitalen Steuerrechners Struktur feiner Koordinatentransformation Struktur feines Montageroboters Strukturanalyse Strukturausgabe Strukturauswahl Strukturauswahl eines Greifers Strukturbezeichnung eines Robotergreifers Struktureingabe Strukturelement strukturell strukturell stabiles System strukturell unstabiles System strukturelle Automatentheorie strukturelle Eigenschaft strukturelle Instabilität strukturelle Kompatibilität strukturelle Synthese strukturelle Verträglichkeit strukturelle Zuverlässigkeit Strukturentwurf von Digitalrechnern Strukturformel Strukturgewicht eines Industrieroboters strukturierte Programmierung strukturierte Schaltung strukturkinetische Einheit Strukturmodell Strukturmodell Strukturmodellierung Strukturmodellierung Strukturoptimierung Strukturparameter Strukturparametermethode Struktursimulator Strukturstabilität Strukturveränderung structurale Strukturwandlung ststionärer Wert stückweise Approximation stückweise lineare Approximation stückweise lineare Kennlinie stückweise stetige Funktion stückweise stetige Funktion Stufe Stufe mit niedrigem Pegel circuit‐breaker circuit selector current source current control current regulator current stabilizer current relay of robot converter protection current direction current feedback current protection current‐voltage characteristic voltage‐to‐current characteristic current peak current regulator current stabilizer current impulse current pulse current surge current transfer ratio liquid flow flow density direction of flow flow sensor current amplifier current amplification factor focus structure structure of digits structure of computer system computer system structure digital control computer structure structure of coordinate transformation assembly robot structure, structure of assembly robot structure analysis structure output structure selection gripper structure selection gripper structure designation (of robot) structure input structure element structural structurally stable system structurally unstable system structural theory of automata structural property structural instability architectural compatibility structure synthesis architectural compatibility structural reliability digital computer structure designing structural formula robot structure weight structured programming structured circuit structural‐kinetic unit structural model structure model structure modelling structure simulation structure optimization structural parameter structure parameter method structure simulator structure stability change of structure structural change conservative value piecewise approximation broken‐line approximation piecewise linear characteristic locally continuous function piecewise continuous function stage low‐level stage stran 276 od 326 EN ‐DE: slovar avtomatizacije in robotike stufenartiges System Stufeneingangswirkung Stufeneinwirkung stufenlose Geschwindigkeitsregelung stufenloses Regelgetriebe Stufenregelung Stufenregelung Stufenschalter Stufenverstärker stufenweise Abstimmung stufenweise Korrelationsberechnung Stützfunktion Stützmenge einer unscharfen Menge Stützpunkt subharmonische Resonanz subharmonische Schwingung subharmonischer phasengekoppelter Oszillator Submodularphase Suboptimierung subpermanenter Magnetismus Substitutionsbefehl Substitutionsmodus Subtraktionsimpuls Suche Suchfilter Suchfunktion Suchgerät Suchkreis Suchkreis Suchoperation Suchoperation Suchposition feines IR Suchprozess Suchprüfung Suchprüfung Suchschaltung Suchschaltung Suchschrittmethode Suchspeicher Suchstrategie Suchstrategie (eines Industrieroboters) Suchtechnik Suchtheorie Suchverlust Suchvorgang Suchvorgang Suchzeit Summationselement Summationsglied Summationsglied Summationskette Summationskette Summationspunkt Summationsstelle Summationsstelle Summationsstelle Summierrelais Summierrelais Summierungsregelung computer‐aided design facilities Summierungsrelais SUM‐MIN‐Inferenz SUM‐PROD‐Inferenz superkleiner Rechner Superkleinstroboter Superminirechner Superposition Superpositionsprinzip Superpositionsprinzip Superpositionsprinzip superreine Oberfläche Supervision Supervision Supervision Supraleitfähigkeit Sylvester's Interpolationsformel Symbolik der Rechenmaschinen cascade system step input step input progressive speed control infinitely variable speed gearing step‐by‐step control stepping control tapping switch cascade amplifier step‐by‐step tuning stepwise correlation calculation supporting function support of membership function point of support subharmonic resonance subharmonic oscillation subharmonic phase‐locked oscillation submodular phase suboptimization subpermanent magnetism extract instruction substitute mode subtract pulse research detecting filter locate function search device search circuit finding circuit searching operating seek operation robot search position, search position of IR search process search check seek check search circuit finding circuit hill climbing search memory search strategy search strategy (of industrial robot) searching technique search theory search loss searching operating seek operation search time summation point summation element summing element adder circuit summation circuit summation point adder adding element summator averaging relay integrating relay compound control action adding relay sum‐min inference sum‐prod inference super‐minicomputer super‐mini‐robot super‐minicomputer superposition principle of superposition superimposing principle superposition principle micro‐cleaned surface monitoring verification supervision superconductivity Sylvester's interpolation formula computer symbology stran 277 od 326 EN ‐DE: slovar avtomatizacije in robotike symbolische Analyse symbolische Logik symbolische Operation symbolischer Befehl symbolisches Gerät symbolisches Gerät symbolisches Programmier[ungs]system Symbolkombination eines IR‐Programms Symbollogik Symbolsprache Symboltabelle symmetrische Ausgangsspannung symmetrische Belastung symmetrische Binomialverteilung symmetrische Funktion symmetrische Greifhilfe symmetrische Impulse symmetrische Klauenbewegung symmetrische Leitung symmetrische logische Funktion symmetrische Mischstufe symmetrische Nichtlinearität symmetrische Schaltung symmetrische Schaltung symmetrische Schwingungen symmetrischer Ausgang symmetrischer Binärkanal symmetrischer Eingang symmetrischer Gegentaktverstärker symmetrischer Kode symmetrischer Phasendiskriminator symmetrisches Gleichungssystem Symmetrisches Optimum symmetrisches Signal symmetrisch‐zyklisch magnetisierter Zustand Synchro Synchro Synchrodifferentialsender m Synchroempfänger Synchronadapter Synchronantrieb Synchronausgabe Synchronbetrieb Synchrondetektor synchrone Betriebsart synchrone Betriebsweise synchrone Bewegung (eines Greiforgans) synchrone Datenleitungssteuerung synchrone Datenübertragung synchrone Datenübertragung synchrone Logik synchrone Querimpedanz synchrone Roboterbewegung synchrone Übertragungsschnittstelle Synchroneingabe synchrones Folgesystem synchrones optisches Netzwerk synchrones Sequenzsystem Synchronisation Synchronisation zwischen Roboter und Peripherie Synchronisationsimpuls synchronisation Synchronisationsimpuls synchronisation Synchronisationsimpuls synchronisation Synchronisationspuffer Synchronisationssignal Synchronisationssignal Synchronisierkreis synchronisierte Gesamtoperation Synchronisierung Synchronisierung der Maschinenarbeit Synchronisierungsgruppe Synchronisierungssatz Synchronmanipulator Synchronmodus Synchronmotorantrieb Synchronphasenschieber symbolic analysis mathematical logic symbolic operation symbolic instruction symbolic unit symbolic device symbolic programming system symbolic combination of IR‐program symbolic logic symbolic language symbol table balanced output balanced load symmetrical binomial distribution symmetrical function symmetrical grip aid balanced pulses symmetrical movement of claw balanced line symmetric logic function balanced mixer symmetric non‐linearity balanced circuit symmetrical circuit symmetric oscillations balanced output binary symmatric channel balanced input balanced push‐pull amplifier symmetric code balanced phase discriminator symmetrical equation system symmetrical optimum balanced signal symmetrically cyclically magnetized condition selsyn synchro synchro‐control differential transmitter synchro‐torque receiver synchronous adapter synchronous motor drive synchronous output synchronous operation synchronous detector synchronous mode synchronous working synchronous motion (movement) (of grip organ) synchronous data link control synchronous data transmission synchronous data transfer synchronous logic quadrature‐axis synchronous impedance synchronous robot movement synchronous communication interface synchronous input synchronous serial system synchronous optical network synchronous serial system synchronization synchronization between robot and periphery dating pulse master pulse synchronization pulse synchronization buffer synchronization signal synchronization signal lock[ing] circuit synchronized total operation synchronization machine‐operation synchronizing synchronization unit synchronization unit Hand‐controlled manipulator, manual‐controlled manipulator synchronous mode synchronous motor drive phase‐shifting transformaer stran 278 od 326 EN ‐DE: slovar avtomatizacije in robotike Synchronspeicherungsverfahren synchronous storage method Synchrontakt synchronous clock Synchrontakt synchronous tact Synchrophasenverschieber synchro dephaser Synchrotrigonometer synchro‐trigonometer Synchrowinkelvergleicher coincidence synchro syntaktische Sprachanalyse syntactic language analysis syntaktischer Algorithmus syntactic algorithm Syntax einer Robotersprache robot language syntax Synthesator synthesizer Synthesator optimaler Systeme optimum system synthesizer Synthese der Parole synthesis of parole Synthese linearer einschleifiger Regelungssysteme synthesis of linear single‐loop control systems Synthese von Netzwerken network synthesis Synthese von Regelkreisen mit Prozessrechnern synthesis of control systems with process computers Synthese von Relaisanlagen switching devices synthesis Syntheseverfahren method for synthesis System system System auf Interruptbasis interrupt‐based system System automatischer Optimierung automatic optimization system System der Basisvektoren eines ndimensionalen Zustandsrau basis for n‐dimensional state space radio‐control system System der Funkfernsteuerung System der Objekterkennung object recognition system, system of object detection System der Objekterkennung object recognition system System der Objekterkennung system of object detection System entwerf er system designer System erster Ordnung first order system System kontaktloser Schaltung system of contactless switching System linear unabhängiger Lösungen fundamental system System logischer Gleichungen system of logical equations System mit angeschlossenem Prozessor attached processor system System mit automatischer Anforderung einer Wiederholung automatic request for repetition system System mit automatischer Wiederholungsanforderung request‐repeat system System mit Dämpfung system with damping System mit digitaler Steuerung digital control system System mit direkter Steuerung direct routing system System mit einem Freiheitsgrad system with one degree of freedom System mit einem ruhenden Detektor single‐stationary detector system system with a simple position feedback System mit einfacher Stellenrückführung System mit Flankenspiel system with play System mit geschlossener Schleife closed loop system closed‐loop system System mit geschlossener Schleife System mit konstanter Stellgeschwindigkeit constant‐velocity system System mit konzentrierten Parametern lumped parameter system System mit mehreren Freiheitsgraden system with several degrees of freedom System mit Mehrfachfreiheitsgraden multiple‐degree freedom system System mit selbsttätiger Stabilisierung automatic stabilization system System mit stetiger Wirkung continuous action system System mit Totzeit time‐lag system System mit unmittelbarer gesteuerter Wahl direct routing system System mit veränderlicher Dämpfung variable damping system System mit verteilten Parametern distributed parameter system System mit verteilter Vermittlung distributed switching system System mit Zeitquantisierung sampled‐data system system with additional pressure feedback System mit zusätzlicher Druckrückführung System niedriger Leistungsaufnahme low‐power system System variabler Feldlänge variable field length system system engineering System[entwurfs]technik system technology System[entwurfs]technik Systemabsturz abnormal system end Systemabsturz system crash Systemanalyse system analysis Systemanteil system part Systemarchitektur system architecture Systematik von Zangengreifeinheiten systematic of pincer grip units Systematik von Zangengreifern systematic of pincer grippers systematic data checking systematische Datenprüfung systematische Klassifizierung systematic classification systematische Lösung systematic solution systematic software technique systematische Softwaretechnik systematischer Fehler bias error systematischer Fehler systematic error Systemaufbau system architecture Systemausgabeschreiber system output writer Systemberechnung system calculaion Systembeschreibung system description stran 279 od 326 EN ‐DE: slovar avtomatizacije in robotike Systembibliothek Systemblockierung Systemblockierung Systemblockierungsbehandlung Systembus Systemdiagnose Systeme zusammenarbeitender Rechner Systemebene System‐Element‐Relationen Systementwerfer Systementwicklung Systementwurf Systemfalle Systemfrequenzgang Systemfunktion Systemgenerierung Systemgestaltung Systemgrenze Systemhierarchie Systemkompatibilität systemkompatibles Gerät Systemkomponente Systemkonfiguration Systemkonstruktion Systemkonzeption systemlogisches Gerät systemlogisches Gerät Systemlösung Systemmatrix Systemmittel Systemmodell Systemmodellierung Systemordnung System‐Output‐Writer Systemparameter Systemplanung Systemplanung Systemplanung Systemprogramm Systemprogrammierspräche Systemprogrammierung Systemprogrammpaket Systemprüfung Systemprüfung Systemresidenz Systemsicherheit Systemsoftware System‐Software Systemsoftwarekomfort systemspezifischer Speicherschaltkreis Systemstabilitätsanalyse Systemsteuerbaustein Systemsteuersprache Systemsteuerung Systemstruktur Systemtakt