EN-DE Automat-u-Roboter.xlsx

Сomentários

Transcrição

EN-DE Automat-u-Roboter.xlsx
 EN ‐DE: slovar avtomatizacije in robotike [elektrische] Eigenbedarfsanlage auxiliaires
[elektrische] Spannung
[elektronischer] Analogrechner
[gegenseitige] Verriegelung
[gegenseitige] Verriegelung
[harmonischer] Oszillator
[industrielles] Robotersystem
[kombiniertes] Dichte‐ und Feuchtemessgerät
[lineares] System mit konstanten Koeffizienten
[lineares] System mit konstanten Koeffizienten
[logisch‐]funktioneller Entwurf
[logische] Ausschließung
[logische] Einschließung
[mittleres] logarithmisches Energiedekrement
[numerischer] Algorithmus
[optischer] parametrischer Oszillator
[Pontrjaginsches] Maximumprinzip
[Pontrjaginsches] Maximumprinzip
[positive] Rückmeldung
[rechtwinklige] Kartesische Komponenten
[schematisches] Fließbild
[schematisches] Fließbild
[Shannonsches] Abtasttheorem
[ver]mengen
[ver]mengen
[ver]mengen
[‐Verhalten
1 R‐Typ
2‐Achse eines Industrieroboters
A L‐Blockstruktur
Abänderung eines Roboterprogramms
Abarten eines Programms
Abbauprozess
Abbautemperatur
Abbesche Sinusbedingung
Abbescher Sinussatz
Abbildung
Abbildungssystem
Abbildungstheorie
Abblasesystem
abbrechen
abbrechen
abbrechen
Abbremsung
Abbruch
Abbruch
Abbruch
Abbruchbedingung Abbruchreaktion
Abdeckplatte
Abelsche Integralgleichung
Aberrationskonstante
Aberregung
Abfallaufarbeitung mittels Roboters
Abfallberichtigung
Abfallbeseitigung mittels Roboters
Abfallgrenze
Abfallprodukt
Abfallsicherheitsfaktor
Abfallwert
Abfangmoment
Abfragebetrieb
Abfrageeinrichtung
Abfragefrequenz
Abfragefrequenz interrogation pulse 344
Abfrageimpuls
Abfrageordnung
Abfragepuffer
Abfrageregister
Abfragesteuerung
Abfragesystem
Abfragesystem mit Wiederholung
Abführoperation eines Industrieroboters
Abführungsgerät
Abgasanlage
abgearbeitet
auxiliary [electrical] system
voltage
[electronic] analog computer
blocking
interlock[ing]
oscillator
robot system, industrial robot system
density/moisture meter
constant‐coefficient system
[linear] system of constant coefficients
functional design
exclusion
inclusion
average logarithmic energy decrement
computational algorithm
[optical] parametric oscillator
maximum principle
Pontrjagin maximum principle
acknowledgement acknowledge, ACK, answerback
[rectangular] Cartesian components
process diagram
flow sheet
sampling theorem
blend v
mix v
mingle v
integral action
robot type, industrial robot type
Z‐axis of [industrial] robot
AL block structure
modification of robot program
varieties of program
decomposition process
breaking down temperature
Abbe's sine theorem
Abbe's sine theorem
mapping
image system
theory of mapping blow‐down system
interrupt v
break v
abort v
braking
interruption
break[ing]
abort
truncation condition terminating reaction
covering plate
Abel integral equation
aberration constant
deenergization
waste treatment by robot
droop correction
waste disposal by robot
critical limit
waste product
safety factor for drop‐out
rate of decrease
moment of interception
direct trunking
answering equipment
interrogation frequency
interrogation frequency
interrogation pulse
values inquest order
auxiliary feature
interrogation register
inquiry control
interrogation system
request repeat system
unloading operation of industrial robot
unloading device
exhaust gas plant
empty
stran 1 od 326
EN ‐DE: slovar avtomatizacije in robotike abgebbare Leistung
abgeglichene bipolare Schaltung
abgeglichene Brücke
abgeglichene Leitung
abgegrenzte Betriebsweise
abgekapptes Rauschen
abgekürzte Adressierung
abgelenkter Strahl
abgeschirmte Leitung
abgeschlossenes Intervall
abgeschnittenes Rauschen
abgestimmter Detektor abgestufter Spannungsteiler
abgetastete Werkstückkontur
abgetrennt
abgetrennt
Abgleich
Abgleichdetektor
Abgleicheinstellung
abgleichen
abgleichen
Abgleichkreis
Abgleichpotentiometer
Abgleichpunkt
Abgleichschaltung
Abgleichschaltung
Abgleichsignal
Abgleichsignal
Abgleichvorrichtung
Abgleichwiderstand compensation
Abgratroboter
Abgrenzungsmethode
abhängig verzögerter Selbstauslöser
abhängige Variable
abhängiger Prozessor
Abhängigkeitsfaktor
Abhebeformroboter
Abkappkreis
Abkappungsverstärker
abklingende Impulse
abklingende Schwingungen
abklingende Schwingungen
abklingende Sinusoide
abklingende Sinusschwingung
Abklingkonstante
Abklingkonstante
Abklingkonstante
Abklingkurve
Abklingkurve
Abklingperiode
Abklingzeit
Abkuppeln mittels Manipulators
Ablage von Werkstücken
Ablagemessung
Ablagemuster für IR (Werkstückordnung)
Ablagerung
Ablaßautomatik
Ablaufeigenschaft
Ablauffolgeprüfung
Ablauffolgesteuerung
Ablaufplanungsmodell
Ablaufplanungsmodell
Ablaufprogramm
Ablaufprogrammierung eines IR
Ablaufschema
Ablaufsteuerung
Ablaufsteuerung
Ablaufsteuerung
Ablaufsteuerung
Ablaufsteuerungsspeicher
Ablaufsteuerungsspeicher
Ablaufverfolgungsprogramm
Ablaufverfolgungsspeicher
Ablaufzeitpunkt
ablegen (Werkstück)
Ableitung
available power
balanced bipolar circuit
balanced bridge
balanced line
local mode
clipped noise
abbreviated addressing
deflected beam
shielded line
closed interval
clipped noise
tuned detector graded potentiometer
sampled contour
offline
autonomous
alignment
balance detector
balancing
balance v
match v
null circuit
balancing potentiometer
balance point
balancing circuit
incremental equivalent circuit
compensating action
compensation signal
incremental equivalent circuit
balancing resistance
deburring robot
determination method
inverse time‐lag circuit‐breaker
dependent variable
support processor, slave processor
control interaction factor
relieving form robot
clipper circuit
clipper amplifier
decaying pulses
convergent oscillations
damped oscillations
damped sinusoid
damped sinusoid
attenuation factor
damping coefficient
damping factor
damping curve
decay curve
damping period
decay time
manipulator coupling‐off
depot of s
distance difference measurement
depot sample for IR
deposit
outlet automatics
flowing property
sequence checking
sequence control
scheduling model
sequencing model
development program
trace programming of IR
operating schedule, flow diagram
operating control
run‐off control
series control
sequential control
development control memory
development control memory (store)
trace program
trace memory
expiry date
sack to (workpiece)
derivative
stran 2 od 326
EN ‐DE: slovar avtomatizacije in robotike Ablenkamplitude
Ablenkbarkeit
Ablenkempfindlichkeit
Ablenkempfindlichkeit
Ablenkfehler
Ablenkfeld
Ablenkpotentiometer
Ablenkspannung
Ablenksystem
Ablenkungseingriff
Ablenkungskoeffizient
Ablenkungskoeffizient
Ablenkungsmodulation
Ablenkungsmoment
Ablenkungssynchronisierung
Ablenkverstärker
Ablesefehler
Ablesefunktion
Ablesegenauigkeit
Ablesegerät
Ablösung durch Roboter
Abmessung der Zangengreifeinheit
Abmessung eines Greifers
Abnahme von Nennwerten der Bauelementeparameter
Abnahmeprüfeinrichtung
Abnahmeprüfeinrichtung
Abnahmeprüfung
Abnahmeversuch
abnehmende Schwingungen
abnehmende Schwingungen
abnehmende Zeitfunktion
Abnehmer betriebsbereit
abproduktfreie Technologie
abproduktfreier Prozess
Abrufbefehl
Abrufbefehl
Abruf‐Interruptsystem
Abrufphase
Abrufregister
Abrufsignal
Abruftechnik
Absackvorrichtung
Absaugmanipulator
Absaugvorrichtung
Abschaltcharakteristik einer Strombegrenzungssicherung
Abschaltelement
abschalten
Abschalten
abschalten
Abschalten
Abschalten
Abschalter
Abschalter
Abschaltgenauigkeit eines IR‐Schaltkreises
Abschaltleistung
Abschaltung
Abschaltung
Abschaltung
Abschaltungsbedingung
Abschaltverzögerung
Abschaltverzögerung
Abschaltzeit
Abschaltzeit
Abschätzung
Abschätzung
Abschlußimpedanz
abschneiden
Abschwächung
Abschwächung des Feldes
absichtlich eingeführte Nichtlinearität
Absinken der Leistung
absolut konvergent
Absolutassembler
absolute Adresse
absolute Aktivität
absolute Assemblersprache
maximum deflection
deflectability
deflecting sensibility
deflection sensitivity
deflection aberration
deflecting field
deflection potentiometer
deflecting voltage
deflection system
deflection action
deflection coefficient
deflection factor
deflection modulation
deflecting torque
deflection synchronization
deflection amplifier
error of reading
reading function
accuracy of reading
indicating instrument
detachment by robot
dimension of pincer
gripper dimension
component derating
acceptance checkout equipment
acceptance checkout equipment, ACE
acceptance test
acceptance test
convergent oscillations
damped oscillations
decreasing time function
acceptor operable, AO
waste‐free technology
waste‐free process
calling instruction
call statement
polling interrupt system
polling phase
call register
polling signal
polling technique
bagging machine
extraction manipulator of robot
suction fixture
cut‐off characteristic of a current‐limiting fuse
disconnection element
disconnect v
switching off
cut off v
trip out
tripping cut‐off
cut‐off switch
disconnection accuracy of IR circuit
breaking capacity
switching off
trip out
tripping cut‐off condition
shut‐down delay
opening delay
breaking time
turn‐off time
appreciation
evaluation
load impedance
cut off v
attenuation
field reduction
intentional nonlinearity
decay of power
absolutely convergent
absolute assembler
absolute address
absolute activity
absolute assembler language, AAL
stran 3 od 326
EN ‐DE: slovar avtomatizacije in robotike absolute Bewegung
absolute bolometrische Größe
absolute Dämpfung
absolute Digitalsteuerung
absolute Effektororientierung
absolute Effektororientierung absolute Effektorposition
absolute Empfindlichkeit
absolute Energieskale
absolute Feuchte
absolute Häufigkeit
absolute kartesische Koordinaten
absolute Kodierung
absolute Messmethode
absolute Stabilität
absolute Temperatur
absolute Temperaturskale
absolute Verzögerung
absolute Wahrscheinlichkeit
absolute Wärmetönung
absolute Zerfallsrate
Absoluteichung
absoluter Druck
absoluter Fehler
absoluter Feuchtegehalt
absoluter Index
absoluter Kode
absoluter Lader
absoluter Nullpunkt
absoluter Vektor
absoluter Wärmeeffekt
absoluter Wert
absoluter Wirkungsquerschnitt
absolutes Elektrometer
absolutes Format
absolutes Koordinatensystem
absolutes Laden
absolutes Maximum
absolutes Minimum
absolutes Programmieren
absolutes System
Absoluthöhenmesser
Absolutkoordinaten eines IR Absolutlader
Absolutmessverfahren
Absolutposition eines Manipulators
Absolutwertdarstellung
Absolutzähler
Absorber
Absorber
Absorber
absorbierbar
absorbieren
Absorbieren
Absorbieren
absorptiometrische Methode
Absorption
Absorption
Absorption durch Fotoeffekt
Absorptionsanalyse
Absorptionsapparat
Absorptionsapparat
Absorptionsapparat
Absorptionsäquivalent
Absorptionsband
Absorptionschromatografie
Absorptionseinheit
Absorptionsfähigkeit
Absorptionsfilter
Absorptionsfilter
Absorptionsfläche
Absorptionsfotometer
Absorptionsfrequenzmesser
Absorptionsgleichgewicht
Absorptionsgrad
Absorptionskante
absolute motion
absolute bolometric magnitude
absolute damping
absolute digital control
absolute effector orientation
absolute effector orientation
absolute effector position
absolute sensitivity
absolute energy scale
absolute humidity
absolute frequency
absolute Cartesian coordinates
absolute coding
absolute measuring method
absolute stability
absolute temperature
absolute temperature scale
absolute delay
absolute probability
absolute heating effect
absolute disintegration rate
absolute calibration
absolute pressure
absolute error
absolute moisture content
absolute index
absolute code
absolute loader
absolute zero
absolute vector
absolute heating effect
absolute value
absolute cross section
absolute electrometer
absolute format
absolute coordinate system
absolute loading
absolute maximum
absolute minimum
absolute programming
absolute system
absolute altimeter
absolute coordinates of IR
absolute loader
absolute measuring method
absolute position of manipulator
absolute value representation
absolute counter
absorber
absorbing apparatus
absorption apparatus
absorbable
absorb v
absorption
absorbing
absorption measuring method
absorption
absorbing
photoelectric absorption
absorption analysis
absorber
absorbing apparatus
absorption apparatus
absorption equivalent
absorption band
absorption chromatography
absorption unit
absorption capacity
absorbent filter
absorption filter
absorption plane
absorption photometer
absorption frequency meter
absorption equilibrium
absorption index
absorption edge
stran 4 od 326
EN ‐DE: slovar avtomatizacije in robotike Absorptionskoeffizient
Absorptionskreis
Absorptionskurve
Absorptionslinie
Absorptionsmedium
Absorptionsmesser
Absorptionsmodulation
Absorptionsprozess
Absorptionspunktschätzung
Absorptionsregelung
Absorptionsröntgenspektrum
Absorptionssättigung
Absorptionssäule
Absorptionssignal
Absorptionsspektralfotometer
Absorptionsspektrum
Absorptionsspitze
Absorptionssprung
Absorptionstechnik
Absorptionstemperatur
Absorptionstrockner
Absorptionsverfahren
Absorptionsvermögen