Systemtestung Systemtestung Systemtheorie Systemübertragungsfunktion Systemumgebung Systemumgebung Systemunterlagenforschung Systemunterlagenwartung Systemvariable Systemwiederanlauf Systemwirksamkeit Systemwirksamkeit Systemzusammenbruch Systemzusammenbruch Systemzustand Systemzuverlässigkeit Szene eines Industrieroboters Szenenanalyse/für einen Roboter T1‐Element T1‐Element system lybrary system deadlock system interlock deadlock handling system bus system diagnostic concurrently operating computer systems system level system‐element‐relations system designer system development system design system trap system frequency response system function system generation system configuration system boundary system hierarchy system compatibility system‐compatible device system component system configuration system design system conception system logical device system logical unit system approach system matrix system resource system model system simulation system order system output writer system parameter system engineering system planning system technology system program system programming language system programming system software system check[ing] system test[ing] system residence system security system software system software comfort of system software system memory chip system stability analysis system controller system control language system control system structure system clock system check[ing] system test[ing] system theory system transfer function system environment system surroundings software research software maintenance system variable system restart efficiency of the system system efficiency system crash abnormal system end system state system reliability robot scene, scene of industrial robot scene analysis of robot dead‐time element, transport‐lag element transport‐lag element, dead‐time element stran 280 od 326 EN ‐DE: slovar avtomatizacije in robotike Tachogenerator Tachogeneratorgenauigkeit Takt Takt Takt Takt[ier]ung Takt[ier]ung Taktausgang Taktbetrieb Takteingang Takterzeugung Taktgeberbetrieb Taktgeberfrequenz Taktgeberstufe Taktgenerator taktgesteuert taktgesteuert Taktierungsfehler Taktierungsfehler Taktierungskennwerte taktile Folgeprogrammierung taktile Programmierung taktile Sensormatrix taktile Sensorüberwachung taktiler Arm (Roboterarm) taktiler Robotersensor taktiler Sensor Taktimpuls Taktimpulsgenerator Taktimpulsübergang Taktimpulsverteiler Taktmontagestrecke Taktperiode Taktperiode Taktregelung Taktsignal Taktsignalerzeugung Taktzeit eines IR Taktzyklus Tangente Tangentenbedingung Tangentenmethode Taschenrechnern! Taskabnormalhalt Task‐Auswahlmechanismus Task‐Management Task‐Steuerblock tastaturgesteuert Tastatursteuerlogik Tastbetrieb Tastbetrieb tastenprogrammierbare Robotersteuerung Tasterrelais Tastgeber Tastgeschwindigkeit modulation Tastorgan Tastsensor Tastsensor eines Roboters Tastsinn Taststift Taststift Tastsystem Tastverhältnis Tastverhältnis tatsächlich tatsächliche Arbeitsstunden pl tatsächliche Leistung tatsächliche Prozesstemperatur tatsächlicher Förderstrom tatsächlicher Wirkungsgrad Tauchsonde Tauchsonde Tauchsonde Tauchthermostat Tauchverfahren mittels Roboters Tauchwanne Tacho generator accuracy of tacho‐generator beat[ing] pulsing pulsation timing clocking clock output synchronous operation clock input timing generation fixed cycle operation clock frequency clock stage clock[‐pulse] generator clock‐controlled clock‐actuated timing error clocking error timing characteristics tactile sequence programming tactic programming tactile sensor matrix tactile sensor survey tactile arm, tactile robot arm tactile robot sensor tactile sensor clock pulse clock[‐pulse] generator clock transition clock pulse distributor automated machine assembly line clock period tact period timing control clock signal cycle signal generation robot cyclic time, cyclic time of IR clock cycle tangent tangent condition tangents method pocket calculator task abnormal end task selection mechanism task management task control block keyboard‐controlled keyboard control logic inching [service] jogging service key‐programmable robot control key relay touch sensor, touching sensor modulation rate touching organ touch sensor, touching sensor touching sensor of robot touch sense, touching sense contact feeler contouring tracer sampled‐data system break‐make ratio duty ratio effective actual hours actual capacity actual process temperature actual displacement actual efficiency depth probe depth sound immersion probe immersion thermostat dipping process by robot dipping tank stran 281 od 326 EN ‐DE: slovar avtomatizacije in robotike TAYLOR‐Reihe Taylor‐Reihe Teach‐in‐Programmiersystem Teach‐in‐Programmierung (von Robotern) Teach‐in‐Steuerung Teach‐in‐Tableau Teach‐in‐Verfahren techn[olog]ische Bewertung Technik technische Anforderung technische Approximierung technische Daten pl technische Entwicklung technische Grenzen technische Kommunikationswissenschaften technische Kommunikationswissenschaften technische Lösung technische Lösung technische Restriktionen technische Stabilitätstheorie technische Zeichnung technische Zeichnung technischer Entwurf technischer Produktenentwurf technischer Roboterparameter technischer Sensor technischer Universalroboter technisches Regelsystem technisch‐ökonomisches Modell der Montagetechnik Technologie Technologiebeschreibung Technologiebeschreibungsdatei Technologienahtstelle technologische Ausrüstung technologische Eigenschaft technologische Einheit technologische Hilfsausrüstung technologische Kriterien technologische Mehrkoordinaten‐Ausrüstung technologische Mehrkoordinaten‐Ausrüstung technologische Operation technologische Roboteroperation technologische Struktur technologischer Befehl technologischer Industrieroboter technologischer Manipulator technologischer Mehrkoordinaten‐Manipulator technologischer Roboter technologischer Variantenvergleich technologisches Fließbild Teilautomat teilautomatischer Bearbeitungsvorgang Teilautomatisierung Teileablage Teilebearbeitung Teileeingabe Teileentnahme Teilefertigung Teilelager Teilelokalisierung Teilepassungsanalyse Teilepassungsanalyse Teilereinigungsroboter Teiletransportweg Teilezuführung Teilezuführung Teilezuführung Teilfunktion eines Roboters Teilgerät Teilinformation Teilkonvergenz Teillastbetrieb Teilleseimpuls Teilmontage eines Industrieroboters Teilmontage feines Industrieroboters Teiloperation Taylor series Taylor's series teach‐in programming system teach‐in programming (of robots) teach‐in control teach‐in‐tableau teach‐in process technical evaluation cryogenics technical requisition engineering approximation engineering data engineering development engineering constraints communication engineering engineering cybernetics engineering solution status‐saving hardware engineering constraints theory of technical stability technical drawing mechanical drawing engineering design engineering product design technical robot parameter technical sensor technical universal robot technical control system technology‐economic model of assembly technique technology technology description technology description file technology weld place technological equipment technological property technological unit technological auxiliary equipment technological criteria technological multi ‐coordinate equipment technological multicoordinate equipment technological operation technological robot operation technological structure technological command technologically used industrial robot technological manipulator, technological handler technological multi‐coordinate manipulator technological robot technological comparison of variants engineering flow sheet partial automaton partially automated machining process partial automatization parts deposit (input) parts machining parts deposit (input) parts taking component fabrication parts stock parts localization, pieces localization piece fit analysis piece adjusting analysis parts cleaning robot parts transport route alimentation of parts, feeding of parts alimentation of parts feeding of parts partial function of robot dividing device partial information incomplete convergence partial‐capacity operation partial‐read pulse robot submounting robot submounting partial operation stran 282 od 326 EN ‐DE: slovar avtomatizacije in robotike teilparallele Verarbeitungseinheit Teilprozess Teilprozess Teilregelung Teilschaltung Teilschreibeimpuls Teilstrom Teilstruktur Teilsystem einer Robotersoftware Teilsystem einer Robotersteuerung Teilsystem eines Industrieroboters Teilsystem eines Roboters Teilsystemsynchronisation Teilsystemsynchronisation partikulärer Punkt teilweise bestimmte Funktion teilweise selektive Ausgabe Teilwert Teilzustandsrückführung Telebeschickung (der gespeicherten Bibliothek) Telemanipulator Telemanipulator Telemechanik telemechanisches Schütz Telemetrie Telemetrie Teleoperateur telestatische Fernübertragungsausrüstung telestatische Steuerung Tellerspeicher Temperatur der Anströmung Temperaturabhängigkeit Temperaturanomalie Temperaturbedingungen Temperaturbereich Temperaturdetektor Temperaturfehler Temperaturfehler Temperaturfühleinrichtung Temperaturgeber Temperaturgefälle Temperaturgleichgewicht Temperaturgradient Temperaturkoeffizient Temperaturkompensationsgrenzen temperaturkompensiert Temperaturkontrast Temperaturkontrolle der Induktionserwärmung temperaturorientierter Sensor Temperaturprofil Temperaturregeleinrichtung Temperaturregler Temperaturschwankung Temperaturstabilisierung Temperaturunterschied Temperaturwandler Temperaturwandler Temperaturzustand tensometrischer Apparat Tensorarm eines Greifers Termanalyse Terminal Terminal für Stapelverarbeitung Terminal‐Job Terminalmehrwegschalter Terminalmultiplexer terminalorientiertes System Terminalprozessor Termstruktur Test bei reduzierter Betriebsspannung Test der Prozessausgabe Test der Prozesseingabe Test des Informationstauschs Test‐ und Kontrollpult Testbefehl Testbit Testbit semi‐partial processing unit sub process subprocess selective adjustment subcircuit partial‐write pulse branch current substructure partial system of robot software partial system of robot control partial system of robot, partial system of industrial robot, robo partial system of robot, partial system of industrial robot, robo partial system synchronization partial system synchronization particular point partially determined function partial‐select output particular value output feedback Tele‐charging (of stored library) telemanipulator Tele‐manipulator telemechanics telemechanic contactor telemetering telemetry Tele‐operator telestatic long range transmission equipment telestatic equipment plate memory (store) static temperature temperature dependence temperature anomaly temperature conditions temperature range temperature detector temperature correction factor temperature error temperature detecting device temperature transmitter temperature gradient temperature equilibrium temperature gradient temperature coefficient temperature compensation limits temperature‐compensated temperature contrast temperature control of induction heating temperature‐oriented sensor temperature profile temperature control equipment temperature controller temperature fluctuation temperature stabilization temperature contrast heat converter temperature detector temperature conditions tensometric apparatus tensor arm of gripper energy‐level analysis terminal batch terminal terminal job terminal multiplexer terminal multiplexer terminal‐oriented system terminal processor level structure marginal voltage check test of process output test of process input test of information exchange test and control console test instruction check bit test bit stran 283 od 326 EN ‐DE: slovar avtomatizacije in robotike Testdaten pl Testeingangssignal Testeinrichtung für mitlaufende Prüfung Testhilfen Testhilfshardware Testhilfsmittel Testhilfsmonitor Testhilfsprogramm Testkammer Testmonitor Testmuster Testmustererzeugung Testoperation Testpunkt Testsignal Teststand Teststand Teststand Teststand Teststand m Teststand m Testsystem Testsystem Testsystem für integrierte Schaltkreise Testung mittels Hardware‐Redundanz Testverfahren Testverfahren Testverfahren Testwerkzeuge Testzeitraum Textangabe Textausgabefunktion Texteingabefunktion Textformulierung (einer Roboteranweisung) Textilroboter Textspeicher textuelle Formulierung textuelle Programmierung textuelles Formulieren textuelles Programmiersystem Textverwaltungssystem Theorem von Shannon theoretisches Modell Theorie der Abbildungen Theorie der automatischen Steuerung Theorie der Datenverarbeitung Theorie der Digitalregelkreise Theorie der Impulskreise Theorie der Kodierung Theorie der numerischen Behandlung Theorie der Relaiseinrichtungen Theorie der Relaiseinrichtungen Theorie der Relaisschaltungen Theorie der selbsttätigen Regelung Theorie der Spiele Theorie der Spiele Theorie der zeitabhängigen Leistungskopplung Theorie des Übergangszustandes Theorie dynamischer Systeme thermische Kompensation thermische Leitfähigkeit thermische Leitfähigkeit thermische Oberflächenbehandlung thermische Relais mit Temperaturkompensation thermische Rückführung thermische Sicherung thermische Überlastbarkeit thermische Zeitkonstante des Thermoumformers thermischer Dissoziationsgrad thermischer Leitwert thermischer Prozess thermischer Wirkungsgrad thermisches Rauschen thermisches Rechenelement thermochemischer Gasanalysator Thermodrucker test data test input signal online test facility test aids testing service hardware test[ing] tools testing service monitor testing service program test chamber test monitor test pattern test pattern generation test operation test point test signal instrument table test stand test board test table pilot plant experimental unit test system test system, TS integrated circuit test system hardware redundancy testing checking procedure test procedure testing technique test[ing] tools test period text specification text output function text input function textual formulation textile robot alphanumeric store textual formulation textual programming textual formulation textual programming system text management system, TMS sampling theorem theoretical model theory of mapping theory of automatic control data processing theory digital control circuits theory pulse circuits theory coding theory theory of numerical treatment switching theory theory of relay systems relay circuit theory theory of automatic control theory of game game theory time‐dependent coupled power theory transition state theory theory of dynamics thermal compensation thermal admittance thermal conductivity thermal surface treatment compensated thermal overload relay thermal feedback thermal cut‐out thermal overload capacity thermal time constant of the thermal converter degree of thermal dissociation thermal admittance thermal process heat effect thermal noise thermal computing element thermochemical gas analyzer thermal printer stran 284 od 326 EN ‐DE: slovar avtomatizacije in robotike Thermodrucker Thermodrucker Thermodynamik thermodynamische Analyse thermodynamische Beziehung thermodynamische Eigenschaften thermodynamische Funktionen thermodynamische Koordinate thermodynamische Wahrscheinlichkeit thermodynamischer Prozess thermodynamisches Gleichgewicht thermodynamisches Potential thermoelektrischer Komparator Thermoelement Thermoelemente für hohe Temperaturen thermografisches Bild Thermokontakt Thermokreuzstrommesser thermomagnetische Analyse Thermometer mit verstellbarem Kontakt Thermopaarstrommesser Thermoregler Thermoregler Thermoregler thermostatisch thermostatische Regelung thermostatische Sonde thermostatischer Flüssigkeitsregler thermostatischer Gasanalysator thermostatischer Regler thermostatischer Schließer thermostatischer Sensor thyristorgesteuerter Roboterantrieb thyristorgesteuerter Robotermotor Tiefendruckregistriergerät Tiefpass Tiefpassfilter Tiefpassfilter in Regelkreisen asservis Tieftemperaturanlage Tieftemperaturbehandlung Tieftemperaturbereich Tieftemperaturbetrieb Tieftemperaturelemente Tieftemperaturtechnik Tilgungswiderstand Timeout Timeout‐Betrieb Time‐Sharing Time‐Sharing Time‐Sharing‐Terminal Tippbetrieb Tippbetrieb Tippbetriebsteuerung Tisch eines Industrieroboters t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm t‐Konorm tmax‐Zeit t‐Norm t‐Norm t‐Norm t‐Norm t‐Norm t‐Norm t‐Norm t‐Norm t‐Norm Toleranz electrothermic printer thermoprinter thermodynamics thermodynamic analysis thermodynamic relationship thermodynamic properties thermodynamic functions thermodynamic coordinate thermodynamic probability thermodynamic process thermodynamic equilibrium thermodynamic potential thermoelectric comparator thermocouple high‐temperature thermocouples thermo graphical image thermocontact thermocouple ammeter thermomagnetic analysis adjustable electric contact thermometer thermocouple ammeter heat controller heating controller thermoregulator thermostatic thermostatic control thermostatic probe thermostatic liquid level control thermostatic gas analyzer thermostatic controller thermostatic closing contact thermostatic sensor thyristor‐controlled robot drive thyristor‐controlled robot motor depth pressure recorder low‐pass filter low‐pass filter low‐pass filters in control‐loops low‐temperature plant low‐temperature processing low‐temperature field low‐temperature operation cryogenic elements cryogenics quenching resistance timeout timeout mode timesharing time division timesharing terminal inching [service] jogging service inching control robot table, industrial robot table s‐norm s‐norm, t‐conorm, triangular conorm algebraic sum bounded sum drastic sum Einstein sum Hamacher sum Hamacher union operator maximum function t‐conorm triangular conorm peak time t‐norm algebraic product bounded difference drastic product Einstein product Hamacher intersection operator Hamacher product minimum function triangular norm tolerance stran 285 od 326 EN ‐DE: slovar avtomatizacije in robotike Toleranz einer unscharfen Menge Toleranzabweichung Toleranzabweichungsausgleich Toleranzfaktor Toleranzsystem Tonfrequenzmultiplexsystem Tonfrequenzoszillator Tonfrequenzverstärker Tongenerator tonnenförmiger Arbeitsraum tonnenförmiger Arbeitsraum eines IR tonnenförmiger Roboterarbeitsraum Tonsignal Tonsignal Toröffnungsstufe Torschaltung Torschaltung Torschaltung Torschaltung Torschaltung Torschaltungslogik Torsionsschwingungsdämpfer Torsteuerung totale Programmierung Totalgewinn des Hohlraumes toter Gang toter Gang totes Band totes Band Totgang Totspeicher Totspeicher Totzeit Totzeit Totzeit Totzeitelement Totzeitelement Totzeitkorrektur Totzeitmodellierung Totzeitsystem Totzone (Lose Totzone bei Dreipunktregler Totzone bei einer Lose Tourenzähler tragbarer Mikrorechner tragbares Datenerfassungsterminal tragbares Terminal Trageinsatz Tragekapazitätsdaten Träger (eines Schweißroboters) Träger einer unscharfen Menge Träger[strom]signal Trägeramplitude trägerfrequente Übertragung Trägerfrequenz Trägerfrequenzfernmessung Trägerfrequenzkomponente Trägerfrequenzrelais Trägerfrequenzsignalübertragung Trägerfrequenzspeiseanlage porteurs Trägerfrequenzstreckenschutz Trägerfrequenzverstärker Trägerkanal Träger‐Rausch‐Abstand Träger‐Rausch‐Verhältnis Trägerstrom Trägerstromfernmessgerät Trägerwelle Trägerwellenverstärkung Tragfähigkeit Tragfähigkeit eines Industrieroboters Trägheit Trägheitsachse trägheitsarmer Roboterantrieb Trägheitskonstante core of membership function tolerance deviation tolerance deviation compensation tolerance factor tolerance system audio‐frequency multiplex system audio‐frequency generator audio‐frequency amplifier audio‐frequency generator barrel‐shaped working room barrel‐shaped working room of industrial robot barrel‐shaped working room of industrial robot audio signal sound signal gating stage gating stage coincidence circuit coincidence gate gate [circuit] gating circuit gate circuit logic torsional vibration damper port controller total programming overall cavity gain dead stroke backlash dead band dead zone backlash fixed memory permanent memory dead time transport lag idle time dead‐time element, transport‐lag element transport‐lag element, dead‐time element dead time correction modeling of the transfer lag time‐lag system dead zone (relay, on‐off‐controller, amplifier), dead band (backlash nonlinearity dead zone (relay, on‐off‐controller, amplifier) dead band (backlash nonlinearity) revolution counter portable microcomputer portable data collection terminal portable terminal portable use supporting capacity data support (of welding robot) support of membership function carrier current signal carrier amplitude carrier frequency transmission carrier frequency carrier telemetring carrier wave component carrier‐actuated relay carrier‐frequency signal transmission carrier wave supply equipment carrier‐current protection carrier‐frequency amplifier carrying channel carrier‐to‐noise ratio carrier‐to‐noise ratio carrier current carrier‐current telemetering equipment carrier wave carrier wave amplification load‐carrying capacity robot load‐carrying capacity, industrial robot load‐carrying ca inertia axis of inertia robot drive with little inertia inertia constant stran 286 od 326 EN ‐DE: slovar avtomatizacije in robotike Trägheitskraft force of inertia Trägheitskraft mass force Trägheitskraftgröße size of inertia force Trägheitskraftmoment moment of force inertia Trägheitslenkung inertial guidance Trägheitsmoment moment of inertia Tragkapazität supporting capacity Tragkraft carrying capacity carrying air Tragluft Trajektoriensollwert trajectory nominal value Trajektorieplanung trajectory planning Tran Sportpalette pallet Transceiver‐Kode transceiver code Transduktor converter Transduktor transducer Transduktor transductor Transduktortemperaturregler magnetic amplifier temperature controller transfer time Transferzeit Transformation conversion Transformation converting Transformation transformation Transformation transforming Transformationsmatrix transform matrix Transformationsmatrix transformation matrix transformation section Transformationsstück Transformator transformer Transformator mit Ferritkern ferrite core transformer transformieren transform v transformierte Gelenkreaktion transformated joint reaction Transistor transistor Transistorelektroantrieb transistor electric drive transistorgesteuert controlled by transistor transistorisierte Schaltbaukasteneinheiten transistorized building‐block switching units transistorisierter Integralverstärker integral transistorized amplifier transistor‐transistor logic Transistor‐Transistor‐Logik TTL Transistor‐Transistor‐Logik Transition transition Transitionsmatrix transition matrix Transitivität transitivity Translation translation Translationsachse translations axis Translationsachse eines Industrieroboters translation axis of [industrial] robot Translationseinheit translation unit Translationseinheit eines Greifers translation unit of gripper translatorische Greiferbewegung translatory gripper movement translatorische Robotergrundbewegung (IR‐Grundbewegung)translatory base movement of robot translatorischer Greifer translatory gripper Transmissionsgrad transmittance Transmitter transmitter Transparenz transparency Transponierte einer Matrix transpose of a matrix transportables Programmiergerät portable programming machine Transportalgorithmus transportation algorithm Transportautomatisierung transport automation Transportband conveying belt (for movement of party) Transportband (zur Bewegung der Teile) conveying belt (for movement of party) Transportbandbewegung movement of conveying belt Transportgreifeinrichtung transport grabbing equipment, transport grab device Transportoperation operation of transport Transportoptimierung transport optimization Transportprüfung feed check Transportroboter transport robot transport technique Transporttechnik Transporttechnologie transport technology Transportvorrichtung transport equipment, transport installation transcendental equation transzendente Gleichung trapezoidal membership function trapezförmige Zugehörigkeitsfunktion trapezoidal approximation of integral Trapeznäherung treiben drive v Treiberstrom drive current Treiberstufe driver stage Treiberstufe driving stage Treiberstufe driver trennen cut off v Trennen (durch Roboter) disconnecting (by robot) Trennfrequenz cut‐off frequency stran 287 od 326 EN ‐DE: slovar avtomatizacije in robotike Trennfrequenz Trennschalter Trennschalter Trennschärfe gegen Nachbarkanal Trennstufe Trennstufe Trennung Trennung Trennungsvermögen Trennungsvorgang Trennverstärker Trennzeit trianguläre Konorm trianguläre Konorm trianguläre Norm trianguläre Norm Triebfeder Trigger der Übertragung trigonometrische Roboterfunktion trigonometrischer Ausdruck Trimmnachfolgesteuerung Tri‐State‐Bauelement Tri‐State‐Bauelement triviales Problem trockene Reibung trockene Reibung Trockensystem Trocknungsprozess Trocknungssystem Trommelbunker Trommelfahrschalter m Trommelkontroller Trommelschreiber Trommelspeicher Trübungsmesser Tschebyscheffsche Approximation Tschebyscheffsche Ungleichung TTL TTL Tubenarm Tüpfelanalyse Tüpfelanalyse turbolenter Energietransport Tustin Formel Typ eines Fasersensors Typemodell typische Vorwärtsverarbeitung über die Zeit gemittelt Überabtastung Uberanpassung Überanpassung überbeanspruchter Verstärker überbestimmt überbrücken überbrücken überbrückt Überbrückungskontakte Überdämpfung Überdeckungsimpulse Überdeckungsoperationen Überdeckungsregelung Überdeckungswirkung Überdruck Überdrucklüftung Überdruckspritzgefäss übereiegender Wert übereinstimmender Wert Übereinstimmung Übereinstimmung Übereinstimmung Übereinstimmungsgesetz Überfrequenzschutz Übergabepunkt Übergabepunkt eines Manipulators Übergabetechnik Übergang critical frequency cut‐off cut‐off switch adjacent‐channel attenuation buffer cascade buffer stage separation separating discrimination separation process buffer amplifier cut‐off time t‐conorm triangular conorm t‐norm triangular norm driving spring carry flip‐flop trigonometrical robot function trigonometrical expression automatic shim rod follow‐up [control] three‐state device tristate device trivial problem Coulomb friction [force] dry friction dry system dehydration process dry system drum bunker drum controller drum controller drum recorder drum store nephelometer Chebyshev approximation Chebyshev inequality transistor‐transistor logic TTL tube arm spot analysis drop analysis turbulent energy transport Tustin's method type of fiber sensor type model typical forward processing time‐averaged oversampling overfitting overrating overdriven amplifier inconsistent bypass v shunt v shorted out bridging contacts overdamping overlapping pulses overlapping operations overlap action overlap action superpressure pressure ventilation high‐pressure tank prevailing value conformable value accordance concordance coincidence correspondence rule overfrequency protection transfer point manipulator transfer point transfer technique transition stran 288 od 326 EN ‐DE: slovar avtomatizacije in robotike Übergang vom unteren zum oberen Signalpegel Übergangsbedingung Übergangsbegrenzung Übergangscharakteristik Übergangscharakteristik Übergangselement Übergangserscheinung Übergangserscheinung Übergangsfrequenz Übergangsfunktion Übergangsgegenspannung Übergangsgegenstrom Übergangsgraf Übergangsprozess Übergangsprozessdauer Übergangsprozesskurve Übergangsprozesskurve Übergangsrückstrom Übergangssignal Übergangsspeicher Übergangsspeicher Übergangsspeicher Übergangsstrom Übergangsverhalten Übergangsverhalten Übergangsvorgang Übergangswahrscheinlichkeit Übergangszustand Übergangszustand übergehen übergehen übergeordneter Rechner Übergeschwindigkeitsbegrenzer Übergruppenkontrolle Überhitzeranlage Überhitzungsgrad Überhitzungsprozess Überhitzungsschutz Überholungsschleife Überholungsstromkreis überkritische Temperatur überkritischer Druck überlagernde Kodierungsmethode überlagernde Verschlüsselungsmethode überlagerte Regelung überlagerte Regelung überlagerte Störung überlagerter Schutz überlagerter Schutz Überlagerung Überlagerung von aktivierten Regeln Überlagerungsbereich Überlagerungsfrequenz Überlagerungsprinzip Überlagerungsprinzip Überlagerungsprinzip Überlagerungssteilheit Überlagerungsstruktur Überlappen überlappender Zugriff überlappter Zugriff Überlappungsoperationen Überlast[ung] Überlastbarkeit überlasteter Verstärker Überlastschutz Überlastsicherheit Überlastsicherung Überlastsignal Überlastung des Roboters Überlastungsdetektor Überlastungsmelder Überlastungsregler Überlastungsschutz Überlauf Überlaufanzeige low[‐to]‐high transition transient condition performance limitation transient performance transient response transition element transient performance transient response