Absorptionsversuch
Absorptionswahrscheinlichkeit
Absorptionswellenmesser
absperren
absperren
Absperrventil
absstandsgetreue Impulse
Abstandsberichtigung
Abstandsdiskriminator
Abstandsfunktion
Abstandsmesser
Abstandssensor
absteigend
Abstellhebel für Automatik
Abstimmeinheit
abstimmen
abstimmen
abstimmen
abstimmen
Abstimmregelung Abstimmskale
Abstimmskale
Abstimmskale
Abstimmtafel Abstimmung
abstrakte Automatentheorie
abstrakte Rechenmaschine
abstrakte Theorie abstrakte Verbindung
abstrakte Zahl
abstrakter Automat
abstrakter Entwurf
abstrakter Kode
abstrakter Kode
abstrakter Wert
abstraktes Modell
abstraktes Typenkonzept
Abstraktion
Absuchen
Absuchen
Absuchen
Abszisse der absoluten Konvergenz
Abszissenachse
Abszissenachse
Abtast
Abtast
Abtastblock
Abtastblock
Abtasteinrichtung
Abtasten
Abtasten
Abtasten
abtastendes Laserradargerät
absorption coefficient
absorption circuit
absorption curve
absorption line
absorbing medium
absorptiometer
absorption modulation
absorption process
last‐event estimator
absorption control
absorption spectrum of X‐rays
absorption saturation
absorption column
absorption signal
absorption spectrophotometer
absorption spectrum
absorption peak
absorption discontinuity
technology of absorption
absorbing temperature
absorption dehumidifier
absorption process
absorption capacity
absorption experiment
absorption probability
absorption wavemeter
close v
bar v
stop valve
equispaced pulses
range correction
range discriminator
metric
position finder
distance sensor
descending
disconnecting lever for mechanism
adjusting device
adjust v
align v
tune v
trim v
tuning control regulation scale
tuning scale
tuning dial
tuning board setting
abstract theory of automata
abstract computer
abstract theory of automata
abstract connection
abstract number
abstract automaton
abstract design
abstract code
pseudo‐code
abstract value
abstract model
abstract type concept
abstraction
balayage
scanning
exploration
abscissa of absolute convergence
abscisse axis
X‐axis
sample
sampling
scanner
scanning unit
sampler
balayage
scanning
exploration
scanning laser radar
stran 5 od 326
EN ‐DE: slovar avtomatizacije in robotike Abtaster
Abtaster
Abtaster
Abtastgeschwindigkeit
Abtastgeschwindigkeit
Abtastgeschwindigkeit durch Sensoren
Abtastglied
Abtastglied
Abtastglied
Abtastglied
Abtastglied
Abtasthalteglied
Abtastimpuls
Abtastintervall
Abtastkreis
Abtastoszillograf
Abtastperiode
Abtastphase
Abtastpunkt
Abtastrate
Abtastregelsystem
Abtastregelung
Abtastregelung
Abtastregelung
Abtastregelung
Abtaströntgenstrahlmikroanalysator
Abtastsensor
Abtastservosystem
Abtastsignaleingang
Abtastspannung
Abtastspektrometer
Abtaststromkreis
Abtastsystem
Abtastsystem mit stochastischen Eingaben
Abtastung
Abtastung
Abtastung mit hoher Geschwindigkeit
Abtastung mit konstanter Geschwindigkeit
Abtastverfahren
Abtastvorgang
Abtastwerte
Abtastzeit
Abtastzeit
Abtastzeit
Abtastzeitintervall
Abtastzyklus
Abtrennanzeige
Abtrennung (durch Roboter)
abweichen
abweichende Grunddatei
Abweichung
Abweichung
Abweichung des Greifzentrums
Abweichung vom Sollwert
Abweichung vom Sollwert
Abweichungsamplitude
Abweichungsanzeiger
Abweichungsfläche
Abweichungsgröße
Abweichungsmesser
Abweichungsverhältnis
Abweichungsverhältnis
Abweichungsverhältnis bei Manipulation von Teilen
Abweichungsverhältnis bei Simultanbewegungen
abzählbare Menge
abzählbare Menge
Abzweigen
Abzweigen (Bewegen eines HHO)
Achsantrieb eines Industrieroboters
Achsenbezeichnung
Achseneinstellung
Achsenposition
Achsenregelung
achsensymmetrisch
Achsgeschwindigkeit
Achskombinationen eines Industrieroboters
sampler
scanner
scanning unit
sampling rate
scanning speed
scanning speed by sensors
detector element
sampler
sensing element
sensor
detector
sample‐and‐hold element
reading pulse
sampling interval
sampling circuit
sampling oscillograph
sampling period
sweep phase action spot
sampling rate
sampled‐data control system
sampled‐data control
sampled‐data control system
sampling control
scanning control
scanning X‐ray microanalyzer
scanning sensor
sampling servosystem
scanning signal input
scanning voltage
scanning spectrometer
scanning circuit
scanning system
random input sampled‐data system
sampling
sampling [action]
high‐velocity scanning
constant‐speed scanning
scanning technique
scanning action
sampled data
sampling period
sampling time
scanning time
sampling period
scanning cycle
disconnect indication
dissociation (by robot)
offset v
different basic file
offset
drift
deviation of gripping centre
deviation from nominal (ordered) value
deviation from nominal value
deviation amplitude
deviation indicator
deviation area
deviation value
deviometer
deviation ratio
offset ratio
deviation ratio at manipulation of parts
deviation ratio at simultaneous movements
countable set
enumerable set
branching
branching (movement of handling object)
axis drive of industrial robot, robot axis drive
marking of axis
axial adjustment
axis position
axial adjustment
axisymmetric
axle speed
robot axis combinations, axis combinations of industrial robot
stran 6 od 326
EN ‐DE: slovar avtomatizacije in robotike Achsregelung
Achsregelungsstruktur
Achswirkungslinie
Achterkreis
Achterkreis
Achterstromkreis double
Achterstromkreis double
Adapter
Adapter für asynchrone Datenübertragung
Adapter für asynchrone Datenübertragung
Adapter für asynchrone Datenübertragung
Adapter für Fernabfrageeinheit distance
Adapter für gepufferte Übertragung
Adapter für gepufferte Übertragung
Adapter für Thermoelemente
Adapter für Widerstandsgeber
adaptive differentielle Pulskodemodulation
adaptive differentielle Pulskodemodulation
adaptive digitale Schaltung
adaptive Handhabung
adaptive Maschine
adaptive Optimalfilterung
adaptive Optimierung adaptive Regelung
adaptive Regelung
adaptive Robotersteuerung
adaptive Schwellwertelemente
adaptive Sensorführung
adaptive sensorgeführtes System
adaptive Steuerung
adaptive Steuerungsoptimierung
adaptive Steuerungsoptimierung
adaptive Vorverzerrung
adaptiver Ausgleich
adaptiver Ausgleich
adaptiver Greifkopf
adaptiver Leitweg
adaptiver lernender Regler
adaptiver Prozess
adaptiver Roboter
adaptiver robotertechnischer Komplex
adaptiver Schweißroboter
adaptiver sensorgeführter Roboter
adaptiver Steuerprozess
adaptiver Umformer des lernenden Systems
adaptiver Zeichenleser
adaptives digitales Element
adaptives digitales Element
adaptives digitales Netzwerk
adaptives Glied
adaptives Lernsystem
adaptives Modell
adaptives Regelsystem
adaptives Regelsystem
adaptives Regelungssystem
adaptives Regelungssystem
adaptives Robotersystem
adaptives sensorgeführtes System
adaptives System
adaptives System
adaptives Verhalten
adaptives Verhalten von Handhabungssystemen
adaptives Verhalten von Handhabungssystemen
Adder
Adder
Adder
Addierkreis löherer Ordnung
Addierstufe
Addierwerk
Addierwerk
Addierwerk
Additionsbefehl
Additionsgatter
Additionsimpuls
Additionsstelle
Additionsstelle
axis regulation
axis regulation structure
action line of axis
double phantom circuit
superphantom circuit
double phantom circuit
superphantom circuit
adapter
asynchronous communications interface adapter, AC1A
asynchronous communications interface adapter
ACIA
remote inquiry unit adapter
buffered communication adapter
buffered communication adapter, BCA
thermocouples adapter
resistance transmitters adapter
adaptive differential pulse code modulation
ADPCM
adaptive digital network
adaptive manipulation
adapting machine
adaptive optimum filtration
adaptive control optimization
actuator adaptive control system
adaptive control system
adaptive robot control
adaptive threshold elements
adaptive sensor guide
adaptive sensor‐guided system
adaptive control
adaptive control optimization
adaptive control optimization, ACO
adaptive predistortion
adaptive equalization
adaptive equalization, AEQ
adaptive grip head
adaptive routing
adaptive learning controller
adaptive process
adaptive robot
adaptive robot‐technical complex
adaptive welding robot
adaptive sensor‐guided robot
adaptive control process
adaptive converter of learning system
adaptive character reader
adaptive digital element
adaptive digital element, AD‐DIE
adaptive digital network
adaptive element
adaptive learning system
adaptive model
adaptive control system
self‐adjusting system
actuator adaptive control system
adaptive control system
adaptive robot system
adaptive sensor‐guided system
adaptable system
adaptive system
adaptive behavior
adaptive behavior of manipulation systems
adaptive behaviour of manipulation systems
adder
adding element
summator
high‐order add circuit
addition cascade
adder
adding element
summator
add instruction
add gate
add impulse
adder stage
adder
stran 7 od 326
EN ‐DE: slovar avtomatizacije in robotike Additionsstelle
Additionsstelle
Additionsstelle
Additionstheorem
Additionstor
Additionsübertrag
Additionszeit
additive Größe
additive Gruppe
additive Inverse
additive Mischstufe
additive Mischung
additive Wirkung
Additivitätseigenschaft
Additivkreis
Additivverfahren
Adhäsionsbeiwert
adiabatische Äquivalenztemperatur
adiabatischer Prozess
adiabatischer Sättigungsprozess
adiabatisches Verfahren
adjungiert
adjungierte Matrix
adjungierte Rechentechnik
adjungiertes System
adjungiertes System
Adjustierung
Adjustierung
Admittanz
Adress[ier]leitung
Adressauswertung
Adressbereich
Adressbuchstabe eines IR‐Programms
Adreßbus eines Rechners
Adresse
Adresse eines Mikroprogrammspeichers
Adressenabtastimpuls
Adressenabtastimpuls
Adressenabtastimpuls
Adressenänderung
Adressenausdruck
Adressenberechnung
Adressenberechnung
Adressenbildung
Adressenbildung
Adressenfeld
Adressenformat
Adressenhauptlinie
Adresseninkrementregister
Adressenkode
Adressenkode
Adressenkonstante
Adressenlöser
Adressenrechenwerk
Adressenrechenwerk
Adressenrechnung
Adressenrechnung
Adressenregister
Adressenregister
Adressenregister
Adressensprache
Adressensubstitution
Adressenteil im Befehlswort
Adressenteil im Befehlswort
Adressenwahlschalter
Adressenzahl
Adresserzeugung
adressierbarer Speicher
adressierbarer Speicher
adressierbarer Steuerungsbaustein
adressierbarer Zwischenspeicher
adressierbares Auffangregister
Adressiermaschine
Adressiersystem
adressierte Einrichtung
adressierter DAM‐Baustein
adding element
counting stage
summator
addition theorem
add gate
add carry
add time
additive quantity
additive group
additive inverse
additive circuit
additive mixing
additive action
additivity property
additive circuit
additive process
adhesion coefficient
adiabatic equivalent temperature
adiabatic process
adiabatic saturation process
adiabatic process
adjoint
adjoint matrix
adjoint computing technique
ad joint system
adjoint system
adjustment
adjusting
admittance
address line
address evaluation
address range
address letter of IR‐program
computer address bus
address
microprogram memory (store) address
address data strobe, ADS, address reading pulse
address data strobe
address reading pulse
address modification
address expression
address calculation
address computation
address calculation
address computation
address array
address format, AFR
address main line
index register
address code
address part
address constant, ADCON
address decoder
address arithmetic[al] element
address arithmetical element
address calculation
address computation
address register
base register
index accumulator
address language
address substitution
address code
address part
address selection switch
address number
address generation
addressable memory
addressable store
addressable control module
addressable latch
addressable latch
addressing machine
addressing system
addressed device
addressed DAM‐element
stran 8 od 326
EN ‐DE: slovar avtomatizacije in robotike Adressierungskonzeption
Adressierungsvermögen
Adressrechner
Adresssignalverzögerungszeit
Adressverzögerungszeit
Adsorptionserscheinung
Adsorptionsmessung
Adsorptionsprozess
Adsorptionstrocknungsanlage
Adsorptionsverfahren
Adsorptionsvorgang
Adsorptionswirkungsgrad
aerodynamische Eigenschaften Aggregation
Aggregationsoperator
Aggregationsoperator
ähnliche Transformation
Ähnlichkeit
Ähnlichkeit
Ähnlichkeit
Ähnlichkeitsbedingungen
Ähnlichkeitsbedingungen
Ähnlichkeitsregel
Ähnlichkeitstheorie
Ähnlichkeitstransformation
Aiken‐Kode Aitkensche Interpolationsmethode
Akkumulation
Akkumulationskoeffizient
Akkumulatorregister
akkumulieren
akkumulierter Fehler
akkumulierter Fehler
Akteur
Aktinograf
Aktinometer
Aktion
Aktionsakzeptor
Aktionsfeld
Aktionspotential
Aktionssystem
Aktionszentrum
aktiv gekoppelt
Aktivator
aktive Datei
aktive Druckrückführung
aktive Führung
aktive Führung
aktive Kontrolle
aktive Ziellenkung
aktive Ziellenkung
aktiver Datensatz
aktiver Fügemechanismus
aktiver Fügemechanismus in
aktiver Laserkursverfolger
aktiver Prozess
aktiver Satellit
aktiver Sensor
aktiver Stromkreis
aktiver Teilnehmer
aktiver Wandler
aktiver Wandlern?
aktiver Wellenleiter
aktives Ausgabegerät
aktives Eingabegerät
aktives Element
aktives Filter
aktives Glied
aktives Kreuzgelenk
aktives Laserkursfolgesystem
aktives Lasermedium
aktives Magazin
aktives optisches Element
aktives Robotergelenk
aktives System
aktives Ultrarotstrahlenerfassungssystem
addressing concept
address capability
address computer
address delay time
address delay time
adsorption phenomenon
adsorption measurement
adsorption process
adsorption dehumidification system
adsorption process
adsorption phenomenon
adsorption efficiency
aerodynamic properties aggregation
aggregation operator
aggregator
similarity transformation
conformity
similitude
similarity
similarity conditions
similitude conditions
law of similarity
law of similarity
similarity transformation
Aiken code Aitken's interpolation method
accumulation
accumulation coefficient
accumulator register
accumulate v
accumulated error
stored error
joint, acting element
actinograph
actinometer
action
action acceptor
action field
action potential
action system
action centre
actively coupled
activator
active file
active pressure feedback
active guidance
active homing
active check
active guidance
active homing
active data record
active joint mechanism
active joint mechanism
active laser tracking system
awake process
active satellite
active sensor
active circuit
active abonent
active transducer
active transducer
active waveguide
active output device
active input device
active element
active filter
active element
active swivel joint
active laser tracking system
[active] laser medium
active magazine
active optical component
active robot joint
active system
active infrared detection system
stran 9 od 326
EN ‐DE: slovar avtomatizacije in robotike aktivieren
Aktivierung
Aktivierungsanalyse
Aktivierungsausbeute
Aktivierungsdetektor
Aktivierungsenergie
Aktivierungsgeschwindigkeit
Aktivierungsintegral
Aktivierungsmechanismus
Aktivierungswärme
Aktivitätsabfall
Aktivitätsanalyse
Aktivitätseinheit
Aktivitätskoeffizient
Aktivitätskurve
Aktivitätsmessung
Aktivitätsniveau
Aktivitätsniveau
Aktivitätsniveau
Aktivitätspegel
Aktivitätspegel
Aktivitätspegel
Aktivitätsverteilung
Aktivsender
Aktivspeicher
Aktivwandler
Aktorik
Aktualparameter
aktuelle Effektorposition
aktuelle Gelenkwinkel von Roboterkoordinaten
aktuelle Robotergerätedaten pl
aktueller Manipulatorzustand
aktueller Orientierungsvektor
aktueller Parameter
aktueller Parameterbereich
aktueller Parameterbereich
aktueller Roboter
aktueller Roboterzustand
aktueller Systemzustand
aktuelles Robotermodell
aktuelles Roboterprogramm
akustische Brücke
akustische Eichvorrichtung
akustische Größe
akustische Kommunikation
akustische Programmierung
akustische Rückkopplung
akustische Signalerfassung
akustische Übertragung
akustische Verzögerungsleitung
akustische Verzögerungsleitung
akustische Verzögerungsstrecke
akustische Verzögerungsstrecke
akustische Vibrationen akustische Warnanlage
akustische Warnvorrichtung
akustischer Ablenkkreis
akustischer Aufnehmer
akustischer Höhenmesser
akustischer Höhenmesser
akustischer Kanal
akustischer Koppler
akustischer Laufzeitspeicher
akustischer Sensor
akustischer Sensor (Aufnehmer)
akustischer Speicher
akustischer Speicher
akustischer Speicher
akustisches Bild
akustisches Echolot
akustisches Erkennungssystem
akustisches Erkennungssystem
akustisches Interferometer
akustisches Programmieren
akustisches Radiometer
akustisches Rechnersignal
activate v
activation
activation analysis
activation yield
activation detector
activation energy
activation speed
activation integral
activation machanism
activation heat
activity decay
activity analysis
activity unit
activity coefficient
activity curve
activity measurement
activity level
level of activity
level of process
activity level
level of activity
level of process
activity distribution
active transducer
active store
active transducer
actorics
actual parameter
actual effector position
actual joint angles of robot coordinates
actual robot device data
actual manipulator state
actual orientation vector
actual parameter
actual parameter area
actual parameter area, APT
actual robot
actual robot state
actual system state
actual robot model
actual robot program
acoustic bridge
acoustic calibrator
acoustic quantity
acoustic communications
acoustic programming
acoustic feedback
acoustic signal acquisition
acoustic transmission
acoustic delay line
sonic delay line
acoustic delay line
sonic delay line
sonic vibrations aural warning device
aural warning device
acoustic deflection circuit
acoustic sensor
acoustic altimeter
echo altimeter
acoustical channel
acoustic coupler, ACU
acoustic delay line memory
acoustic sensor
acoustic sensor
acoustic memory
acoustic storage
acoustic store
acoustic image
acoustic altimeter
acoustic identification system
acoustic indentifaction system
acoustical interferometer
acoustic programming
acoustic radiometer
acoustic computer signal
stran 10 od 326
EN ‐DE: slovar avtomatizacije in robotike akustisches Relais
acoustic relay
akustisches Signal
acoustic signal
acoustic overload signal
akustisches Überlastsignal
akustisch‐phonetische Verarbeitung
acoustic‐phonetic processing
Akustooptik
acoustooptics
akustooptisch
acoustooptic[al]
akustooptische Signalverarbeitung
acoustooptic signal processing
akustooptische Wechselwirkung
acoustooptic interaction
akustooptischer Effekt
acoustooptic effect
akustooptischer Modulator
acoustooptical modulation device
akustooptischer Modulator
acoustooptical modulator
akustooptisches Ablenkungsgerät
acoustooptical deflection device
akustooptisches System
acoustooptic system
akzeptabel
acceptable
acceptable design
akzeptabler Entwurf
Akzeptanzdiagramm
acceptance pattern
Akzeptanzwinkel
acceptance angle
acceptable limit
akzeptierbarer Grenzwert
Akzeptierbarkeitskriterium
acceptability criterion
akzeptieren
accept v
Akzeptor
acceptor
Akzeptor betriebsbereit
acceptor operable, AO
Akzeptorendichte
acceptor density
Akzeptorfehler
acceptor error, AE
Akzeptorniveau
acceptor level
Alarmanlage
alarm circuit
Alarmanlage
alarm set
Alarmeinrichtung
alarm annunciator
Alarmgerät
alarm device
Alarmkontakt
alarm contact
Alarmprogramm
alarm program
Alarmrelais
alarm relay
Alarmzustand
alert condition
Algebra der Logik
algebra of logic
Algebra der Logik
Boolean algebra
algebraische Addiereinrichtung
algebraic adder
algebraische Auswahlmethode
algebraic selection method
algebraische Automatentheorie
algebraic automaton theory
algebraische Funktion
algebraic function
algebraische Gleichung höheren Grades
algebraic equation of higer degree
algebraische Struktur
algebraic structure
algebraic sum
algebraische Summe
algebraische Summe der Impulse
algebraic sum of impulses
algebraischer Addierer
algebraic adder
algebraischer fehlerkorrigierender Kode
algebraic error‐correcting code
algebraisches Komplement
algebraic complement
algebraic product
algebraisches Produkt
algebraisches Stabilitätskriterium
algebraic stability criterion
Algorithmentheorie
algorithm theory
algorithmisch
algorithmic
algorithmische Ausarbeitung
algorithmic elaboration
algorithmische Betätigung
algorithmic manipulation
algorithmische Minimisierung
algorithmic minimizing
algorithmische Minimisierung algorithmisch orientierte Spracalgorithmic minimizing
algorithmische prozedurale Sprache
algorithmic procedural language, APL
algorithmische Sprache
algorithmic language
algorithmische Unlösbarkeit
algorithm insolubility
algorithmisches System
algorithmic system
Algorithmus
algorithm
Algorithmus für arithmetische Operation
algorithm for arithmetic operation
Algorithmus für die Inversion
algorithm for the inversion
Algorithmus für Division
algorithm for division
Algorithmus für Division
division algorithm
Algorithmus für quadratische Interpolation
algorithm for quadratic interpolation
Allbetriebregler multiples Analogrechner
all‐purpose controller
Allbetriebregler multiples Analogrechner
all‐regime controller
exclusive access
alleiniger Zugriff
allgemeine Anwendung in der Automatisierung
general application in automation
allgemeine Lösung
general solution
allgemeine Prozesstheorie
overall process theory
allgemeine Reaktorgleichung
general reactor equation
allgemeines Diagramm
general chart
allgemeines Maschinenprogramm
general machine program
allgemeines Programm
general routine
allgemeines Programm
general program
allgemeines Rücksetzsignal
master reset signal
stran 11 od 326
EN ‐DE: slovar avtomatizacije in robotike allgemeines Überwachungsprogramm
Allpassfilter
Allpassfilter
Allpassglied
Allpassglied
Alltypsensorsteuerung
Allzweckmesser
Allzweckmesser
Allzweckrechner
Allzweckregler
Allzweckregler
Alphabet
alphabetische Information
alphabetischer Kode
alphabetisches Kundeninformationssystem
alphabetisches Zeichen
alphanumerisch
alphanumerisch kodierte geometrische Information
alphanumerische Anzeigeeinheit
alphanumerische Ausgabe
alphanumerische Darstellung
alphanumerische Daten pl
alphanumerische Tastatur
alphanumerischer Leser
alphanumerischer Speicher
alphanumerisches Kodieren
alphanumerisches Sichtanzeigegerät
alphanumerisches Verschlüsseln
alphanumerisches Zeichen
AL‐Programmiersystem
alternativ
Alternativadresse
Alternative
alternative Manipulatoranordnung
alternative Maschinenanordnung
alternative Maschinenordnung
alternative Montagelösung
alternative Montageoperation
alternative Roboteranordnung
alternativer Teilebaum
alternativer Übertragungsweg
alternativer Übertragungsweg
alternativer Werkstücktransportweg
Alternativkanal
Alternativverzweigung
alternierende Reihen
alternierendes Verhalten
AL‐Typendeklaration
ALU
ALU
ALU‐Betriebsart
ALU‐Funktionswahl
AL‐Verzweigung
amerikanische Norm
amerikanischer Standard
amerikanischer Standardkode für Informationsaustausch
amerikanischer Standardkode für Informationsaustausch
Amortisationszeit (bei Roboteranwendung)
ampassungsfähige Rechnerstruktur
Amphibienroboter
Amplidyne
Amplidynservosystem
Amplistatverstärker
Amplitude
Amplitude am Ausgang
Amplitude der effektiven Erregerstromdichte
Amplitudenanalysator
Amplitudenanalysator‐Baugruppe
Amplitudenanalysator‐Baugruppe
Amplitudenanalyse
Amplitudenanalyse
Amplitudenbedingung
Amplitudenbegrenzer
Amplitudenbegrenzer
amplitudenbegrenzter Ausgang
amplitudenbegrenzter Eingang
general monitor checking routine
all‐pass filter
all‐pass element
all‐pass filter
all‐pass element
all‐type sensor control
all‐purpose meter
multimeter
general‐purpose computer
all‐purpose controller
all‐regime controller
alphabet
alphabetic information
alphabetic code
alphabetic customer's information system
alphabetic character
alphanumeric
alphanumeric‐coded geometric information
alphanumeric indicating unit
alphanumeric output
alphanumeric representation
alphanumeric data
alphanumeric keyboard
alphanumeric reader
alphanumeric store
alphameric coding, alphanumeric coding
alphanumeric display
alphameric coding, alphanumeric coding
alphanumeric character
AL programming system
alternative adj
alternative address
alternative
alternative manipulator arrangement
alternative machine arrangement
alternative machine order
alternative assembly solution
alternative assembly operation