cross‐over frequency unit‐step response reverse conduction voltage reverse conduction current transition graph transient [phenomenon] transient time transient characteristic transient curve reverse conduction current transient signal buffer memory buffer storage buffer store transient current transient behavior transient behavior, transient response transient [phenomenon] transition probability transition regime transient state bypass v shunt v contention computer overspeed limiter major control superheating plant overheating degree process of superheating overheat control leading circuit leading circuit supercritical temperature supercritical pressure superimposed coding method superimposed coding method cascade control concatenated control superimposed interference back‐up protection reserve protection overlay aggregation overlay area conversion frequency principle of superposition superimposing principle superposition principle conversion transconductance overlay structure overlap overlapped access overlapped access overlapping operations overload[ing] overload capacity overdriven amplifier overload protection overload safety overload fuse overload signal robot overloading overload detector overload detector overload controller overload protection overflow overflow alarm stran 289 od 326 EN ‐DE: slovar avtomatizacije in robotike Überlaufkontrollsignal Überlaufregister Überlaufzahl Über‐MAX‐Operator (alle t‐Konormen außer MAX) Übernahmekontrolle übernommen übernommen Überprüfung auf verbotene Kombinationen Überregelungsfaktor Überschlagspannung bei Kraftstromfrequenz Überschreibungseinrichtung Überschwellen‐Laserzustand Überschwingfaktor Überschwingweite Überschwingweite Überschwingweite Überschwingweite Überschwingzeit Übersetzen des Anwenderprogramms Übersetzer Übersetzer in maschinenorientierte Programme Übersetzer in maschinenorientierte Programme übersetztes Maschinenprogramm übersetztes Objektprogramm übersetztes Programm übersetztes Programm übersetztes Roboterprogramm Übersetzungsprotokoll Übersetzungsverhältnis Übersichtsschema Übersichtsschema Überspannung Überspannungsabschalten Überspannungsgerät Überspannungsgerät Überspannungsschutz Übersprechstörungen Übersteuerung Übersteuerungsanzeige surcharge Überstromauslöser mit unabhängiger Zeitverzögerung Überstromschutz courant Übersynchronisierung Übertrag Übertrag Übertrag Übertragen übertragen Übertragen Übertragen Übertrager Übertragsregister Übertragsselbsthalteschaltung Übertragsspeicherung Übertragsstelle Übertragsziffer Übertragung Übertragung der Drehbewegung Übertragung der Steuerung Übertragung der Steuerung Übertragung großer Datenmengen Übertragung zu mehreren Stationen Übertragungsblock Übertragungsblock Übertragungsblock Übertragungscharakteristik Übertragungscharakteristik des Rückführungssystems Übertragungsdämpfung Übertragungseigenschaften Übertragungselement Übertragungsfehler Übertragungsfehler Übertragungsfunktion Übertragungsfunktion Übertragungsfunktion Übertragungsfunktion Übertragungsfunktion des geschlossenen Regelkreises overrun control signal overflow register capacity exceeding number over max operator acceptance control accepted accepted, ACC forbidden‐combination check overshoot ratio power‐frequency flashover voltage rewriting device after‐threshold laser behaviour amplitude factor maximum overshoot maximum overshoot, overshoot overshoot transient overshoot overshoot period translation of user program combiner compiled program compiler compiled machine program compiled object program compiled program object program compiled robot program translation record ratio of transmission layout plan general plan overvoltage overvoltage tripping overvoltage device voltage limiter overvoltage protection cross noise overload[ing] overload warning system definite time‐lag over‐current release overcurrent protection oversynchronization carry carry over transfer carry transfer v carry over transfer transmitter carry register carry latch carry storage carry digit carry digit transfer circulation transmission control transfer transfer of control bulk transmission of data multiloop transmission block block, functional block functional block transfer characteristic feedback‐system transient response transmission loss transmission properties transfer element transfer error transmission error carry‐over function inverse transfer function transfer function actuating transfer function closed‐loop transfer function stran 290 od 326 EN ‐DE: slovar avtomatizacije in robotike Übertragungsfunktion des offenen Regelkreises Übertragungsfunktion des offenen Systems Übertragungsfunktion Regelkreises Übertragungsgerät Übertragungsgeschwindigkeit Übertragungsgeschwindigkeit Übertragungsglied Übertragungskanal Übertragungskanal Übertragungskennlinie Übertragungskontrolle Übertragungskontrolle Übertragungsleitung Übertragungsleitung Übertragungsmatrix Übertragungsmatrix Übertragungsmedium Übertragungsoperation Übertragungsprozedur Übertragungsrate Übertragungsrate Übertragungsrichtung transmission Übertragungsrichtung transmission Übertragungsschnittstelle Übertragungssteuerprogramm Übertragungssteuerprogramm communication Übertragungssteuerzeichen Übertragungsstrom Übertragungssystem Übertragungssystem mit Wiederholung Übertragungstechnik binärer Daten Übertragungstechnik‐Anwendung Übertragungsverfahren Übertragungsverhältnis n Übertragungsverhältnis n Übertragungsverhältnis n Übertragungsverzögerung Übertragungsweg Übertragungszeit überwachen überwachen Überwachung Überwachung Überwachung Überwachung Überwachung der Montagekräfte Überwachung der Montagemomente Überwachung eines Betriebszustands Überwachung mit taktilem Sensor Überwachung von Handhabungssequenzen Überwachung von Handhabungssequenzen Überwachung von Robotern Überwachungsautomatisierung Überwachungsautomatisierung Überwachungseinrichtung Überwachungseinrichtung Überwachungsfunktion Überwachungsgerät Überwachungskontrolle Überwachungspaket überwachungspflichtige Anlage Überwachungsprogramm Überwachungsraum Überwachungssensor Überwachungssteuerung Überwachungssystem Überwachungssystem für IR Überwachungssystem für lR Überweisungsbefehl u‐Drehbewegung UHF‐Filter Uhrrelais Ultrarotflüssigkeitsanalysator Ultraschall Ultraschallabsorptionsmessung Ultraschallabtastgerät open‐loop transfer function open‐loop transfer function feedback transfer function transfer device transfer rate transfer speed transfer circuit transmission channel transfer channel transfer characteristic dump check transfer check transfer line transmission line transfer matrix transfer‐function matrix communication medium transfer operation communication procedure transfer rate transfer speed direction of transfer transmission direction transmission interface communication control program, CCP communication control program communication control character, CCC convection current communication system request repeat system binary data transmission technique communication application communication procedure gear ratio transfer ratio transfer number transfer lag transfer path transfer time monitor v verify v monitoring verification supervision operational condition monitoring survey of assembly forces survey of assembly moments operational condition monitoring tactile sensor survey monitoring of sequential handling monitoring of sequential handlings surveillance of robots monitoring automation monitoring automation verifying device monitor monitoring function survey instrument supervisory control trace packet plan subject control monitor checking routine control room supervision sensor supervision control monitor system robot supervision system robot supervision system move instruction u‐rotary motion ultrahigh‐frequency filter clock relay liquid infrared analyzer ultrasonics ultrasonic absorption measurement ultrasonic scanner stran 291 od 326 EN ‐DE: slovar avtomatizacije in robotike Ultraschallaufzeitglied n Ultraschallaufzeitglied n Ultraschalldetektor Ultraschallhochfrequenzmaschine Ultraschallimpulsgenerator Ultraschallmaterialprüfgerät Ultraschallpegel Ultraschallsensor Ultraschallsensor Ultraschalltechnologie Ultraschallverzögerungsleitung Ultraschallverzögerungsleitung Ultrastabilität Umdrehoperation bei Montage Umdrehungsroboterarm Umdrehungszähler Umfangsregelung Umfangsregelung Umformer Umformerempfindlichkeit Umformung Umformung Umformung Umformung Umgebung Umgebung Umgebungsanforderungen Umgebungsbedingung Umgebungsbedingungen Umgebungssimulation Umgebungsstörungen Umgebungstemperatur Umgebungstemperaturinformationen umgeformte Größe umgeformtes Ausgangssignal umgeformtes Eingangssignal umgehen umgehen Umgehungsschaltung Umgehungssystem umgekehrte Amplituden‐Phasen‐Charakteristik umgekehrte Betriebsweise umgekehrte Folge umgeschaltetes Fehlersignal umgewandelte Ausgangsgröße umgewandelte Eingangsgröße umkehrbar umkehrbarer Vorgang umkehren Umkehrfunktion Umkehrgröße einer Variablen Umkehrintegrator Umkehrpunkt Umkehrspannungserhöher Umkehrsteuerelement Umkehrsteuerung Umkehrstufe Umkodierer Umkodierer Umkodierer Umladeoperation Umlagern von Werkstücken Umlagern von Werkstücken Umlaufgeschwindigkeit Umlaufintegral Umlaufpotentiometer Umlaufpufferspeicher Umlaufpumpe Umlaufregistern Umlaufrichtung Umlaufschalter Umlaufspeicher Umlaufspeicher Umlaufsystem Umlenkoperation feines Roboters Umprogrammieren eines Industrieroboters supersonic delay line ultrasonic delay line supersonic detector high‐frequency alternator for ultrasonic transducer ultrasonic pulse generator ultrasonic material testing apparatus ultrasonic level ultrasonic sensor ultrasonic sensor ultrasonic technology supersonic delay line ultrasonic delay line ultrastability assembly revolution operation revolute robot arm circulation counter band adjustment range adjustment transformer converter sensibility conversion converting transformation transforming environment environs environmental requirements environmental condition ambient conditions environment simulation ambient disturbances ambient temperature ambient temperature information converted variable converted output signal converted input signal bypass v shunt v bypass circuit bypass system inverse phase‐amplitude characteristic inverted mode inverse sequence commutated error signal converted output quantity converted input quantity reversible reversible process invert v inverse function reciprocal variable inverse integrator point of reversal reversible booster reverse‐acting control element reversal control inverter stage code converter code translator transcoder operation of transshipment rearranging of work pieces rearranging of workpieces rotation[al] speed circulation integral circulation potentiometer circular buffer memory circulation pump circulating register circulation direction rotary switch circulating memory circulating storage circulation system turning operation of robot robot reprogramming, industrial robot reprogramming stran 292 od 326 EN ‐DE: slovar avtomatizacije in robotike Umprogrammierung reprogrammlng Umrissfolgeregler contour follower Umrisssteuerung contouring control change‐over flexibility (of gripper) Umrüstflexibilität Umrüstflexibilität (eines Greifers) change‐over flexibility (of gripper) Umrüstung eines Roboters change‐over of robot, resetting of robot umschaltbar switchable Umschaltkontakt change‐over contact Umschaltkontakt double‐throw contact Umschaltkontakt transfer contact Umschaltkontakt two‐way contact Umschaltkontakt alternating contact Umschaltkontakt mit neutraler Stellung double‐throw contact with neutral position Umschaltkontrolle mit gleichzeitiger Zeitmessung switching check with simultaneous timing Umschaltkreis commutated network Umschaltkreis switching network Umschaltkreis switching circuit Umschaltmotor change‐speed motor Umschaltregelautomatik commutation automatic change‐over control Umschaltsignal switching signal Umschalttor change‐over gate Umschalttor commutation switch Umschaltungskette commutated network Umschaltungskette switching network Umschaltzeit switching time Umschaltzeit switching period Umschaltzeit switch‐over time umschreibbarer Steuerspeicher writable control store Umsetzer converter Umsetzer transducer Umsetzer transductor fuzzification Umsetzung von scharfen Signalwerten in Zugehörigkeitsgrade von linguistischen Werten conversion time Umsetzungszeit Umsteuergröße modifier umwandeln convert v Umwandler converter Umwandler transducer Umwandler transductor Umwandlerprogramm converter program Umwandlung conversion Umwandlung converting Umwandlung transformation Umwandlung transforming Umwandlung grafischer Darstellung in elektrische Spannungs graphical record converting into electric voltage wave conversion unit Umwandlungseinheit Umwandlungsprogramm transformation program Umwandlungswirkungsgrad conversion efficiency conversion time Umwandlungszeit conversion loss Umwandlungwerlust Umwelt environment Umwelt environs Umweltdaten pi eines Roboters environment data of robot Umwelterfassung environment acquisition umweltgerechte Roboterkonstruktion robot construction suitable to environment Umweltmodell environment model Umweltmodelldaten pf data of environment model Umweltmodelldaten pl data of environment model Umweltsimulation environment simulation Umweltstabilität environmental stability Umweltstörgröße environmental disturbance variable unabhängig gesteuerte Antriebsbewegung independent‐controlled drive movement unabhängig programmierter Rechner independent‐programmed computer unabhängig verzögerter Auslöser definite time‐limit release unabhängig verzögerter Selbstunterbrecher definite time‐lag circuit‐breaker unabhängig verzögertes Relais definite time‐lag relay unabhängige definite time lag unabhängige fixed time lag unabhängige permanent delay unabhängige Antriebsbewegung independent drive movement unabhängige Armlängsbewegung independent longitudinal movement of arm unabhängige Betriebsweise offline operation unabhängige Konstante non‐contiguous constant unabhängige manuelle Operation independent manual operation unabhängige Regelung independent control unabhängige Roboterbewegungskontrolle independent motion checking of robot stran 293 od 326 EN ‐DE: slovar avtomatizacije in robotike unabhängige Veränderliche unabhängige Zeitverzögerung unabhängige Zeitverzögerung unabhängige Zeitverzögerung unabhängiger Handbetrieb unabhängiges Dienstprogramm