alternative robot arrangement
alternative piece tree
alternate route
alternate route, ARU alternating contact
alternative transport route
alternative channel
alternative branching
alternating series
alternating behaviour
AL type declaration
arithmetic‐logic unit
ALU
operation mode of arithmetic‐logic unit, ALU‐mode of operatio
ALU‐function selection, function selection of arithmetic‐logic u
AL branching
American standard
American standard
American standard code of information interchange
ASCII
amortization time (at robot application)
adaptive architecture
amphibian robot
amplidyne
amplidyne servosystem
amplistat
amplitude
output amplitude
effective driving‐current density amplitude
amplitude analyzer
amplitude analyzing assembly
pulse height analizing assembly
amplitude analysis
pulse amplitude analyzing
root‐locus amplitude (magnitude) condition
peak limiter
clipper circuit
bounded output
bounded input
stran 12 od 326
EN ‐DE: slovar avtomatizacije in robotike Amplitudenbegrenzung
Amplitudencharakteristik
Amplitudencharakteristik
Amplitudendichte‐Spektrum
Amplitudendiskriminator
Amplitudeneinstellung
Amplitudenfaktor
Amplitudenfehler
Amplitudenfernmesssystem
Amplitudenfrequenzentzerrung
Amplitudenfrequenzspektrum
Amplitudengang
Amplitudengang
Amplitudengang
Amplitudengeräuschbegrenzer
Amplitudenkennlinie
Amplitudenkennlinie
Amplitudenkennlinie
Amplitudenlinearität
Amplitudenmodulation
amplitudenmodulierte Schwingungen
amplitudenmodulierter Geber
amplitudenmodulierter Impuls
amplitudenmodulierter Sender
amplitudenmodulierter Signalverfolger
amplitudenmodulierter Träger
Amplitudenniveau
Amplitudennormierungsfaktor
Amplituden‐Phasen‐Charakteristik transfert
Amplitudenrand
Amplitudenreserve
Amplitudenreserve
Amplitudenresonanz
Amplitudenschnittfrequenz
Amplitudenschwankung
Amplitudenskalierungsfaktor
Amplitudenspektrum
amplitudenstabilisierter Laser
Amplitudenvektor
Amplitudenverteilung Amplitudenverzerrung
Amplitudenverzerrung
Amplitudenverzerrung
Amplitudenverzögerung
Amplitudenwähler
Analog
analog arbeitender Sensor
analog arbeitender Sensor
Analog‐ Digital‐Umsetzer
analogarbeitender Prozessrechner
Analogausgabebasis
Analogdarstellung
Analogdaten pl
analog‐digitale Simulation
analog‐digitale Simulation
Analog‐Digital‐Konverter
Analog‐Digital‐Schleife
Analog‐Digital‐Schleife
Analog‐Digital‐Technik
Analog‐Digital‐Umwandlung
Analog‐Digital‐Wandler
Analog‐Digital‐Wandler
analoge Ausgabe
analoge Darstellung
analoge Darstellung
analoge Eingabe
analoge Gerätetechnik
analoge Größe
analoge mathematische Simulation
analoge Messung
analoge Punkt‐Punkt‐Steuerung
analoge Punkt‐Punkt‐Steuerung
analoge Rechentechnik
analoge Rechnereingabe
analoge Rechnereingabe
analoge Schaltung
amplitude limitation
amplitude characteristic
amplitude response
amplitude‐density spectrum
amplitude discriminator
amplitude adjustment
amplitude factor
amplitude error
amplitude telemetering system
amplitude‐frequency correction
amplitude‐frequency spectrum
amplitude response
magnitude plot
Bode diagram
amplitude noise limiter
amplitude locus
amplitude characteristic
amplitude response
linearity in amplitude
amplitude modulation
amplitude‐modulated oscillations
amplitude‐modulated transmitter
amplitude‐modulated pulse
amplitude‐modulated transmitter
amplitude‐modulated signal tracer
amplitude‐modulated carrier
amplitude level
amplitude scale factor
gain‐phase characteristic
amplitude margin
gain margin
amplitude margin
amplitude resonance
gain cross‐over frequency
fluctuation of amplitude
amplitude scale factor
amplitude spectrum
amplitude‐stabilized laser
amplitude vector
amplitude distribution
amplitude distortion
harmonic distortion
waveform distortion
amplitude delay
amplitude selector
analog[ue]
analog‐active sensor
analogue‐active sensor
analog‐digital converter
analog process computer
analogue output basis
analog display
analog data
analog‐digital simulation
analognumerical simulation
analog‐digital converter
analog‐digital loop
analogue‐digital loop
analog‐digital technique
analog‐digital conversion
analog‐to‐digital converter
analog‐digital converter
analog output
analog display
analog representation
analog input
actual hardware system simulation
analogue quantity
analog mathematical simulation
analog measurement
analog point‐to‐point control
analogue point‐to‐point control
analog computing technique
computer analog input
computer analogue input, CAI
analog circuit
stran 13 od 326
EN ‐DE: slovar avtomatizacije in robotike analoge Verarbeitungseinheit
analoge Verarbeitungseinheit
Analogeingabepunkt
Analogeinheit
Analogeinrichtung mit leitendem Medium
Analogelement
Analogelement
analoger Detektor
analoger Eingabe‐Abtaster
analoger Eingabe‐Abtaster
analoger Kode
analoger Prozessor
analoger Prozessor
analoger Prozessrechner
analoger Regler
analoger Regler
analoger Schalter
analoger Schatter
analoges Eingabeabtastglied
analoges Eingabeabtastglied
analoges Extremalsystem
analoges Modell
analoges Signal
analoges Signal für Robotersteuerung
Analoggröße
Analogie
Analogieinterpolation
Analogierechenmaschine
Analogiestudie
analogische Größe
Analogkanal
Analogkanal
Analogkomparator
Analogkorrektur
Analogmodell
Analogmodulation
analognumerische Nachbildung
analognumerische Nachbildung
Analogrechentechnik
Analogrechner‐Simulation
Analogregelung
Analogschalter
Analogschalter
Analogschaltung
Analogschnittstelle
Analogsteuerung
Analogstromkreis
Analogtechnik
Analogübertragung
Analogübertragung
Analogumwandler
Analogumwandler
Analogvergleicher
Analogverstärker
Analysator für integrierte Schaltungen
Analyse
Analyse der Teilepassungen
Analyse der Teilepassungen
Analyse eines digitalen Systems mit einem Rechner
Analyse fvon Maschinendefekten
Analyse geometrischer Objekte
Analyse instationärer Vorgänge
Analyse von Manipulatordefekten
Analyse von Maschinendefekten
Analyse von Regelungs‐ und Steuerungssystemen
Analyse von Roboterdefekten
Analysengerät
Analysengerät
analysieren
analysieren
analytisch
analytisch
analytische Beziehung
analytische Datenreflexion
analytische Funktion
analytische Methode
analog processing unit
analogue processing unit
analogue input point
analog unit
conductive medium of analog device
analog element
analogue element
analog detector
analog input scanner
analogue input scanner, AIS
analog code
analog processor
analogue processor
analog process computer
analog controller
analog regulator
analog switch
analogue switch
analog input scanner
analogue input scanner, AIS
analog extremal system
analog model
analog signal
analogue signal for robot control
analog quantity
analogy
analog interpolation
[electronic] analog computer
analog study
analog quantity
analog channel
analogue channel
analog comparator
analog correction
analog model
analog modulation
analog‐digital simulation
analognumerical simulation
analog computing technique
analog computer simulation
analog control
analog switch
analogue switch
analog circuitry
analog interface
analog control
circuit analog
actual hardware system simulation
analog transmission
analogue transmission, ATR
analog converter
analogue converter
analog comparator
analog amplifier
integrated circuit analyzer
analysis
piece fit analysis
piece adjusting analysis
computer‐aided digital system analysis
machine defect analysis
analysis of geometric objects
transient response analysis manipulator defect analysis
machine defect analysis
analysis of control system
robot defect analysis
analyser
analyzer
analyse v
analyze v
analytic[al]
regular
analytic relationship
analytical data reflection
analytical function
analytic method
stran 14 od 326
EN ‐DE: slovar avtomatizacije in robotike analytische Regelung
analytische Simulation
analytische Steuerung
analytische Struktur
analytische Untersuchungsmethode
analytischer Ausdruck
analytischer Entwurf
analytisches Hochfrequenzmessverfahren
analytisches Verfahren
anamorphotisches Abbildungssystem
anbefohlener Übertrag
ändern
Änderung
Änderung des Bauteilparameters
Änderungsausfall
Änderungsgeschwindigkeit
Änderungshäufigkeit
Anfahrbetrieb
Anfahren und Speichern (IR‐Programmierverfahren)
Anfahren von Regelkreisen
Anfahrfilter
Anfahrinstrumentierung
Anfahrprüfung
Anfahrrampe
Anfahrtransiente
Anfahrverhalten
Anfangs
Anfangsadresse
Anfangsaufnahmefähigkeit
Anfangsauswahlfolge
Anfangsautomat
Anfangsbedingungen
Anfangsbedingungen
Anfangsbedingungen ungleich Null
Anfangsdaten pl
Anfangseinstellung
Anfangsgeschwindigkeit
Anfangsgeschwindigkeit
Anfangspunkt (einer Greiferbahn)
Anfangsstabilität
Anfangsstörung
Anfangssuszeptibilität
Anfangstestprogramm
Anfangswert
Anfangswert
Anfangswerte
Anfangswerte
Anfangswertproblem
Anfangswertsatz
Anfangszustand
Anfärbbarkeit
anfordern
Anforderung an die Roboterprogrammierung
Anforderungsblock für geladene Programme
Anforderungsblock für Unterbrechungs[sbehandlung]
Anforderungssignal
Anfrage
anfragen
Anfragezeichnung
Angabe im Programmtext
angelegte Spannung
angelegtes Signal
angenäherte Bestimmung der Überregelung
angenäherte Lösung
angenommen
angenommen
angepasste Belastung
angepasste Impedanz
angepasste Konstruktion
angepasste Rechnerkonfiguration
angepasster Fasersensor
angepasstes Greifersystem
angepasstes Verhalten (eines IR)
angeregtes Niveau
angeschlossene Einheit
angeschlossene Einheit
analytical control
analytic simulation
analytical control
analytical structure
analytical research method
analytic expression
analytical design
high‐frequency analytical measuring method
analytic method
anamorphotic image system
instructed carry
change v
unable to learn (ro move, to change, … etc.) component parameter variation
progressive failure
rate of change
modification frequency
start‐up operation
starting and storage
starting of regulating circuits
start‐up filter
start‐up instrumentation
start‐up test
start‐up ramp
start‐up transient
start‐up behaviour
initial
initial address
initial susceptibility
initial selection sequence
initial automaton
initial conditions
starting conditions
non‐zero conditions
initial data
initial adjustment
initial rate
initial speed
initial point
initial stability
initial displacement
initial susceptibility
initial test routine
initial value
start value
initial conditions
starting conditions
initial‐value problem
initial‐value theorem
initial state
Colourability, US: colorability
request v
requisition of robot programming
loaded request block (of programs)
interruption request block
request signal
inquiry
request v
enquire drawing
program text specification
applied voltage
applied signal
approximative determination of the overshooting
approximate solution
accepted
accepted, ACC
matched load
matched impedance
adapted design
adapted computer configuration
adaptive fibre sensor
adapted gripper system
adaptive behavior
excitation level
online equipment
online unit
stran 15 od 326
EN ‐DE: slovar avtomatizacije in robotike angeschlossene Registrieranlage
angeschlossener Automat
angeschlossener Prozessor
angeschlossenes Gerät
angeschlossenes Gerät
angeschlossenes Prozessorsystem
angewandte Schaltungssynthese
angezeigter Roboterfehler
angezeigter Winkel
Anhalten am Ende der Reihe
Anhalten bei Ende des Satzes
anharmonisches Verhältnis ???