unabhängiges Messinstrument unabhängiges Programm unabhängiges tragbares Gammaspektrometer unabhängiges tragbares Gammaspektrometer unabhängiges Zeitrelais unabhängiges Zeitrelais Unausgeglichenheit unbedingt unbedlingter Sprung unbegrenzt unbegrenzt unbekannter Zustand unbelastet unbelastet unbelastet unbemannte Fabrik unbemannte Fertigung mit Robotern unbemannte Fertigung mit Robotern unbemanntes (selbständiges) Fahrzeug unbenannte Zahl unbenannter Koeffizient unbeschränkt unbeschränkt unbeständiger Zustand Unbeständigkeit unbestimmtes Integral Unbestimmtheitsbereich Unbestimmtheitsdiagramm Unbestimmtheitsfunktion UND‐Glied undichtes Gehäuse UND‐Operation UND‐Schaltung UND‐Schaltung UND‐Tor UND‐Tor UND‐Verknüpfung UND‐Verknüpfungsglied unempfindlich unempfindlicher Sensortyp Unempfindlichkeit Unempfindlichkeit Unempfindlichkeit des Gliedes Unempfindlichkeitsbereich Unempfindlichkeitsbereich Unempfindlichkeitszone Unempfindlichkeitszone unendlich unendlicher Automat unendlicher Stabilitätsgrad unerlaubte Operation unfaehig zu erlernen Unfallschutz ungedämpfte Frequenz ungedämpfte Regelung ungelegene Betätigung ungeordneter Teilevorrat ungeordnetes Handhabungsobjekt ungeordnetes HHO ungerade Funktion ungerade symmetrische Nichtlinearität ungeradzahlige Harmonische ungeregelt ungeregelte Gleichspannung ungerichteter Graph ungesteuerte Fügebewegung ungesteuerte Orientierungsbewegung ungesteuerter Fügemechanismus ungesteuerter Fügemechanismus ungestörtes dynamisches System independent variable definite time lag fixed time lag permanent delay independent manual operation independent utility program self‐contained instrument independent program autonomous portable gamma‐ray spectrometer independent portable gamma‐ray spectrometer definite time‐lag relay independent time‐lag relay unbalance unconditional unconditional jump unbounded boundless unknown state no‐charge no‐load nonchargeable unmanned factory unmanned production with robots unmanned production with robots unmanned vehicle abstract number non‐dimensional coefficient unbounded boundless unsettled condition inconstancy indefinite integral zone of ambiguity ambiguity diagram uncertainty function AND‐element leaky package AND‐operation AND‐circuit AND‐gate AND‐circuit AND‐gate conjunction logical AND circuit insensitive insensitive sensor type insensitivity non‐sensitivity non‐sensitivity of element dead band dead zone dead band dead zone infinite infinite automaton infinite degree of stability illegal operation unable to learn (ro move, to change, … etc.) accident prevention natural frequency undamped control inopportune operation disordered parts stock disordered handling object disordered handling object odd function odd symmetrical non‐linearity odd harmonic uncontrolled unregulated continuous voltage non‐directed graph uncontrolled joint(ing) movement uncontrolled orientation movement uncontrolled joint(ing) mechanism uncontrolled join[ing] mechanism free dynamic system stran 294 od 326 EN ‐DE: slovar avtomatizacije in robotike ungestörtes Einersignal ungestörtes Nullsignal ungetaktet ungetaktetes System ungezwungene Schwingung ungezwungene Schwingung ungezwungene Schwingung ungezwungene Schwingung ungezwungene Schwingung ungleich ungleichförmige Drehbewegung ungleichförmiger heterostatischer Ungleichförmigkeitsgrad Ungleichförmigkeitsgrad Ungleichgewicht Ungleichimpuls ungleichmäßige Greiferbewegung ungleichmäßiger Laserstrahl ungültig machen Unifizierung Unifizierung uniform unipolarer Mikrorechner Unisensor unitäre Transformation unité unité unité Universalanwendung Universalelement universaler Labormessautomat universales Baukastensystem Universal‐Fügemechanismus Universalfunktionswandler Universal‐Gelenkroboter Universalgreifer Universalhilfsrelais Universalimpulsmodell Universalinterface für Peripherieanschluss Universalkontrollgerät Universallabormessautomat Universalmanipulator Universalmanipulator Universalmaschine Universalmikroskop mit automatischer Belichtungsregelung Universalprogrammgeber Universalprogrammierer für Roboter Universalprüfroboter Universalrechner Universalregisterstruktur Universalschnittstelle Universalschnittstelle Universalsteuerautomat mit freier Programmauswahl universelle Manipulatoranwendung universelle Manipulatoranwendung universelle Peripherieschnittstelle universelle rechner‐orientierte Sprache universelle Robotersteuerung universelle Robotersteuerung universelle Sensorgeometrie universelle Steuerung universelle Steuerung universeller Algorithmus universeller Automat universeller Automat universeller Befehl universeller faseroptischer Sensor universeller Industrieroboter universeller IR universeller Manipulatoreinsatz universeller Manipulatoreinsatz universeller Miniroboter universeller Peripheriesteuerungs‐Schaltkreis universeller Peripheriesteuerungs‐Schaltkreis universeller Prozessor universeller Prozessor undisturbed one signal undisturbed‐zero output unclocked system without clock autooscillation self‐oscillation selfvibration free oscillation natural oscillation unmatched non‐uniforme rotary movement asymmetrical heterostatic circuit degree of irregularity irregularity coefficient non‐equilibrium unequal impulse non‐uniform gripper movement non‐uniform laser beam cancel v standardization uniformalization uniform unipolar microcomputer universal sensor unitary transformation component part construction unit structural member general‐purpose application universal element universal measuring laboratory‐type universal aggregate system universal joint(ing) mechanism universal function converter universal‐joint robot universal gripper universal auxiliary relay universal impulse model (of controlled system) universal peripheral interface universal checking machine universal measuring laboratory‐type universal manipulator universal manipulator universal machine universal microscope with automatic exposure universal program transmitter universal programmer for robots universal testing robot general‐purpose computer general‐register architecture universal interface general‐purpose interface universal control automaton with free program selection universal manipulator application universal manipulator application universal peripheral interface universal computer‐oriented language universal robot command universal robot command universal sensor geometry universal control universal control universal algorithm multipurpose automatic device universal automaton universal instruction universal fibre‐optical sensor universal industrial robot universal industrial robot universal manipulator application universal manipulator application universal mini robot universal peripheral controller UPC universal processor universal processor stran 295 od 326 EN ‐DE: slovar avtomatizacije in robotike universeller Robotereinsatz universeller Sensor universeller Sensortyp universeller Sensortyp universelles Entwicklungssystem universelles Greifergetriebe universelles halbautomatisches Prüfgerät universelles Interface universelles Interface unklare Instruktion unklare Programmierung unklares Filtrierungssystem unkohärente Analogmodulation unkorrigierbarer Fehler unkorrigierbarer Fehler unkorrigierte Laufzeit unkorrigierte Verzögerung Unlösbarkeitsgrad unmittelbare Regelung unmodulierte Trägerwelle unpaarig unpassendes Ansprechen unpolarisiertes Relais unregelmäßig unregelmäßiger Kode Unregelmäßigkeitsfaktor unrichtige Operation unscharfe Entscheidung unscharfe Information unscharfe Logik unscharfe Menge unscharfe Menge mit einem Wertepaar unscharfe Menge mit einem Wertepaar unscharfe ODER‐Verknüpfung unscharfe Regel unscharfe Relation (Beziehung) unscharfe UND‐Verknüpfung unscharfe Zahl unscharfer Operator unscharfes Robotermodell unscharfes Schließen unscharfes Schließen unscharfes Schließen unscharfes Schlussfolgerungssystem unscharfes Schlussfolgerungsverfahren unscharfes Schlussfolgerungsverfahren unscharfes Schlussfolgerungsverfahren unscharfes Schlussfolgerungsverfahren unscharfes Schlussfolgerungsverfahren unstabile Bewegung unstabiler Brennpunkt unstabiler Grenzzyklus unstabiler Knoten unstabiler Regelvorgang Unstabilität unstetig unstetige Funktion unstetige Größe unstetige Regelung unstetige Regelung unstetige Wirkung unstetiger Regler unstetiger Regler intermittente unstetiger Regler intermittente unstetiger Regler intermittente unstetiger Zustand unstetiges Glied unstetiges Integrationsgetriebe unstetiges Signal unstetiges Signal unstetiges System unstetiges System Unstetigkeit Unstetigkeitsstelle unsymmetrische Massenkraft unsymmetrische Modulation universal robot application, universal sensor universal sensor type universal sensor type universal development system universal gripper gear universal semi‐automatic tester universal interface general‐purpose interface fuzzy instruction fuzzy programming fuzzy filtration system incoherent analog modulation unrecoverable error uncorrectable error uncorrected delay uncorrected delay insolubility degree direct control unmodulated carrier unmatched inopportune operation non‐polarized relay irregular irregular code irregularity coefficient incorrect operation fuzzy decision fuzzy information fuzzy logic fuzzy set fuzzy singleton, singleton singleton fuzzy OR fuzzy rule fuzzy relation fuzzy AND fuzzy number fuzzy operator unsharp robot model approximate reasoning fuzzy inference fuzzy reasoning fuzzy inference system (FIS) max‐prod inference sum‐min inference sum‐prod inference Mamdani inference max‐min inference unsteady motion unstable focus unstable limit cycle unstable node unstable control operation instability intermittent discontinuous function discontinuous variable discontinuous control intermittent control discontinuous action discontinuous‐action controller discontinuous controller discrete action controller intermittent controller unsettled condition discontinuous term discontinuous integration gearing discontinuous signal intermittent signal intermittent system discontinuous system unsteadiness point of discontinuity asymmetric mass force asymmetric modulation stran 296 od 326 EN ‐DE: slovar avtomatizacije in robotike unsymmetrische Nichtlinearität unsymmetrische Verzerrung unsymmetrisches nichtlineares Element Unterarm Unterbaugruppenmontage unterbestimmt unterbrechen unterbrechen unterbrechen unterbrechen unterbrechen unterbrechen Unterbrecherrelais Unterbrechung Unterbrechung Unterbrechung Unterbrechungsanerkennungssignal Unterbrechungsaufforderung Unterbrechungsauslösung Unterbrechungsbus Unterbrechungseinheit unterbrechungsgesteuerter Mikroprozessor unterbrechungsgesteuertes System Unterbrechungsidentifizierung Unterbrechungskanal Unterbrechungsprioritätssystem Unterbrechungsquelle Unterbrechungsquellensperrung Unterbrechungsregister Unterbrechungsschalter Unterbrechungsstelle Unterbrechungssteuereinheit Unterbrechungssteuerungsgerät Unterbrechungsvektor Unterbrechungsvektormodifikation Unterbrechungszeit unterbrochen unterdeterminiert Unterdrückung Unterdrückung der Selbstschwingungen Unterdrückungskoeffizient untere Spannung unterer Roboterarm unterer Wert unteres logisches Niveau untergeordnete Struktur Unter‐MIN‐Operator Untermontage Unternehmensforschung Unternehmensforschung Unterprogrammnummer Unterrichtsgestaltung auf Rechnerbasis Unterscheidungsvermögen Unterschlackeschweißautomat Unterschlackeschweißautomat Unterschwellenlasermode Unterschwellenlasermode Unterschwellenlaserzustand Unterschwellenlaserzustand Unterschwingen Unterspannungsauslöser Unterspannungsauslöser Unterspannungsetzen Unterspannungsgerät Unterstromauslösen Unterstromausschalten Unterstützung der Basisprogrammierung Unterstützungsprogrammsystem Unterstützungssoftware Untersuchung Untersuchung Untersuchung von Montagekonzepten untersynchrone Stromrichterkaskade Untersystem unterteilen unterteilen asymmetrical non‐linearity bias distortion asymmetric non‐linear unit below arm sub‐assembly mounting underdetermined interrupt v close v cut off v bar v break v abort v chopping relay interruption break[ing] abort interrupt acknowledge signal interrupt call interrupt tripping interruption bus interruption unit interrupt‐controlled microprocessor interrupt‐driven system interrupt identification interrupt channel interrupt priority system interrupt source interrupt disarm interrupt register breakpoint switch breakpoint interrupt control unit interrupt controller interrupt vector interrupt vector modification interrupting time intermittent underdetermined suppression suppression of self‐oscillations cancellation ratio bottom voltage lower robot arm low value logic low level subordered structure Under min operator sub mounting enterprise investigation operational reserch subroutine number computer‐based education scenario discrimination automatic electroslag welder automatic electroslag welding machine before‐threshold behaviour below‐threshold laser state; before‐threshold behaviour below‐threshold laser state; undershoot no‐voltage release no‐voltage trip making alive undervoltage device undercurrent tripping undercurrent tripping basic programming support, BPS support system support software inquiry assembly draft investigation assembly draft investigation subsynchronous rectifier cascade subsystem partition v segment v stran 297 od 326 EN ‐DE: slovar avtomatizacije in robotike unterteilte Automatisierung Unterteilung Unterwassermanipulator Unterwasserroboter ununterbrochene Feuchtigkeitsmessung unveränderlich Unveränderlichkeit unverbesserlich unverbesserlich unvermaschtes Sicherheitssystem unvermaschtes Sicherheitssystem unverträgliches System von Gleichungen Unverträglichkeit unverzögerte Streckensicherung unverzögerter Detektor unverzweigte Robotermontage unwesentliche Daten pl Unwucht unzulässiger Wert unzulässiger Zustand Urspannung Ursprung eines Koordinatensystems ursprünglicher Zustand u‐Schubbewegung ÜÜbertragungsfunktion des geschlossenen Regelkreises ÜÜbertragungsfunktion des geschlossenen Regelkreises Vakuumanlage Vakuumanzeiger Vakuumapparat Vakuumfluoreszenzanzeige Vakuumfotozelle Vakuumkammer Vakuummessgerät Vakuumregler Vakuumregler Vakuumregler Vakuumtechnik Vakuumverfahren Variable variable Bewegungen variable Blocklänge variable Daten pl variable Handhabungsanforderung variable Komponente variable Rückführung variable Rückführung variable Verzögerungsblock variable Verzögerungsblock Variablengenerierung (für IR‐Befehle) Variablensubstitution Variablenvertauschung variabler Bestückungskopf variabler definierter Antriebsdrehwinkel variabler Faktorgeber variabler Faktorgeber variables Dämpfungsglied variables Dämpfungsglied variables Dämpfungsglied Varianten von Greifermechanismus Varianz Varianzanalyse Variation Variation der Konstanten Variationsbereich Variationsbereich (des Robotereinsatzes) Variationsgleichung Variationsprinzip Variationsrechnung Varietät variierbarer Parameter Variometer Variometer Varistor Varmeter v‐Drehbewegung Vektor sectional automation segmentation underwater manipulator underwater robot continuous humidity measurement invariable invariance irrecoverable unrecoverable non‐interacting safety system single‐loop safety system inconsistent system of equation incompatibility quick‐break feeder fuse instantaneous action detector non‐branched robot assembly irrelevant data unbalance illegal value inadmissible state primary voltage coordinate system origin orginal state u‐sliding movement closed‐loop transfer function output transfer function (US) vacuum plant vacuum indicator vacuum apparatus vacuum fluorescent display vacuum photocell vacuum chamber vacuum measuring instrument vacuum controller vacuum governor vacuum regulator vacuum technique vacuum process variable variable movements variable block length variable data variable handling requirement variable component elastic feedback variable feedback variable time‐delay block variable timelag unit variable generation (of IR instructions) change of variables change of variables variable mounting head variable defined drive rotation angle variable coefficient unit variable scale factor unit adjustable attenuator, variolosser adjustable attenuator variolosser variants of gripper mechanism variance variance analysis, analysis of variance, ANOV variation variation of constants variation range variation range (of robot application) variational equation variation principle calculus of variation variety adjustable parameter adjustable inductor variometer varistor varmeter v‐rotary motion vector stran 298 od 326 EN ‐DE: slovar avtomatizacije in robotike Vektordarstellung Vektordiagramm Vektorfunktion vektorielle Darstellung vektorielle Schreibweise einer Roboterbewegung vektorieller Prozessor Vektoroptimierung Vektorparameter Vektorspalte Vektortheorie Vektorwellenanalyse Vektorwert Ventil verallgemeinerte Frequenzcharakteristik verallgemeinerte Koordinaten verallgemeinerte Übertragungsfunktion verallgemeinerter Automat verallgemeinerter Parameter verallgemeinertes aktives Element verallgemeinertes Modell veränderbare Durchflussregelung veränderbare Speicherung veränderbarer Festwertspeicher Veränderliche veränderliche Abstimmung Veränderliche automatischer Regelung veränderliche Dichte veränderliche Koordinaten veränderliche Stromeinstellung veränderliche Verzögerung veränderliche Zyklusdauer veränderlicher Befehl veränderlicher Haupttakt veränderlicher Widerstand Veränderung der Manipulationsart Veränderung fder Manipulationsart Veranschaulichung mittels Robotertechnik verarbeitete Roboterinformation Verarbeitung Verarbeitung der Sensordaten Verarbeitung eines Roboterprogramms Verarbeitung geometrischer Informationen Verarbeitung grafischer Informationen Verarbeitung optischer Daten Verarbeitung von Grauwertbildern Verarbeitung von Sensorinformationen Verarbeitungsart Verarbeitungsautomat Verarbeitungseinheit Verarbeitungseinheit Verarbeitungseinheit Verarbeitungsfähigkeit Verarbeitungsform Verarbeitungsgeschwindigkeit Verarbeitungsinformation Verarbeitungskapazität Verarbeitungsmaschine Verarbeitungsmodul Verarbeitungsmonitor Verarbeitungsmonitor Verarbeitungsoperation Verarbeitungsschritt Verarbeitungsstation Verarbeitungssystem für Sensorsignale Verarbeitungszyklus verbesserte (bessere) Präzision verbesserte Präzision verbesserte Präzision verbesserte Präzisionssteuerung verbesserte Schaltkreistechnik Verbesserung Verbesserungsverfahren verbiegen verbinden verbinden Verbinden von peripheren Geräten vector representation vector diagram vector function vector representation vectorial notation of robot movement vectorial processor vector optimization vector parameter column vector vectorial theorie vectorial wave analysis vector value valve generalized frequency response generalized coordinates generalized transfer function generalized automaton generalized parameter generalized active element generalized model variable flow control variable storage alterable read‐only memory, AROM variable variable tuning variables of automatic control variable density variable coordinate adjustable current setting variable delay variable cycle duration variable instruction variable master clock adjustable resistance change of manipulation kind change of manipulation kind illustration by means of robotic (robots technique) processed robot information processing sensor data processing processing of robot program processing of geometric information graphic data processing optical data handling processing of grey value images processing of sensor information mode of processing processing automaton processor, processing unit, PU processor processing unit processing capability mode of processing processing speed processing information processing capacity processing automaton processing module processing monitor processing monitor, PM processing operation processing step processing station processing system for sensor signals processing cycle improved precision improved precision improvement of control quality improved precision control improved circuit technique improvement corrective procedure warp v link v connect to interconnection of peripheral equipments stran 299 od 326 EN ‐DE: slovar avtomatizacije in robotike Verbindung (durch Roboter) Verbindungsaufbau Verbindungsdraht Verbindungselement Verbindungsfolge Verbindungsfunktion Verbindungsglied Verbindungsglied Verbindungsmatrix verbindungsprogrammierte Steuerung Verbindungspunkt Verbindungsregister Verbindungsrichtlinie Verbindungsschema Verbindungsschraube Verbindungssteuertabelle Verbindungsstift Verbindungstechnik Verbindungsverträglichkeit Verbindungsweg Verbindung‐Synchronisation Verblockungssystem verbotene Logik verbotener Befehl verbotener Relaiskreiszustand verbotenes Energieband verbotenes Inkrement Verbotssignal Verbrauch Verbraucherspannung Verbraucherstromkreis Verbreitung Verbrennungsregelungsanlage Verbrennungsregler Verbrennungssystem Verbundausdruck Verbundbedingung Verbundbetrieb verbunden Verbunderregung Verbundnetz Verbundregelung Verbundschaltung Verbundstoff Verbundsynthese Verbundsystem Verbundsystem Verbundsystem verdrahtetes Interruptprioritätssystem Verdrahtung Verdrahtungsautomat i Verdrahtungsfehler Verdrahtungsmethode Verdrahtungsprogramm Verdrahtungsprüfungsroboter Verdrahtungswerkzeug ( Verdrehsicherung feines Greifers Verdünnungsmittel vereinbarer Zustand Vereinbarung vereinfachte automatische Multiplikation vereinfachter Programmablaufplan vereinfachter Regelalgorithmus vereinfachtes Modell Vereinheitlichung Vereinheitlichung vereinigen vereinigen Vereinigung Vereinigung der Zustände Vereinigung der Zustände Vereinigungsgraf Vereinigungsgraf Vereinigungsoperation bei Mengen (ODER‐Operation) Vereinigungsstruktur Vereinzeln der Werkstücke connection (by robot) connection buildup connecting wire joining element linking sequence connecting function connecting joint connective connection matrix connection‐programmed control connection point linkage register linkage convention connection diagram assembly screw linkage control table connecting pin connecting technique connecting compatibility connecting path links synchronization interlocking device illogical logic illegal instruction relay circuit forbidden condition forbidden band forbidden increment inhibiting input consumption load voltage load circuit propagation combustion control equipment combustion controller combustion system compound expression compound condition interconnection connected compound excitation interconnected network coupled control element combination compound connection composite material compound synthesis compound system interconnected system overall system hardware priority interrupts wiring wiring automaton wiring error wiring method wiring program robot for wiring tests wire wrap tool torsion safety of gripper diluent compatible state (theory of automata) convention simplified automatic multiplication simplified plan for program schedule simplified regulation algorithm simplified model standardization uniformalization associate v join v union combination of the states joining of the states combined graph combination graph union operation integrated structure separating of s stran 300 od 326 EN ‐DE: slovar avtomatizacije in robotike Vereinzelungseinrichtung Verfahren Verfahren der Molekulartechnik Verfahren für Kurvenverfolgung Verfahren mit Güteparametern Verfahren zur chemischen Behandlung Verfahrensbedingungen Verfahrensbewertung Verfahrensdiagramm Verfahrenseinschätzung Verfahrensentwicklung Verfahrenserkennung Verfahrensfehler Verfahrensfließbild Verfahrensfließbild Verfahrensforschung Verfahrensforschung verfahrensorientierte Industrie verfahrensorientierte Programmiersprache verfahrensorientierte Prozedursprache Verfahrensregelung Verfahrensroboter Verfahrenssteuersystem verfahrenstechnisches System verfahrenstechnisches System Verfolgen von Objekten Verformung durch Roboter Verformung feines elastischen Körpers verfügbare Einheit verfügbare Leistung verfügbares Programm verfügbares Sensorsystem Verfügbarkeit Verfügbarkeit Verfügbarkeit eines Industrieroboters (IR) Verfügbarkeit/von Roboterteilen Verfügbarkeitsfaktor vergänglicher Temperaturgradient Vergasungsanlage Vergasungsprozess Vergasungsreaktor Vergasungsverfahren Vergleich vergleichbar vergleichbar Vergleichbarkeit Vergleichbarkeit vergleichen Vergleicher Vergleicherlogik Vergleichsapparat Vergleichselement Vergleichsglied Vergleichsglied Vergleichsglied Vergleichsinstruktion Vergleichslogik Vergleichsmethode Vergleichsmethode Vergleichsmodul Vergleichsoperation Vergleichsoperator Vergleichsorgan Vergleichsorgan Vergleichspotentiometer Vergleichspriorität Vergleichsquelle Vergleichssatz Vergleichsschaltung Vergleichsschaltung Vergleichsstelle Vergleichssystem Vergleichstheorem Vergleichswert Vergleichung vergrabener Kontakt separating device method molecular engineering technique curve follower logic qualitative methods chemical treatment process process conditions process evaluation process chart process evaluation process development process identification error of approximation process diagram flow sheet operational reserch enterprise investigation process‐oriented industry procedure‐oriented language procedural (procedure‐oriented) language process regulation process robot process control system chemical‐technological system chemical process system tracking of objects shaping by robot forming of elastic body available unit available power available program available sensor system accessibility availability availability of industrial robot availability of robot parts availability factor transient temperature gradient gasification plant gasification process gasification reactor gasification process comparison comparable commensurable commensurability comparability compare v comparator compare logic reference instrument comparison element comparator device error‐mesuring device comparator compare instruction compare logic comparison method method of comparison equals module comparison operation relational operator comparator device comparator comparison potentiometer matching priority reference source comparison theorem comparison circuit differential connexion reference junction comparison system comparison theorem matching value comparison buried contact stran 301 od 326 EN ‐DE: slovar avtomatizacije in robotike Verhalten Verhalten Verhalten Verhalten des Systems Verhalten im Beharrungszustand Verhalten im Beharrungszustand Verhaltensanalyse Verhaltensanalyse eines Automaten Verhaltensstrategie Verhaltenstyp Verhaltensweise Verhaltensweise Verhältnis Verhältnis Verhältnis Einersignal‐Nullsignal Verhältnisanalysator Verhältnisanzeiger Verhältnismessgerät Verhältnisregelung Verhältnisregelung Verhältnisregler Verhältniszahl verhindern Verifikation Verifikation Verifikation verkabeln (durch Roboter) Verkabelung (durch Roboter) verketten verkettete Arbeitsmaschinen verkettete Arbeitsmaschinen verkettete Transferstraße verketteter Manipulator verkettetes Roboter‐Maschinensystem Verkettung von Industrierobotern Verkettung von Maschinen Verkettung von unscharfen Relationen Verkettungsausdruck verklemmungsfreies Fügen Verknüpfungen zwischen zwei Variablen Verknüpfungsdiagramm Verknüpfungsfrequenz Verknüpfungsglied Verknüpfungsglied Verknüpfungsglied Verknüpfungskapazität Verknüpfungsvorschrift verkoppelte Regelkreise verkoppelte Steuerungen verkürzt Verlauf einer Antriebsgeschwindigkeit verlustarm Verlustfaktor Verlustleistung Verlustmodul Verlustwiderstand vermaschte Anlage vermaschte Anlage vermaschte Regelstrecke vermaschte Regelstrecke vermaschte Regelung vermaschte Regelung vermaschte Regelung vermaschte Schaltung vermaschter Regelkreis vermaschter Regelkreis vermaschter Regelkreis vermaschtes Regelungssystem vermehrter Impuls vermuten vermuten vernachlässigbarer Fehler vernachlässigen vernachlässigen verpacken (durch Roboter) Verpackungsroboter action behaviour way of behaviour system behaviour steady state response steady‐state response analysis of behaviour behaviour analysis of automaton behaviour strategy type of behavior behaviour way of behaviour ratio proportion one‐to‐zero ratio ratio analyzer ratio indicator ratio measuring instrument flow ratio control ratio control ratio controller proportionality factor inhibit v monitoring verification supervision cable to (by robot) cabling (by robot) link v chained [work] machines chained work machines, chained machines interlinked transfer line chained manipulator chained robot‐machine system linking of industrial robots linking of machines composition concatenation expression jointing without jamming connectives of two variables logical diagram conjugation frequency combinational circuit decision element logical element capacity of connection connection instruction combination automatic controller