Anhäufung
anheben
anisochrone Verbindung
anisochrone Verbindung
Anlage
Anlage
Anlage
Anlagenausfall
Anlagenauslegung
Anlagenleistung
Anlagensicherheit
Anlagensteuerung
Anlagenstruktur
Anlagensystem
anlagentechnischer Entwurf
Anlagenüberwachung
Anlagenvorbereitung
Anlauf‐ und Bremskurve
Anlaufkonstante
Anlaufkontrolle
Anlaufregler
Anlaufzeit
Anlaufzeit
Anlaufzeit
Anlaufzeitbegrenzerrelais
anlegen
anlegen
Annäherung
Annäherung
Annäherungsfühler
Annäherungsgeschwindigkeit
Annäherungslösung
Annäherungsstufe
Annäherungsverzögerung
Annäherungswert
Annäherungswert
Annahme
Annahme der Anforderung
Annahme der Anforderung
Annahmeprüfeinrichtung
Annahmeprüfeinrichtung
Annahmesteuerung
Annahmesteuerung
annehmbar
annehmbare Qualitätsstufe
annehmbare Qualitätsstufe
annehmbare Station
annehmbare Station
annehmbare Zuverlässigkeitsstufe
annehmbare Zuverlässigkeitsstufe
annehmbare Zuverlässigkeitsstufe
annehmbares Programm
annehmen
Anodenbelastung
Anodendetektor
Anodenkorrektion
anomal
anomale Ausbreitung
anordnen
Anordnung
Anordnung des Speichersystems
Anordnung des Speichersystems
Anordnung eines Industrieroboters
Anordnungsplanung
connected recording equipment
connected automaton
attached processor, AP
online equipment
online unit
attached processor system
applied circuit synthesis
indicated robot error
indicated angle
stop at end of sequence
stop at end of sequence
anharmonic relation
disturbance storage
bootstrap v
asynchronous connection
anisochronous connection
equipment
installation
fitting out
machine failure
plant design
system capacity
plant safety
plant control
plant structure
equipment system
plant design
plant control
plant preparation
starting and breaking curve
acceleration constant
start‐up control
acceleration controller
build[ing]‐up time
transient period
rise time
overall starting‐time relay
design v
construct v
approximation
approach
approximate sensitive element
approach speed
approximate solution
degree of approximation
retardation of approximation
approximate quantity
approximate value
acceptance
accept of request
accept of request, ARQ
acceptance checkout equipment
acceptance checkout equipment, ACE
acceptor control
acceptor control, AC
acceptable
acceptable quality level
acceptable quality level, AQL
accepting station
accepting station, AS
acceptance reliability level, ARL, acceptable reliability level
acceptable reliability level
acceptance reliability level
acceptable program
accept v
anode load
anode bend detector
anode correction
anomalous
anomalous propagation
order v
layout
arrangement of the memory system
store system arrangement
robot arrangement, industrial robot arrangement
arrangement planning
stran 16 od 326
EN ‐DE: slovar avtomatizacije in robotike Anordnungsprinzip arrangement principle
Anordnungsvariante
arrangement variant
anormales Ende der Aufgabe
abnormal end of task, ABEND
anpassbare Montagebedingung
adaptable assembly condition
anpassbare Robotersteuerung
adaptable robot control
anpassbares Datenbanksystem
adaptable data bank system
anpassbares Manipulatorobjekt (Objekt)
adaptable [manipulator] object
anpassen
match v
Anpassung
adaptation
Anpassung
adapting
Anpassung
matching
Anpassung der Greiferstruktur
adaptation of gripper structure
Anpassung der Robotermechanik
adaptation of robot mechanics
Anpassung eines Greifers
gripper adaptation
Anpassung eines Roboterprogramms
matching of robot program
Anpassung feines Manipulators
adaptation of manipulator
Anpassungsbedingung
matching condition
adapter
Anpassungseinheit
matching device
Anpassungseintrichtung
matching equipment
Anpassungseintrichtung
adaptive logic
anpassungsfähige Logik
anpassungsfähiger Effektor
adaptable effector
anpassungsfähiger Roboter
adaptable robot
anpassungsfähiger Robotereffektor
adaptable robot effector
anpassungsfähiger Sensor
adaptable sensor
anpassungsfähiges (anpassbares) programmierbares Montageadaptable programmable assembly system
anpassungsfähiges Anlagensystem
adaptable system of equipment
anpassungsfähiges Fingersystem
versatile finger system
anpassungsfähiges integriertes Werkzeugsystem
flexible integrated tool system
anpassungsfähiges programmierbares Montagesystem
adaptable programmable assembly system
anpassungsfähiges Regelungssystem
adaptive control system
anpassungsfähiges System
adaptable system
anpassungsfähiges System
adaptive system
adaptability
Anpassungsfähigkeit
compatibility
Anpassungsfähigkeit
Anpassungsfehler
matching error
Anpassungsmechanismus
adaptation mechanism
Anpassungsparameter
adaptation parameter
Anpassungsregelung
adaptive regulation, adaptive control
Anpassungswiderstand
matching impedance
rise time
Anregelzeit
anregen
activate v
Anregung
activation
Anregungsbedingung
excitation condition
Anregungsfunktion
excitation function
Anregungsgröße
forward signal
Anregungskurve
excitation curve
Anregungsniveau
excitation level
Anreizung
activation
Anrufrelais
calling relay
Anrufrelais
line relay
Anrufrelais
ringing relay
Anschauungsmodell
demonstration model
Anschlageinstellung
positioning of stop
Anschlaglinie
line of stop
anschließen
associate v
anschließen
connect to
anschließen
join v
Anschlussbild
interface
Anschlusskanal
interface channel
Anschlussklemme
terminal
connection head
Anschlusskopf
Anschlussmultiplexer
terminal multiplexer
connection point
Anschlusspunkt
point of connection
Anschlusspunkt
interface circuit
Anschlussschaltung
Anschlussstandard
interface standard
Anschlussstelle
interface
interface controller
Anschlusssteuereinheit
terminal pin
Anschlussstift
Anschlusstechnik
interfacing technique
Ansprechempfindlichkeit
operating threshold sensibility
Ansprechgrenze
response limit
Ansprechmoment
pull‐up torque
Ansprechschwelle
operation threshold
Ansprechschwelle
response threshold
stran 17 od 326
EN ‐DE: slovar avtomatizacije in robotike Ansprechsicherheitsfaktor
Ansprechspannung
Ansprechspannung
Ansprechspannung des Leistungsrichtungsrelais
Ansprechvermögen
Ansprechvermögen
Ansprechwahrscheinlichkeit
Ansprechwert
Ansprechzeit
Ansprechzeit
Ansprechzeitfehler
Ansprechzeitkonstante
anstehende Unterbrechungsanforderung
anstehender Interrupt
Ansteuerschaltung
Anstieggeschwindigkeit
Anstiegs
Anstiegsantwort
Anstiegsantwort
Anstiegsantwort
Anstiegsfunktion
Anstiegsfunktion
Anstiegszeit
Anstiegszeit
Anstiegszeit
Anstiegszeit bei maximaler Amplitude
Anstrichroboter
Anstückelungsmethode
Anteil der Handmontage
anthropomorpher Manipulator
Antikoinzidenzkreis
Antikoinzidenzmethode
Antikoinzidenzschaltung
Antilogarithmus
antiparallel
Antiparallelschaltung
Antiparallelschaltung
Antiresonanz
Antiresonanz
Antivalenzglied
Antizipationssignal
Antrieb des Stellgliedes
Antrieb eines Industrieroboters
Antrieb eines Industrieroboters
Antrieb eines Rundtisches
Antriebsbaugruppe
Antriebsbewegung
Antriebscharakteristik
Antriebsdaten pl eines Industrieroboters
Antriebsdimensionierung
Antriebsdrehbewegung
Antriebsdrehwinkel
Antriebselement
Antriebselementedynamik
Antriebsfunktion
Antriebsgelenkzahl
Antriebsgeschwindigkeit
Antriebsgeschwindigkeitsverlauf
Antriebsgestaltung
Antriebsgetriebe
Antriebsgetriebe
Antriebsgliederzahl
Antriebsgliederzahl
Antriebsgliederzahl
Antriebsimpuls
Antriebsimpuls
Antriebsimpuls
Antriebskraft
Antriebsmechanismus
Antriebsmechanismus
Antriebsmechanismus
Antriebsmoment
Antriebsmoment
Antriebsmoment
Antriebsmomenterzeugung
Antriebsmotor
safety factor for pick‐up
response voltage
threshold voltage
operating voltage of power‐direction relay
ability to respond
response capacity
detector efficiency
responding value
operating time
response time
response time error
responsive time constant
pending interrupt
pending interrupt
selection circuit
rise speed
tamp
ramp‐forced response
tamp response
ramp function response
ramp function
tamp function
build[ing]‐up time
transient period
rise time
rise time et maximal amplitude
painting robot
method of solutions sewing
hand assembly part
anthropomorpheral manipulator
anticoincidence circuit
anticoincidence method
anticoincidence circuit
antilogarithm
antiparallel
antiparallel connexion
inverse‐parallel
antiresonance
parallel phase resonance
anticoincidence element
anticipatory signal
drive of regulated unit
robot drive, industrial robot drive
[industrial] robot drive
circular table drive, rotary attachment feed gear
drive assembly
drive movement
characteristic of drive
drive data of robot, drive data of industrial robot
drive dimensioning
drive rotation movement
drive rotation angle
drive element
drive element dynamics
function of drive
drive joint number
drive speed
course of drive speed
drive design
drive gear
operating mechanism
drive element number, element number of manipulator drive
drive element number
element number of manipulator drive
actuating pulse
control pulse
driving pulse
driving power
actuator mechanism
operating mechanism
drive gear
drive moment
controlling torque
driving torque
generation of drive moment
drive motor
stran 18 od 326
EN ‐DE: slovar avtomatizacije in robotike Antriebsparameter
Antriebsregler
Antriebsschubbewegung
Antriebsschubweg
Antriebsstromkreis
Antriebsstromkreis
Antriebsstromkreis
Antriebssystem
antriebstechnische Baugruppe
antriebstechnisches Bauelement
Antriebsweg eines Greifers
Antwort
Antwort auf Rampenfunktion als Eingang
Antwort auf Rampenfunktion als Eingang
Antwortannahme
Antwortannahme
Antwortbake
Antwortbetriebsart
Antworteinheit
Antwortfunktion
Antwortfunktion der homogenen Zustandsgleichung
Antwortfunktion der inhomogenen Zustandsgleichung
Antwortimpuls
Antwortschaltkreis
Antwortsender
Antwortsender mit Frequenzversetzung
Anwahlautomatik
Anwahlautomatik
Anwahlautomatik
Anwenderanpassung
Anwenderelektronik