interconnected controls short course of drive speed low‐loss loss factor power dissipation loss modulus loss resistance controlled member with interacted conditions controlled plant with controlled member with interacted conditions controlled plant with multielement control interacting control multivariable control intermeshed circuit interaction automatic control system multiple‐loop servomechanism control of many‐variable system interaction automatic control system multiplied pulse suppose v assume v negligible error neglect v disregard v pack to (by robot) packaging robot stran 302 od 326 EN ‐DE: slovar avtomatizacije in robotike verrauscht verrauschter Nachrichtenübertragungskanal m verrauschter Servomechanismus Verregelungsglied verriegelter Betrieb Verriegelungseinrichtung Verriegelungselement Verriegelungsrelais Verriegelungsrelais Verriegelungsrelais Verriegelungsvorrichtung Verriegelungszeit Versabus verschalten verschiebbarer Modul verschiebbares Objektprogramm Verschiebebefehl verschieben verschieben Verschiebesignal Verschiebevektor Verschiebevektorendpunkt Verschiebeweg Verschiebeweg Verschiebung Verschiebungsdichte Verschiebungsgeber Verschiebungskonstante Verschiebungskreis Verschiebungsregler Verschiebungssatz verschiedene Einheiten Verschiedenheitsfaktor Verschleißprüfer Verschlusseinrichtung verschlüsseln verschlüsseln verschlüsselt Verschlüsselung Verschlüsselung in der Fernsteuerung Verschlüssler Verschlüssler Verschlüssler Verschraubung (durch Roboter) Verschraubung mittels Industrieroboters versetzen versetzen versetzen versetzen versetzte Frequenz versetzte Stromkreise Versetzungsdichte Verseuchungsmessgerät Versorgungsleitung zum Roboter Versorgungsstrommessung Versorgungsstrommessung Verspätung Verspätung Verspätung verstärken verstärken Verstärker Verstärker Verstärker Verstärker des Aufzeichnungsantriebes Verstärker für Mikrologikschaltung Verstärker mit hohem Gewinn Verstärker mit verteilten Parametern Verstärker mit Verzögerungsanordnung Verstärker) Verstärkeranlage Verstärkerbandbreite Verstärkerbetriebsart Verstärkerdrossel Verstärkerelektonenröhre noisy noisy communication channel noisy servomechanism locking member interlocked operation interlocking device locking member blocking relay guard relay interlocking relay clamping device interlock time versabus connect v relocatable module relocatable object program, slidable object program shifting instruction shift v offset v shift signal shifting vector end point of shift[ing] vector displacement travel shift path shift[ing] dislocation density displacement indicator displacement constant shift circuit displacement controller bias theorem various units diversity factor wear‐testing gauge shutter encipher v encode v coded coding remote control coding coder encoder code equipment screw cap (by robot) robot bolting, industrial robot bolting offset v blend v mix v mingle v offset frequency staggered circuits dislocation density contamination meter supply line to robot supply current measurement supply current measurement delay lag retardation amplify v boost v amplifier dead zone (relay, on‐off‐controller, amplifier) amplifying element recorder driver amplifier amplifier for micrologic circuit high‐gain amplifier distributed parameter amplifier delay amplifier dead zone (relay, on‐off‐controller, amplifier), dead band (backlash nonlinearity booster mechanism amplifier bandwidth amplification class transductor element amplifying electron tube stran 303 od 326 EN ‐DE: slovar avtomatizacije in robotike Verstärkerelektonenröhre Verstärkerfrequenzgang Verstärkerkette Verstärkerklasse Verstärkermechanismus Verstärkerröhre Verstärkerröhre Verstärkerschaltung Verstärkerschaltung Verstärkerstufe Verstärkerstufe Verstärkerventil Verstärkerwicklung verstärktes Signal Verstärkung Verstärkung des offenen Kreises Verstärkung in geschlossenen Regelkreis Verstärkungsbereich Verstärkungselement Verstärkungsfaktor Verstärkungsfaktor Verstärkungsfaktor Verstärkungsfaktor Verstärkungsfaktor des Vervielfachers Verstärkungsgrenze Verstärkungskennlinie Verstärkungskoeffizient Verstärkungskoeffizient Verstärkungskoeffizient Verstärkungskoeffizient Verstärkungsmesseinrichtung Verstärkungsmesser Verstärkungsnachstellung Verstärkungsorgan Verstärkungsprinzip Verstärkungsregelung Verstärkungsrelais Verstärkungsstabilisierung verstellbar verstellbare Spannungsregelung verstellbarer Kollimator verstellbarer Parameter verstellbarer Spannungsgleichrichter verstellbarer Spannungsteiler Verstellimpuls Verstellimpuls Verstellimpuls verstümmelte Information verstümmeltes Signal Versuch und Irrtum Versuchsanlage Versuchsaufbau experimental conditions 262 Versuchsbetrieb Versuchsbetrieb Versuchseinrichtung Versuchsergebnis Versuchsergebnis Versuchsplan Versuchsplanung Versuchsproduktion Versuchsraum Versuchsstand Versuchsstand Verteilanlage verteilen Verteiler Verteiler in Fernwirkanlagen Verteilerregister verteilt verteilte Dateneingabe verteilte Induktivität verteilte Kapazität verteilte Logik verteilte Netzwerke verteilte Redundanz verteilte Steuerung amplifying valve amplifier response amplifier chain amplification class booster mechanism amplifying electron tube amplifying valve amplifier circuit amplifying circuit amplification stage amplifier stage amplifier valve amplifier winding amplified signal gain, gain factor open‐loop gain closed‐loop gain gain range amplifier element amplification coefficient amplification constant amplification factor gain multiplier gain gain margin gain characteristic amplification coefficient amplification constant amplification factor gain gain set gain set gain adjustment amplifier element principle of amplification gain control amplification relay gain stabilization controllable adjustable voltage control adjustable collimator adjustable parameter adjustable voltage rectifier adjustable voltage divider actuating pulse control pulse driving pulse garbled information garbled signal trial and error trial equipment experimental assembly test run trial run experimental facilities test result experimental result test plan design of experiments trial production test chamber pilot plant experimental unit distributor distribute v distributor remote control distributor distribution register distributed distributed data entry distributed induction distributed capacity distributed logic distributed network distributed redundancy distributed control stran 304 od 326 EN ‐DE: slovar avtomatizacije in robotike verteiltes Datenverarbeitungssystem verteiltes Rechnersystem Verteilung der Steuerung Verteilung[sfunktion] Verteilungsdispersion Verteilungsfunktion Verteilungsgesetz Verteilungskode Verteilungskoeffizient Verteilungskoeffizient Verteilungskonstanten Verteilungsmodell Verteilungsschaltung vertikale Achse vertikale Armbewegung vertikale Armlängsbewegung vertikale Fügebewegung vertikale Längsbewegung vertikale Mikroprogrammierung vertikale Prüfung vertikale Roboterarmverschiebung Verträglichkeit Verträglichkeitsanschluss Verträglichkeitsbedingung Vertrauenskoeffizient vertriebsgerechte Roboterkonstruktion Vervielfachungsprozess vervollkommnen vervollkommnen vervollständigen vervollständigen Vervollständigung Verwaltungs‐ und Datennetzwerk Verwaltungs‐Datenendstellensystem Verwaltungsinformation Verwaltungssystem verwandeln Verweilzeit Verweilzeit Verweisadresse Verweisungsauftrag verwendbar verwendete Roboterart Verwendung Verwendung Verwendung verzerrtes Signal Verzerrung Verzerrungsanalysator verzerrungsbegrenzter Betrieb Verzerrungsfaktor Verzerrungsfaktor verzerrungsfrei Verzerrungskompensation distorsion Verzerrungskompensation distorsion Verzerrungsmessbrücke Verzerrungsmesser verzögerte Abtastung verzögerte Alarmgabe verzögerte Anwendung verzögerte Kollektorleitung verzögerte Reaktivität verzögerte Regelung verzögerte Regelung verzögerte Rückführung verzögerte selbständige Verstärkungsregelung verzögerte Wirkung verzögerte Zündung verzögerter Manipulationsfehler verzögerter Schutz verzögerter Übertrag Verzögerung Verzögerung Verzögerung Verzögerung Verzögerungseinheit distributed processing system distributed computer system distribution of control distribution distribution variance distribution function distribution law distribution code partition coefficient distribution coefficient distributed constants distribution model distribution circuit vertical axis vertical lever movement vertical longitudinal movement of arm vertical joint[ing] movement vertical longitudinal movement vertical microprogramming vertical check vertical shift(ing) of robot arm compatibility compatibility attachment compatibility condition coefficient of trust robot construction suitable to marketing multiplication process complete v finish v complete v finish v completion administrative and data network, ADN administrative terminal system, ATS, administrative data term management information administrative system convert v dwell time turnaround time look‐up address blank instruction adaptable used kind of robot application use employment garbled signal distortion distortion analyzer distortion limited operation distortion coefficient distortion factor free of distorion distortion elimination compensation of distortion distortion bridge distortion meter delayed scanning delayed alarm delayed application delayed collector conduction delayed reactivity delayed control retarded control delayed feedback delayed automatic gain control time‐lag action delayed ignition delayed manipulation error time‐limit protection delayed carry deceleration delay lag retardation delaying unit stran 305 od 326 EN ‐DE: slovar avtomatizacije in robotike Verzögerungselement Verzögerungselement 1. Ordnung Verzögerungselement I. Ordnung Verzögerungsfaktor Verzögerungsfilter Verzögerungsfilter mit linearer Kennliniensteilheit verzögerungsfreie Robotersteuerung Verzögerungsglied Verzögerungsglied Verzögerungsglied Verzögerungskabel Verzögerungskennlinie Verzögerungskorrekturschaltung Verzögerungskreis Verzögerungskreis Verzögerungsleitung Verzögerungsleitungsregister Verzögerungsleitungsspeicher Verzögerungsmesser Verzögerungsphase Verzögerungsrückkopplungsgenerator Verzögerungsschaltung Verzögerungsstrecke Verzögerungssystem Verzögerungsverstärker Verzögerungswiedergabe Verzögerungszeit Verzögerunsmessgerät Verzugszeit Verzweigen bei Null verzweigte Robotermontage Verzweigung Verzweigungsadresse Verzweigungsbedingung Verzweigungsbefehl Verzweigungsbefehl Verzweigungsbefehl eines Roboter p rog ra m s Verzweigungselement Verzweigungsentscheidung Verzweigungsindex Verzweigungsmethode Verzweigungsprozess Verzweigungspunkt Verzweigungspunkt Verzweigungspunkt Verzweigungspunkt eines Roboterprogramms Verzweigungssteuerung Verzweigungssteuerung Verzweigungssteuerung eines Roboterprogramms Vibration Vibrationsfestigkeit Vibrationsmessvorrichtung Vibrationsprobe Vibrationsregler Vibrationsregler Vibrationsregler Vibrationsspeiser Vibrator Vibrograf schreibender Schwingungsmesser Vibrotron Videosignalamplitude Videosignalverarbeitung Videoverstärker Vielfachanalyse Vielfachbusstruktur Vielfachdetektor vielfachdimensionale Verteilung Vielfachheit Vielfachkoinzidenz Vielfachkontaktschalter Vielfachkontrolle Vielfachmikroprozessorsystem Vielfachresonanz Vielfachsensor Vielfachsteuung Vielfachzugriff delay element first‐order lag element lag element lag coefficient filter with time delay linear‐slope delay filter non‐delay robot control delaying member lag element delay element delay cable lag curve delay correction network inhibiting circuit time delay circuit delay line delay‐line register delay‐line memory decelerometer lagging phase delay feedback generator slowing‐down circuit delay line delay system delay amplifier delay representation delay time decelerometer delay time branch on zero branched robot assembly branching branch address branch condition branching instruction alternate instruction branch instruction of robot program branch point branch decision branching index branching method branching process branch point breakroot‐locus in point root‐locus breakaway point branch point of robot program branch control branching control branch control of robot program vibration vibration resistance vibration measuring equipment vibration test oscillating controller oscillating regulator vibrating controller vibrator conveyor vibrator vibrograph vibrotron video amplitude video‐signal processing video amplifier multianalysis multiple‐bus structure multiple detector multidimensional distribution multiplicity multiple coincidence multiple contact switch multiple check multimicroprocessor system multiple resonance multisensor multiple scatter[ing] multiaccess stran 306 od 326 EN ‐DE: slovar avtomatizacije in robotike Vielfaktor Vielfalt Vielkanal‐Gammaspektrometer Vielkanalstreuung Vielkanal‐Überwachungsanlage Vielkanal‐Überwachungssystem Vielkörperverdampfanlage Vielpunktsteuerung Vielpunktsteuerung r* vielseitige (anpassungsfähige) Roboterhand Vielstufenspeichersystem Vielstufenverfahren Vielstufenzähler vielwertige Funktion vielwertige Logik polyvalente vielwertige Logik polyvalente Vierfingerhand Vierpegelanordnung Vierpegelgenerator Viertermschema virtuelle Maschine virtuelle Speicher virtuelle Speicher virtuelle Speichertechnik virtueller Prozessor virtuelles Speicherkonzept Virtuellspeicherkonzept viskose Reibung viskoser Dämpfungskoeffizient viskoser Reibungskoeffizient Viskosimeter visuelle Abstimmung visuelle Anzeige visuelle Darstellung f,Sichtanzeige visuelle Erkennungsdaten pi visuelle Erkennungsdaten pl visuelle Informationen visuelle Kommunikation visuelle Manipulatorüberwachung visuelle Robotererkennungseinrichtung visuelle Roboterfähigkeit visuelle Sensorik visuelle Sensorik visuelle Sensorik (Sensortechnik) visuelle Sensortechnik visuelle Sensortechnik visuelle Überwachung visueller Sensor visuelles Alarmsystem visuelles Differentialrefraktometer visuelles Erkennungssystem visuelles Organ eines Roboters visuelles Roboterinspektionssystem visuelles Robotersystem vokale Eingabe vokale Erkennungskarte vokale Steuerung f(in der Robotik) Vokalterminal Vollast Vollautomat Vollautomat vollautomatische Analyse vollautomatische Blende vollautomatische Dieselnotstromanlage vollautomatische Einrichtung vollautomatische Fehlerkorrektur automatique vollautomatische koordinierte Verkehrsregelung vollautomatische Prüfung vollautomatische Verarbeitung Vollbelastung Vollbildübertragung feines IR Volldämpfung Vollduplexübertragungsleitung Vollduplexübertragungssystem volle Stoßwelle vollenden duplication factor variety multichannel gamma‐ray spectrometer multichannel scattering multichannel monitoring system multichannel monitoring system multiple effect evaporator multipoint control multipoint control, MPC, multipoint, MP versatile robot hand multistep memory system multistage process many‐stage counter many‐valued function multiple‐valued logic many‐valued logic four‐finger hand four level scheme four level generator four level scheme virtual machine virtual memory virtual storage virtual storage technique virtual processor virtual memory concept virtual memory concept viscous friction viscous friction coefficient viscous friction coefficient visco[si]meter visual tuning visual display visual display visual identification data visual identification data visual information visual communication visual manipulator supervising visual robot identification device visual capability of robot visual sensorics visual sensor technique visual sensorics, visual sensor technique visual sensorics visual sensor technique visual supervising visual sensor visual alarm system visual differential refractometer visual perception system visual element of robot visual robot inspection system visual robot system vocal input vocal recognition card vocal control (in robotics) vocal terminal full load fully automatic equipment fully automatic machine full‐automatic analysis fully automatic diaphragm fully automatic Diesel emergency power supply unit full‐automatic equipment full‐automatic error correcting fully automatic coordinated trafic regulation full‐automatic checkig full‐automatic processing full load full‐image transmission of IR complete attenuation full‐duplex communication line full‐duplex transmission system full‐wave voltage impulse complete v stran 307 od 326 EN ‐DE: slovar avtomatizacije in robotike vollenden Vollendung Vollinertiallenkung vollintegrierte Fertigungsanlage vollintegrierte Fertigungsanlage vollkommen vollkompatibler Prozessor Volllast vollmagnetischer Fahrschalter Vollmechanisierung Vollmechanisierung Vollmechanisierung Volloperation volloptischer Rechner vollprogrammierbare Manipulatorsteuerung vollprogrammierbare Manipulatorsteuerung programmable vollständig angeschlossener Automat vollständige Ableitung vollständige Fourier‐Reihe vollständige Induktion finite pulse width 274 vollständige Information vollständige Integration der Informationsverarbeitung vollständige Montagestation vollständige Roboterprogrammierung vollständige Umkehrbarkeit vollständige Zustandsliste vollständiger Regelalgorithmus vollständiger Stromkreis vollständiger Übertrag vollständiger Unterquasiautomat vollständiges System Vollständigkeit Volltrieb Volum[en]prozent Volumenkraft Volumenpotential Volumenregler volumetrisch‐manometrisches Gasanalysengerät von Ein‐ und Ausgabe abhängiges System voraus eingerichtet Vorausberechnung der Ausfallrate Vorausholen von Befehlen Voraussagegleichung vorausschauende Steuerung voraussetzen voraussetzen Voraussetzung Vorbehandlung Vorbehandlung Vorbehandlung Vorbehandlung Vorbehandlung mittels Roboters Vorbereitung Vorbereitung Vorbereitung Vorbereitung Vorbereitung eines Robotereinsatzes Vorbereitungsmethode Vorbereitungszeichen Vorbeschleuniger vorbetriebliche Prüfung Vorbetriebsprüfung vorbeugen vorbeugende Wartung Vordeponierplatz Vordergrundverarbeitung Vordrallregler Vordrallregler Voreilen der Phase Voreilen der Phase Voreilglied Voreilimpuls Voreilung Voreilungswinkel voreingestellter Impulszähler voreingestellter Wert finish v completion all‐inertial guidance full‐integrated production equipment fully‐integrated production equipment perfect full‐compatible processor full load full‐magnetic controller complete mechanization full mechanization complex mechanizing complete operation all‐optical computer full‐programmable manipulator control full‐programmable manipulator control complete connected automaton complete derivative complete Fourier series finite induction perfect information complete integration of information processing complete assembly station complete robot programming complete reversibility complete table of states complete regulating algorithm complete circuit complete carry complete subquasi‐automaton entire system completeness full duty percentage by volume body force volume potential volume governor volumetric gas analyzer input‐output limited system preloaded failure rate prediction instruction prefetch predicting equation predictive control suppose v assume v premise preparation pretreatment dressing preconditioning pretreatment by robot preparation pretreatment dressing preconditioning preparation of robot use method of preparation preparatory signal preaccelerator pre‐operational [system] test pre‐operational [system] test prevent v preventive maintenance auxiliary storage location of IR foreground processing prerotation controller prerotation regulator phase advance phase lead leading element advance pulse lead advace angle predetermined pulse counter predetermined value stran 308 od 326 EN ‐DE: slovar avtomatizacije in robotike voreinstellen Voreinstellen Voreinstellung vorfertigen Vorfertigung Vorfilter Vorfilterung Vorfilterung Vorgabeimpuls Vorgang Vorgang Vorgangsaufbereitung Vorgangsdatei Vorgangskontrolle vorgangsorientierte Sprache vorgegebene Einstellung vorgegebene Robotertrajektor vorgegebener Parameter vorgegebener Roboter‐Arbeitszyklus vorgegebener Robotersollwert vorgegebenes Roboterprogramm vorgesehene Konstante vorgespannte Kippschaltung vorgespeicherte Information Vorgleichgewichtsprozess Vorhalt Vorhalteglied Vorhaltelement Vorhalt‐Element Vorhalteregelung Vorhaltezeit Vorhaltsgüte Vorhaltübertragungsfunktion Vorhaltverhalten Vorhaltzeit Vorhaltzeit bei D‐Wirkung Vorhaltzeitkonstante Vorhaltzeitkonstante f vorhergehender Modus vorhergehender Status vorherige Betriebsart vorheriger Status Vorhersagenetzwerk Vorhersagetheorie Vorimpuls Vorimpuls Vorinnendruck Vorinnendruck vorkritischer Zustand Vorkühlung Vorlagekonturen vorläufige Logik vorläufige Logikschaltung Vormontage (durch Roboter) vormontieren (durch Roboter) vormontierte Baugruppe Vor‐Ort‐Verarbeitung vorprogrammierbarer Kurvenpunkt Vorprogrammierung Vorprojektierung Vorprüfung Vorranganzeiger Vorrangfunktion vorranggerechte Verarbeitung vorranggestuftes Unterbrechungssystem Vorrangmeldung Vorrangmerkmal Vorrangprogramm Vorrangsteuerung Vorrangsteuerung Vorrangstruktur Vorrangunterbrechungssteuerung Vorrangverhältnis Vorrichtung Vorrichtung Vorrichtung preset v presetting preset adjustment prefabricate v prefabrication prefilter prefiltration preliminary filtration advance pulse event occurrence transaction editing transaction file checking of process transaction‐oriented language preset adjustment preset robot trajectory preset parameter preset robot working cycle preset robot nominal value preset robot program figurative constant biased flip‐flop prestored information pre‐equilibrium process derivative action derivative component leading element lead element derivative control differentiator time constant quality of prediction prediction transfer function derivative action rate time derivative action time rate time constant derivative time constant previous mode previous status previous mode previous status predictor network prediction theory preknock impulse prepulse prepressurization initial internal pressure precriticality precooling pattern contours preliminary logic preliminary logic sub‐assembly (by robot) pre‐assemble to (by robot) pre‐assembled assembly local processing preprogrammable curve point preprogramming preliminary design preliminary test priority indicateur priority function priority processing priority interrupt system priority feature priority feature priority program priority control advanced priority scheduling priority structure priority interrupt control priority relation jig fixture appliance stran 309 od 326 EN ‐DE: slovar avtomatizacije in robotike Vorrichtung device Vorrichtung facility Vorrichtung zum Transport von Teilen device for transport of parts Vorrichtung zur Beseitigung von Abfällen device for waste disposal Vorrichtung zur Wartung des Schweißwerkzeuges maintenance device for welding tool, fixture for maintenance o Vorrichtung zur Zuführung und Auswechselung von Werkzeu device for feeding and changing of tools Vorschaltkondensator series capacitor Vorschub feed[ing] Vorschubregelung machine feed control Vorschubregler feed controller Vorschubsteuerung advance control Vorschubwechsel feed change vorsortierte Montagelage presorted assembly position Vorspannungsregelung bias control Vorspannungswicklung bias winding vorsteuern pilot v Vorsteuerung anticipatory control Vorsteuerung pilot operation Vorstufe prestage Vorstufenmodulation low‐level modulation Vorteil der Montagesimulation simulation advantage, advantage of assembly simulation vorübergehend transient adj vorübergehende Abweichung transient deviation vorübergehende Regelabweichung dynamic error vorübergehende Regelabweichung transient deviation transient error signal vorübergehende Regeldifferenz vorübergehender Spannungsausfall momentary disappearance of line voltage Voruntersuchung preliminary investigation Vorverarbeitung von Sensorinformationen pretreatement of sensor informations Vorverarbeitung von Sensorinformationen pretreatment of sensor informations Vorverstärker head amplifier Vorverstärker preamplifier Vorversuch preliminary test Vorwähler preselector Vorwahlimpuls batch pulse Vorwahlzähler preset counter Vorwärtsdifferenz forward difference Vorwärtspfad forward channel Vorwärtspfad forward path Vorwärtssteuerungsglied forward controlling element Vorwärtsstrecke forward distance Vorwärtswirkung feedforward Vorwegänderungen premodifications Vorzeichenkontrollkreis algebraic sign control circuit vorzeichenlose ganze Zahl unsigned integer Vorzugsrichtung preferred direction Vorzugsrichtung feiner Robotermontage assembly‐preferred direction (of robot) v‐Schubbewegung v‐sliding movement waagerechte Greiferbewegung horizontal gripper movement waagerechter Roboterträger horizontal robot support Wähler option switch Wählimpuls dialling pulse Wahlschalter option switch wahlweise Modifikation optional modification wahlweise Modifikation selective modification optional facility wahlweise Zusatzeinrichtung wahlweiser Schutz selective protection wahlweiser Zusatz optional facility wahrer Wert true value wahrer Zustand true state wahres Ausgangssignal true output signal wahres Eingangssignal true input signal wahres Sperrsignal true inhibiting signal wahres Sperrsignal true disabling signal wahres Steuersignal true control signal Wahrheit true Wahrheitsfunktion truth function Wahrheitstabelle truth table Wahrnehmung perception Wahrnehmung von Teilen perception of pieces Wahrnehmungsmotorik perceptive motoric Wahrnehmungssystem (eines Roboters) perceptive system (of robot) wahrscheinliche Struktur probable structure wahrscheinlicher Fehler probable error Wahrscheinlichkeit probability Wahrscheinlichkeitsdichte probability density stran 310 od 326 EN ‐DE: slovar avtomatizacije in robotike Wahrscheinlichkeitsdichtefunktion Wahrscheinlichkeitsfunktion Wahrscheinlichkeitsgesetz Wahrscheinlichkeitsgesetz Wahrscheinlichkeitsintegral Wahrscheinlichkeitslogik Wahrscheinlichkeitsmaschine Wahrscheinlichkeitsmethode Wahrscheinlichkeitsrechnung Wahrscheinlichkeitstheorie Wahrscheinlichkeitsverteilung Wahr‐Sperrsignal Wahr‐Sperrsignal Walzenbearbeitung mit Roboter Wälzlager Wälzlagerfügen Wälzlagermontage durch Roboter Wandbefestigung "eines Roboters Wandler Wandler Wandler Wandler Wandlersystem Wandlung feines Roboterprogramms Wandmanipulator Ward‐Leonard‐Antrieb Wärmedurchflussmesser Wärmedurchgang wärmeempfindlicher Sensor Wärmeflussfernmessung Wärmekapazität Wärmekompensation Wärmekontrolle Wärmekontrolle Wärmekraft Wärmeleitfähigkeit Wärmeleitfähigkeit Wärmeleitfähigkeitsfernmessung Wärmeleitfähigkeitsmessgerät wärmeorientierter Sensor Wärmeprozess Wärmeregler Wärmeregler Wärmeregler Wärmestrahlungskoeffizient Wärmeträgheit Wärmeübergangsbeiwert Wärmeverlust Wärmevorgang Wärmewechselwirkung Wärmewirkungsgrad Warnanlage Warngerät Warngerät Wärnmtechnik Warnungsdiagnostik Warnungseinstellung Warnzeichen Warnzeichen Wartebedingung Wartebedingung Wartebedingung Wartemodus warten wartend Wartestelle Wartetheorie Wartezähler Wartezeit Wartezeitfaktor Wartezeitgleichung Wartezustand Wartezustand Wartezustand Wartezyklus Wartezyklus probability density function probability function low of probability probability low probability integral probabilistic logics probabilistic machine probability method probability calculation probability theory probability distribution true inhibiting signal true disabling signal roll machining with robot antifriction bearing jointing of antifriction bearing assembly of antifriction bearing by robot wall mounting of robot transmitter converter transducer transductor transducer system conversion of robot program wall manipulator Ward‐Leonard drive thermal flowmeter heat transfer heat‐sensitive sensor heat flow remote measurement heat capacity thermal compensation heat supervision thermal control thermal power heat conductivity thermal conductivity thermal conductivity measurement caloric conductibility measuring apparatus heat‐oriented sensor thermal process heat controller heating controller thermoregulator coefficient of heat radiation thermal inertia heat transfer coefficient heat loss thermal process thermal interaction heat effect alarm annunciator alarm monitor warning device heat engineering warning diagnostic alarm setting bell character bell character, BEL, bell wait condition wait state wait[ing] status waiting mode maintain v pending control station waiting theory wait counter latency time waiting time factor waiting time equation wait condition wait state wait[ing] status waiting cycle waiting loop stran 311 od 326 EN ‐DE: slovar avtomatizacije in robotike Wartung eines Manipulators manipulator servicing, manipulator maintenance Wartungseinrichtungen maintenance equipment Wartungseinrichtungen servicing equipment maintenance function test Wartungsfunktionstest Wartungshilfen maintenance aids Wartungskonsole enginee