Anwenderprogramm
Anwenderprogrammabschnitt
Anwenderprogrammiersystem
Anwenderprogrammierung
Anwenderprogrammparameter
Anwenderprogrammstart
Anwenderprogrammstopp
Anwendung
Anwendung
Anwendung
Anwendung in Netzen
Anwendung syntaktischer Algorithmen
Anwendungsbereich von Greifeinheiten
Anwendungsfall
Anwendungsgebiet
Anwendungsgebiet
Anwendungsgebiet für Effektoren
Anwendungsgebiet für Effektoren
Anwendungshilfen
Anwendungslücke
anwendungsorientiert
Anwendungsproblem
Anwendungsprogramm
Anwendungssteuerung
Anwendungssteuerung
Anwendungsstudie
Anwendungsweise
Anwesenheit
Anwesenheitszeichen
Anzahl der Antriebsbewegungen
Anzahl der Freiheitsgrade
Anzahl der Freiheitsgrade (eines Greifers)
Anzahl der Programmpositionen
Anzahl der Speicherplätze
Anzahl von Robotertypen
Anzeige
Anzeige feines Roboterfehlers Anzeige für die Nichtbestätigung
Anzeige für die Nichtbestätigung
Anzeige für die Nichtbestätigung
Anzeigebereich
Anzeigebereich
Anzeigebetriebsarten
Anzeigegerät
Anzeigelampe
parameter of drive
drive regulator
drive sliding movement
drive sliding path
control circuit
steering circuit
driving circuit
drive system
drive‐technical assembly
drive‐technical component
drive path of gripper
response
ramp‐forced response
ramp function response
accept of response
accept of response, ARP, response acceptance
responder
response mode
answer unit, AU
response function
zero‐input response
zero‐state response
replay pulse
replay circuit
responder
frequency offset transponder
automatic selectivity control
automatic selection control
automatic selective
user matching
user electronics
user program
application program division, APD, user program division, use
user programming system
user programming
user program parameter
user program start
user program stop
application
use
employment
network application
applying of syntactic algorithms
application field of grip units
case of application
application field
area of application
effector field of use
effector field of application
application aids
gap of application
application‐oriented
application problem
application program
application control
application control, AC
application study
mode of application
presence
presence signal
drive movement number
number of degrees of freedom
number of freedom degree
program position number
memory location number, store location number
robot type number, type number of robot
indication
robot error indication, fault indication of robot
acknowledge run flag, ARF, display for non‐validation
acknowledged run flag
display for non‐validation
indicating range
range of indication
display modes
indicating instrument
check indicator
stran 19 od 326
EN ‐DE: slovar avtomatizacije in robotike Anzeigelampe
anzeigeloser Regler
Anzeigemultiplexer
anzeigender Regler
anzeigender Selsyn
anzeigendes und selbsttätig abgleichendes Potentiometer
Anzeigeposition
Anzeiger eines Rechners
Anzeigerelais
Anzeigerelais
Anzeigerelais
Anzeigestelle
Anzeigesteuerung
Anzeigetechnik
Anzeigeverfahren
Anzeigevorrichtung
Anzeigevorrichtung
anziehen
Anziehen der Schraube
aperiodisch
aperiodisch
aperiodisch
aperiodisch gedämpft
aperiodisch gedämpft
aperiodisch gedämpftes Glied
aperiodisch gedämpftes Instrument
aperiodische Arbeitsweise
aperiodische Bewegung
aperiodische Bewegung
aperiodische Dämpfung
aperiodische Dämpfung
aperiodische Dämpfung
aperiodische Stabilität
aperiodischer Betriebszustand
aperiodischer Betriebszustand
aperiodischer Frequenzteiler
aperiodischer Grenzfall
aperiodischer Grenzfall)
aperiodischer Kreis
aperiodischer Verstärker
aperiodischer Vorgang
aperiodisches Exponentialsignal
aperiodisches Glied
Apparatur
Apparatur
Apparatur
Apparatur
Apparatur
Applikation Applikationder Sensortechnik
Approximation
Approximation im Frequenzbereich
Approximation im Zeitbereich
Approximation mit der Tschebyscheffschen
Approximation von Exponentialfunktionen
Approximation von Zeitfunktionen
Approximationsfehler
Approximationsgüte
Approximationsmethode
Approximationstheorie
approximative Darstellung
approximierte Berechnung
approximierte Berechnung
äquidistanter Kode
Äquipotentiallinie
äquivalente Admittanz
äquivalente Admittanz
äquivalente Belastung
äquivalente Binärstellenzahlen
äquivalente Einwirkung
äquivalente Impedanz eines nichtlinearen Gliedes
äquivalente Rauschleistung
äquivalente Rauschleistung
äquivalente Strukturwandlung
Äquivalenteinwirkung
äquivalenter Verstärkungskoeffizient m
indicating lamp
non‐indicating controller
display multiplexor
indicating controller
indicating selsin
indicating self‐balancing potentiometer
display position
computer indicator
indicating relay
indicator relay
annunciator relay
display position
display control
display technique
display technique
display device
display unit
absorb v
tightening of screw
aperiodic
overdamped
dead‐beat
aperiodic damping
overdamped
aperiodic element
aperiodic instrument
aperiodic regime
a periodic motion
aperiodic motion
a periodic damping, a periodic attenuation
aperiodic attenuation
aperiodic damping
aperiodic stability
a periodic regime (working condition)
aperiodic regime
aperiodic frequency divider
critically damped, D = 1
critical damping
aperiodic circuit
aperiodic amplifier
aperiodic phenomenon
aperiodic exponential signal
aperiodic link
jig
fixture
appliance
device
facility
application of sensor technique;
application of sensor technique, application of sensorics
approximation
approximation in the frequency domain
approximation in the time domain
Chebyshev approximation
approximation of exponential functions
approximation of time functions
error of approximation
error of approximation
approximation method
approximation theory
approximative representation (of a physical phenomenon)
approximate calculation
approximate computation
equidistant code
equipotential line
describing function
equivalent admittance
equivalent load
equivalent binary digits
equivalent action
equivalent impedance of a non‐linear element
equivalent power of noise
noise equivalent power
equivalent structure transformation
equivalent action
describing function
stran 20 od 326
EN ‐DE: slovar avtomatizacije in robotike äquivalenter Verstärkungskoeffizient m
äquivalenter Zustand
Äquivalenz logischer Schaltungen
Äquivalenz von Algorithmen
Äquivalenzrelation
arbeiten
arbeitender Sensor
Arbeitsablauf
Arbeitsablaufdiagramm
Arbeitsablaufplan
Arbeitsanpassung Arbeitsbahn eines Robotergreifers
Arbeitsbedingungen einer Schalteinrichtung
Arbeitsbefehl
Arbeitsbefehl
Arbeitsbereich
Arbeitsbereich
Arbeitscharakteristik
Arbeitscharakteristik
Arbeitsdruck
Arbeitsdruck
Arbeitsebene eines Manipulators
Arbeitselemente
Arbeitsfeld
Arbeitsfeld
Arbeitsgeschwindigkeit
Arbeitsgeschwindigkeit
Arbeitsgeschwindigkeit
Arbeitsgeschwindigkeit
Arbeitsgeschwindigkeit eines Systems
Arbeitsintensität
Arbeitskontakt
Arbeitskontakt
Arbeitskontakt
Arbeitskontrolle
Arbeitsmakro
Arbeitsmaschine Arbeitsmittelmanipulator
Arbeitsmittelstruktur eines IR
Arbeitsorgan eines IR Arbeitsphase
Arbeitsphase
Arbeitsplatzanalyse
Arbeitsplatzanordnung
Arbeitsplatzposition
Arbeitsposition (eines IR) Arbeitsprinzip
Arbeitsproduktivitätssteigerung (durch Robotereinsatz)
Arbeitsprogramm Arbeitsprozess
Arbeitspunkt
Arbeitspunkt Arbeitsraum Arbeitsraum (eines Manipulators)
Arbeitsraum eines Roboters
Arbeitsraumkoordinaten
Arbeitsschwellwertempfindlichkeit
Arbeitsseite feines IR
Arbeitssicherheit
Arbeitsspeicher
Arbeitsstation
Arbeitsstation
Arbeitsstellung
Arbeitsstellung
Arbeitsstellung
Arbeitsstromschaltung
Arbeitstakt des Relaisgerätes relais
Arbeitstemperatur
Arbeitsverfahren‐ Kennlinie
Arbeitsverfügbarkeit
Arbeitsvermögen
Arbeitsvorgangszeitmesser
Arbeitsweise
Arbeitswicklung
Arbeitswinkel
Arbeitszyklus
equivalent admittance
equivalent state
logical circuits equivalence
algorithm equivalence
equality relation
operate v
active sensor
operation procedure
process chart
plan of operation sequence
working matching
gripper working path [of robot]
work conditions of switching device
work instruction
working command
operating range
working range
operating characteristic
working characteristic
operating pressure
working pressure
manipulator working plane
work elements
operating range
working range
operating speed
circuit speed
operation speed
switching speed
overall system speed
working intensity
operating contact
back contact
normally open contact
work check[ing]
action macro
working machine
working medium handler
operating medium structure ofIR
working organ of IR
duty cycle
work cycle
workplace analysis
workplace layout
workplace position
working position (of IR)
operating principle
increase of labour productivity (by application of robots), incr
working program
operating procedure
operating point
working point
working area, operating area
working room, working zone (of manipulator)
operating space of robot
working space coordinates
operating threshold sensibility
robot operating side
industrial safety
operating memory
work station
working station
working position
operative position
operating position
circuit‐closing connection
relay device operation cycle
working temperature
process characteristic
availability factor
working capacity
process timer
operating mode
power winding
operating angle
duty cycle
stran 21 od 326
EN ‐DE: slovar avtomatizacije in robotike Arbeitszyklus
Arbeitszylinder für Roboter
Architektur eines Echtzeit‐Betriebssystems
Architektur feines Roboterrechners
Ardometer
Argonlaser
Argument
Argument einer Funktion
Arithmetikeinheit ???
Arithmetik‐Logik‐Einheit
Arithmetik‐Logik‐Einheit
Arithmetik‐Logik‐Prozessor
Arithmetik‐Logik‐Prozessor
Arithmetikprozessor
arithmetische Daten pl
arithmetische Ergibtanweisung ???
arithmetische Expression
arithmetische Funktion
arithmetische Konstante
arithmetische Kontrolle
arithmetische Kontrolle
arithmetische Operation
arithmetische Prüfung
arithmetische Prüfung
arithmetische Schreibweise
arithmetische Sprachoperation
arithmetische Verschiebung
arithmetischer Bus
arithmetischer Roboterprozessor
arithmetisches Element
arithmetisches Mittel
Arm kante
Arm mit fünf Gelenken
ARMA‐Modell
ARMA‐Modell
ARMAX‐Model
ARMAX‐Modell
Armbewegungsablauf
Armdrehung
Armeinstellung
Armelement
Armelementkonfiguration
Armgeometrie
Armgliederverkleidung eines Roboters
Armkomponente
Armkonfiguration
Armlagekomponente
Armlängsbewegung
Armleistung
AR‐Modell
Armposition
Armrotation
Armsegment
Armstellung
Armstellung eines Industrieroboters
Armtragfähigkeit
Armverschiebung
Arrayprozessor
Arretiervorrichtung
Art des Kraftanschlusses
Art eines Montageroboters
ARX‐Modell
ASCII
ASCII
ASSA
Assemblerprogrammiersystem
Assemblerquellprogramm
Assoziation
assoziativ
assoziative Indexmethode
assoziative Indexmethode
assoziative Programmierung
assoziativer Festwertspeicher
work cycle
actuating cylinder for robots
architecture of real‐time operating system
architecture of robot computer
radiation pyrometer
argon laser
argument
argument of a function
arithmetic unit
arithmetic‐logic unit
ALU
arithmetic‐logic processor
arithmetic‐logic processor, ALP
arithmetic processor
arithmetic data
arithmetic assignment statement
arithmetic expression
arithmetical function
arithmetic constant
arithmetical check[ing]
mathematical check[ing]
arithmetical operation
arithmetical check[ing]
mathematical check[ing]
arithmetic notation
arithmetical language operation
arithmetical shift
arithmetic bus, AB
arithmetic robot processor
arithmetic[al] element
arithmetic mean
arm edge
arm with five joints
ARMA model
ARMA model, auto‐regressive moving‐average model
auto‐regressive moving‐average model with extra (exogenous) variable automatic
ARMAX model, auto‐regressive moving‐average model with extra (exogenous) variable
arm movement running
lever turning
adjusting of arm
arm element
arm element configuration
arm geometry
arm element coating of robot
arm component
arm configuration
component of arm position
longitudinal movement of arm
arm performance
AR model, auto‐regressive model
arm position
arm rotation
arm segment
arm position
position of robot arm (lever), position of industrial robot arm load‐carrying capacity of arm
arm shifting, arm shift
digital processor
arresting device
mode of power supply connection
assembly robot kind
ARX model, auto‐regressive model with extra (exoglnous) variable
American standard code of information interchange
ASCII
absolute assembler
assembler programming system, APS
assembler source program
association
associative
associative index method
associative index method, AIM
associative programming
associative read‐only memory, AROM
stran 22 od 326
EN ‐DE: slovar avtomatizacije in robotike assoziativer Link
assoziatives Gesetz
Assoziativprinzip
Assoziativspeicher
assoziierte Struktur
assoziierte Zeichengabe
astabiler Multivibrator
astatische Regelstrecke
astatische Regelung
astatische Regelung
astatische Regelung
astatische Regelung mit konstanter Geschwindigkeit
astatischer Regler
astatischer Regler
astatischer Regler
astatischer Regler
astatisches Gerät
astatisches System asymmetrische Funktion
asymmetrische Modulation
asymmetrischer Graph
asymmetrisches Biprozessorsystem
asymmetrisches Biprozessorsystem
asymmetrisches Netzwerk
asymmetrisches nichtlineares Element
asymmetrisches Werkstück
asymmetrisches Werkstück
asymmetrisch‐heterostatische Schaltung
Asymptote
Asymptoten
asymptotisch
asymptotische Beziehung
asymptotische Entwicklung
asymptotische Grenze
asymptotische Methode
asymptotische Stabilität
asymptotischer Fluss
asymptotischer Wert
asymptotisches Optimum
asymptotisches Verhalten
Asynchronbetrieb
Asynchrondämpfung
asynchrone Antwortbetriebsart
asynchrone Antwortbetriebsart
asynchrone ausgeglichene Betriebsart
asynchrone Betriebsweise
asynchrone Betriebsweise
asynchrone Erregung
asynchrone Folgeschaltung
asynchrone Logikschaltung
asynchrone Rechenanlage
asynchrone Robotersteuerung
asynchrone Steuerung
asynchrone Systemfalle
asynchrone unterbrochene Betriebsart
asynchrone unterbrochene Betriebsart
asynchrone Unterdrückung
asynchrone Verbindung
asynchrone Verbindung
asynchroner Kommunikationsadapter
asynchroner Kommunikationsadapter
asynchroner Stellmotor
asynchrones Multiplexsystem
asynchrones Relaissystem
asynchrones Übertragungssystem
Asynchrongerät
Asynchronrechner
atmosphärische Optik
atmosphärische Störung
atmosphärisches Bremsen
Atomwärme
ATS
audiovisuell
audiovisuell
audiovisuelle Präsentation
auditive (hörende) Sensoren pl
associative link
associative law
associative principe (of a memory)
contents addressable data store
associated structure
associated [channel] signaling
astable multivibrator
astatic controlled system
floating control
multispeed floating control
null offset
single‐speed floating control
astatic controller
integral controller
floating‐action controller
reset controller
astatic device
astatic system
asymmetric[al] function
asymmetric modulation
asymmetric graph
asymmetric biprocessor system
asymmetric bi‐processor system
asymmetric network
asymmetric non‐linear unit
asymmetric asymmetric work piece
asymmetrical heterostatic circuit
asymptote
root‐locus asymptotes
asymptotic
asymptotic relation
asymptotic expansion
asymptotic value
asymptotic method
asymptotic stability
asymptotic flux
asymptotic value
asymptotical optimum
asymptotic behavior
asynchronous working, asynchronous operation
asynchronous quenching
asynchronous response mode
asynchronous response mode, ARM
asynchronous balanced mode, ABM
asynchronous working
asynchronous working (mode)
asynchronous excitation
asynchronous sequential circuit
asynchronous logic
asynchronous computer
asynchronous robot control
asynchronous control
asynchronous system trap, AST
asynchronous disconnected mode
asynchronous disconnected mode, ADM
asynchronous quenching
asynchronous connection
anisochronous connection
asynchronous communication adapter
asynchronous communication adapter, ACA
asynchronous servomotor
non‐synchronous multiplex system
asynchronous relay system
asynchronous transmission system
asynchronous device
asynchronous computer
atmospheric optics
atmospheric perturbation
atmospheric braking
atomic heat
automated transport system
audiovisual
audiovideo
audiovisual presentation
audible sensors
stran 23 od 326
EN ‐DE: slovar avtomatizacije in robotike auf Karten
Aufarbeitung
Aufbau einer Aufnahmeeinrichtung
Aufbau einer Lineareinheit
Aufbau einer Manipulatorsteuerung
Aufbau eines Kanals
Aufbau eines Werkzeugmanipulators
Aufbauprinzip
Aufbereitung eines Roboterprogramms
aufeinanderfolgende Stufen
auffangen
Auffangregister
Auffrischungschaltung f
Auffrischungsperiode
Auffrischungssteuerung f
Auffrischungszyklus
Aufgabeapparat
aufgabenangepasste Programmierung
aufgabenangepasste Struktur
aufgabenangepasster Sensor
aufgabenangepasstes Montagesystem
Aufgabenbeschreibung für einen Roboter
aufgabenorientierter Fügemechanismus
aufgabenorientierter Greifer
Aufgabenprogrammierung
Aufgabensteuerblock
Aufgabenüberwachung
Aufgabenumschaltung
Aufgabenverwaltung
Aufgabenwechsel
Aufgabenwert
Aufgabenzielplan
Aufgabenzuordnung
Aufgabevorrichtung
Aufgeber
aufgenommene Leistung
aufgeschnittenes Impulssystem
aufgespürter Fehler
aufgeteilte Belastung
Aufhängung
aufklingende Schwingung
aufladen
aufladen
Aufladeschaltung
Auflage A für mechanische Teile
Auflisten eines Roboterprogramms
Auflösbarkeit Auflösungsvermögen
Auflösungsvermögen
Auflösungsvermögen
Auflüsungsfunktion
Aufnahmeeinrichtung
Aufnahmeeinrichtung
Aufnahmeeinrichtung
aufnahmefähig
Aufnahmegenauigkeit eines Greifers
Aufnahmegerät
Aufnahmegerät
Aufnahmemittelaufbau
aufnehmen
aufrufbares Programm
Aufrufbefehl
Aufrufbefehl
Aufruffolge eines Roboterprogramms
Aufrufform calling instruction 104
Aufrufstelle
aufsaugen
Aufsaugverlust
aufspeichern
aufstellen
aufstellen
Aufstellungsoptimierung
Aufstellungsplan
Aufstellungsplan
Aufstellungsprojekt
aufstocken
ants on cards
reprocessing
assembly of reception device
linear unit structure
assembly of manipulator control
channel design
tool manipulator assembly
principle of construction
reworking of robot program
successive stages
latch v
latch register
refresh circuit
refresh period
refresh control
refresh cycle
feed apparatus
task‐adapted programming
task‐adapted structure
task‐adapted sensor
task‐adapted assembly system
robot task description
task‐oriented jointing] mechanism
task‐oriented gripper
programming of tasks
task control block
task supervision
task switch[ing]
task management
task switch[ing]
prescribed value
task target plan
task coordination
distributor
distributor
absorbed horsepower
open‐loop pulse system
traced fault
split load
accumulation
increasing oscillation
bootstrap v
boost v
bootstrapping circuitry
support for mechanical parts
listing of robot program
solvability resolving power
resolution power
resolution capability
resolution function
reception device
receiving device
receiving gear
absorbable
reception accuracy of gripper
input unit
sensing unit
assembly of reception device
absorb v
executable program
calling instruction
call statement
calling sequence of robot program
call form
point of invocation
absorb v
absorption loss
store v
install v
setup v
installation optimozation
installation schedule
equipment layout plan
arrangement planning
upgrade v stran 24 od 326
EN ‐DE: slovar avtomatizacije in robotike Auftastimpuls
Auftastimpuls
aufteilen
Aufteilung
Aufteilungskoeffizient m
Aufteilungskoeffizient m
Auftragsverarbeitung
Auftragsverwaltung
Auftragsverwaltung
Auftretenswahrscheinlichkeit
Aufwärskompatibilität aufweisen
aufzählen
Aufzeichnung digitaler Messergebnisse
Aufzeichnung von Ergebnissen
auf‐zu
Auge‐Hand‐Koordination
Auge‐Hand‐Koordination der Robotersteuerung
augenblickliche Regelabweichung
augenblickliche Störung
Augenblicksbilanz
Augenblicksfrequenz
Augenblicksleistung
Augenblicksspannung
Augenblickswert
Augenblickswert
Augenblickswert m. Momentan wert
aus
aus
aus dem Gleichgewicht
Ausbau nach dem Baukastenprinzip
ausbauen
Ausbaufähigkeit
Ausbaufähigkeit
Ausbaufähigkeit
Ausbaufähigkeit
Ausbessern elektronischer Karten
Ausbreitung
Ausbreitung in der Atmosphäre
Ausbreitungsdämpfung
Ausbreitungsgleichung
Ausbreitungsmodell
Ausbreitungsmodus
Ausbreitungsrichtung
Ausbreitungstheorie proportional 514
Ausbreitungsverhältnis
Ausbreitungsverlust
Ausbreitungsverzögerung propagation
ausdehnbare Messzentrale
Ausdehnungszahl
ausdrücklich
Ausfahrgeschwindigkeit eines Roboterarms
Ausfall
Ausfall
Ausfall
Ausfall der Wechselspannungsversorgung
Ausfall wegen des unsachgemäßen Einsatzes
Ausfalldauer
Ausfallfreiheit
Ausfallfreiheit
ausfallgeschütztes System
Ausfallrate
ausfallsicher
ausfallsicheres System
Ausfalltest
Ausfallursache
Ausfallverhalten
Ausfallverhalten
Ausfallwahrscheinlichkeit
Ausfallwahrscheinlichkeitsdichteverteilung
ausfallweiches System
Ausfallzeit
Ausfallzeit
Ausfallzeit
Ausfallzeit eines Roboters
ausführbar
gate pulse
gating pulse
partition v
partition[ing]
partition coefficient
distribution coefficient
job processing
job management
job control
probability of occurrence
upward compatibility feature v
increment v
recording of digital results
result recording
on‐off
eye‐hand‐coordination
eye‐hand coordination of robot control
instantaneous deviation of controlled variable
momentary disturbance
momentary balance
instantaneous frequency
instantaneous power
instantaneous voltage
momentary value
instantaneous value
instantaneous value
off
out of circuit adj
off‐balance
modular expansion
upgrade v expandability
expansibility
extendibility
extensibility
repairing of electronic cards
propagation
atmospheric propagation
propagation loss
propagation equation
propagation model
propagation mode
direction of propagation
propagation theory
propagation ratio
propagation loss
propagation delay
extensible measuring central
coefficient of expansion
explicit
departure speed of robot arm
failure
breakdown
malfunction
alternating‐current dump
misuse failure
outage time
freedom of defects
absence of failures
fail‐safe system
failure rate
fail‐safe
fail‐safe system
failure test
failure reason
failure behaviour
behaviour during breakdown
failure probability
failure probability density distribution
fail‐soft system
downtime
failure time
fault time
down time of robot
executable
stran 25 od 326
EN ‐DE: slovar avtomatizacije in robotike ausführen
ausführliches Modell
Ausführungsorganisationssystem
Ausführungssteuerprogramm
Ausführungssteuerung
Ausführungszeit
Ausführungszone
Ausführungszyklus
Ausgabe analoger Informationen
Ausgabe der Sensorinformation
Ausgabe eines Roboterprogramms
Ausgabe von Drucklisten
Ausgabe von Steuerinformationen
Ausgabeadressbereich
Ausgabe‐Anforderungssignal
Ausgabegeschwindigkeit
Ausgabeimpuls
Ausgabeinformationssignale
Ausgabekonvertierung
Ausgabeleitung
Ausgabelogik
Ausgabemarkiersignal
Ausgaberate
Ausgabesteuerung
Ausgabesystem
Ausgabetor‐ Aktivierungssignal
Ausgabeverfahren
Ausgangs
Ausgangsachse
Ausgangsamplitude
Ausgangsanzeigeleitung
Ausgangsbefehl
Ausgangsdaten pl
Ausgangselement
Ausgangsfolgeachse
Ausgangsgleichspannung
Ausgangsgleichung
Ausgangsgröße
Ausgangsgröße
Ausgangsimpuls
Ausgangskapazität
Ausgangskennwortleitung
Ausgangslaserstrahl
Ausgangsleitung
Ausgangsleitwert bei offenem Eingang
Ausgangsmatrix
Ausgangspegel
Ausgangsposition
Ausgangsposition der Roboterhand
Ausgangsrückführung
Ausgangssammelleitung
Ausgangssignal
Ausgangsspitzenleistung peak point 472
Ausgangsstufe
Ausgangsstufe
Ausgangssystem
Ausgangsvariable
Ausgangsvektor
Ausgangsverstärker
Ausgangswert
Ausgangswert
Ausgangswicklung
Ausgangszeitkonstante
Ausgangszustand
Ausgangszustand
Ausgangszustand
Ausgangszustand eines Greifers
ausgeglichene Regelung
ausgehängt
ausgeregelte Störung
ausgeschaltet
Ausgießen (durch Roboter)
Ausgleich
Ausgleich
Ausgleich
Ausgleich des Leitungswiderstandes
execute v
detailed model
executive system
executive program
executive control
execution time
performance zone
execution cycle
analog output
output of sensor information
robot program output
output of print lists
output of control information
output address area
output‐request signal
output speed
output pulse
output information signals
output conversion
output line
output logic
output strobe signal
output rate
output control
output system
output strobe signal
output action
output
output axis
output amplitude
tag line out exit instruction
original data
output element
output axis
direct current output voltage
output equation
output quantity
output variable
output pulse
output capacitance
tag line out outgoing laser beam
output line
open circuit output conductance
output matrix
output level
initial position
starting position of robot hand
output feedback
bus‐out
output signal
peak output power
output cascade
output state
initial system
output variable
output vector
output amplifier
initial value
start value
output winding
output time constant
orginal state
output cascade
output state
initial state of gripper
balanced control
off‐hook
corrected perturbance
off‐load
sealing (by robot)
equalization
self‐recovery
compensation
line resistance compensation
stran 26 od 326
EN ‐DE: slovar avtomatizacije in robotike Ausgleich von Positionierabweichungen
Ausgleich von Positionierungenauigkeiten positionnement
Ausgleich von Positionierungsgenauigkeiten
Ausgleich von Posttionierabweichungen
Ausgleich von Toleranzabweichungen
Ausgleichdrosselspule
Ausgleichen
ausgleichen
ausgleichende Zeichenerkennungslogik
Ausgleicher
Ausgleichgetriebe
Ausgleichsbehälter
Ausgleichsbewegung eines Geifers
Ausgleichsbewegung eines Greifers
Ausgleichsdynamometer
Ausgleichseinheit
Ausgleichseinheit
Ausgleichseinheit eines Geifers
Ausgleichseinheit eines IR
Ausgleichseinheit mit elastischen Gliedern
Ausgleichseinheit mit eleastischen Gliedern
Ausgleichseinrichtung
Ausgleichselement
Ausgleichserscheinung
Ausgleichsgeschwindigkeit
Ausgleichsglied
Ausgleichsgrad
Ausgleichsimpuls
Ausgleichsindikator
Ausgleichsleitung
Ausgleichsleitung
Ausgleichsleitung
Ausgleichslinie
Ausgleichsmethode
Ausgleichsrückkopplung
Ausgleichsstrom
Ausgleichsstrom
Ausgleichsumspanner
Ausgleichsverfahren
Ausgleichsvorgang
Ausgleichszeit
Aushilfssystem
Aushilfssystem
Auskellern
Auslastung von Industrierobotern
Auslastung von Manipulatoren
Auslastung von Manipulatoren Manipulatorfahrzeug
Auslastung von Montagemaschinen
Auslastungsfaktor
Auslastungsfaktor
Ausleger (eines Schweißroboters)
Ausleger (eines Schweißroboters)
Ausleger eines Manipulators
Ausleger eines Robotergreifers
Auslegerindustrieroboter
Auslegerroboter
Auslegungsmodell
Auslegungsoptimierung
Auslöseimpuls
Auslöseimpuls
Auslöseimpuls
Auslösestrom
Auslösung
Ausmessung von Schallfeldern von Ultraschallgeräten
Ausnahmebedingung
ausrechnen
ausrechnen
Ausregelzeit
Ausrichtstation
Ausrichtung
Ausrichtungsmechanismus
Ausrüstung
Ausrüstung
Ausrüstung f. Hardware
Ausrüstung mit Ziffernprogrammsteuerung
ausrüstungsabhängige Robotertechnik (Robotik)
positioning deviation compensation
balancing of positioning inaccuracy
balancing of positioning inaccuracy
positioning deviation compensation
tolerance deviation compensation
smoothing reactor
balancing
balance v
compensated character recognition logic
adjuster
differential gear
compensating tank
balancing movement of grip‐per
balancing movement of gripper
balancing dynamometer
balancing unit
balancing unit of gripper
balancing unit of gripper
transient unit of IR
balancing unit with elastic elements
balancing unit with elastic elements
compliance device
balancing element
compensating process
balancing speed
equalizer
coefficent of inherent regulation
equalizing pulse
balancing indicator
balancing network
compensating line
compensation lead
compensating curve
balanced method
compensating feedback
balanced current
transient current
balancing transformer
balanced method
compensating process
duration of self‐regulation
backup system
standby system
pop
robot utilization, industrial robot utilization
manipulator utilization
manipulator utilization
machine utilization, assembly machine utilization
stream factor
utilization factor
bore to
to drill (by robot)
boom principle of manipulator
gripper boom, boom of robot gripper
boom industrial robot
boom industrial robot
design model
design optimization
firing pulse
initiating pulse
release pulse
releasing current
reset[ing]
sound field measurement of ultrasonic instruments
exception condition
calculate v
compute v
settling time
aligner station
alignment
alignment mechanism
equipment
fitting out
equipment, hardware
equipment with numerical program control
equipment‐dependent robots technique, equipment‐dependen
stran 27 od 326
EN ‐DE: slovar avtomatizacije in robotike Ausrüstungsabnahme
Ausrüstungsanordnung
Ausrüstungsauslegung
Ausrüstungsblock
Ausrüstungsentwurf
Ausrüstungserneuerung
Ausrüstungsfließband
Ausrüstungsgruppe
Ausrüstungskosten pl
Aussage
Aussage
Aussage
Ausschalteinheit
Ausschalten
Ausschalten
Ausschalten
Ausschalten der Stromversorgung
Ausschaltkontakt
Ausschaltkreis
Ausschaltkreis
Ausschaltsensor
Ausschaltstellung
Ausschaltstrecke
Ausschaltung
Ausschaltung
Ausschaltung
Ausschaltverzögerung Ausschaltverzung
Ausschaltverzung
Ausschaltzeit
Ausschaltzeit
Ausschaltzeit
Ausschaltzeitverzögerung
ausschlagabhängiger astatischer Regler
Ausschlagfaktor
Ausschlagfaktor
Ausschlagimpuls
Ausschlagmessmethode
Ausschlagmessmethode
Ausschlagpotentiometer
ausschlagunabhängiger astatischer Regler
Ausschneiden (von Werkstücken)
Ausschwingcharakteristik
Ausschwingkonstante
Ausschwingkonstante
Ausschwingzeit
Ausschwingzeit feines IR
Außenbefehl
Außendienst
Außengreifer
Außengreifereigenschaft
Außeninterpolator
Außenlastwiderstand
Außenrückkopplungssignal
Außenstation
Außerbetriebsdauer
äußere Abmessung
äußere Abschirmung
äußere Einwirkung
äußere Erregung
äußere Logik
äußere optische Modulation
äußere Regelung
äußere Roboterinformation
äußere Rückkopplung
äußere Spannung
äußere Störung
äußeres Magnetfeld
äußeres Rückkopplungssignal
Außertrittfallen
Aussetzbetriebsertrag
Aussetzdauer
ausstreichen
Austastimpuls
Austastung austauschbar
acceptance of equipment
equipment arrangement
process equipment design
equipment block
process equipment design
equipment innovation
equipment flow‐line
equipment group
equipment cost
conclusion
proposition
offering
breaking unit
switching off
trip out
tripping power‐down
shut‐off contact
blanking circuit
quenching circuit
switching‐off sensor
open position
break length
switching off
trip out
tripping turn‐off delay shut‐down delay
opening delay
breaking time
cut‐off time
turn‐off time
disconnection time delay
proportional speed floating regulator
deflection coefficient
deflection factor
overshoot impulse
deviation measuring method
direct deflection measuring method
deflection potentiometer
constant‐speed floating regulator
finish of the cut (of s)
decay curve
damping constant
decay constant
decay time
dying‐down time of IR
order from outside
field service
external gripper
external gripper property
external interpolator
external load
external feedback signal
terminal station
outage time
overall dimension
external shielding
external action
external drive
external logic
external optical modulation
external control
outer robot information
outer feedback
external voltage
external disturbance
external magnetic field
primary feedback signal
falling out of step
intermittent duty
rest duration
cancel v
blackout pulse
suppression interchangeable
stran 28 od 326
EN ‐DE: slovar avtomatizacije in robotike austauschbar
austauschbar
austauschbar
austauschbar
austauschbar
austauschbare Geräte
austauschbare Greifervorrichtung
austauschbarer Fingersatz
Austauschkode
Austrittsdruck
Austrittsverfahren
Austrittsverluste
Austrittswinkel
Auswahl mittels Koinzidenzströmen
Auswahl von Montageunterlagen
Auswahlkriterium
Auswahlprinzip
Auswahlregel
Auswahlschalter
Auswahlschaltung
Auswahlsteuerung
Auswahlsystem
Auswahlsystem
Auswahlverfahren
Auswahlverhältnis
auswechselbar
auswechselbar
auswechselbare Greiferbacken mpf
auswechselbare Steuerschiene
auswechselbare Werkstückaufnahme
auswechselbare Werkstückaufnahme
auswechselbarer Robotergreifer
auswechselbares Greifersystem
auswechselbares Greiforgan
Auswechseln von Steuerprogrammen
Ausweichbewegung
Auswerteeinheit
Auswerteeinheit
auswerten
Auswerteverfahren (für Roboterbilder)
Auswertezeit
Auswertung der Sensorinformation
Auswertung feines Roboterprogramms
Auswirkung fvon Maschinendefekten
Auswirkung von Manipulatordefekten
Auswirkung von Maschinendefekten
Auswirkung von Roboterdefekten
Auswuchtung
Auszeit
Auszeitintervall
Auszug
Auszug
Aus‐Zustand
Aus‐Zustand
Autochemogramm
Autochemogramm
Autodiagnostiksystem
Autodiagnostiksystem
Autofluoroskop
autoinduktive Kopplung
Autoionisation
Autoionisation
Autokode
Autokorrelation
Autokorrelation des optischen Rauschsignals
Autokorrelationsfunktion
Autokorrelationsfunktion
Autokorrelationsfunktion
Autokorrelationskoeffizient
Autokorrelator
Autokorrelogramm
Autokovarianz
Autoleistungsdichte
Autoleistungsspektrum
Automat für das Elektro‐Schlacke‐Schweißen
Automat für das Elektro‐Schlacke‐Schweißen
pluggable
exchangeable
plug‐in
plug‐type
removable
replacement instruments
interchangeable gripper device
interchangeable finger set
alternate code
outlet pressure
output action
exit losses
root‐locus, angle of departure
coincident current selection
selection of assembly documentation
selection criterion
selection principle
selection rule
selector
selection circuit
selective control
gating system
selector system
method of choice
selection ratio
interchangeable
exchangeable
interchangeable gripper Jaws
exchangeable control bar
changeable collet
changeable workpiece collet
interchangeable robot gripper
interchangeable gripper system
interchangeable grip organ
changing of control programs
emergency movement
estimation unit
evaluation unit
evaluate v
evaluation process (for robot images)
evaluation time
evaluation of sensor information
evaluation of robot program
machine defect effect
manipulator defect effect
machine defect effect
robot defect effect
balancing
timeout
timeout interval
separation
separating
off condition
off state
autochemogram
autochemograph
auto diagnostic system, self test system
autodiagnostic system
autofluoroscope
autoinductive coupling
auto‐ionization
preionization
autocode
autocorrelation
optical noise autocorrelation
autocorrelation function, ACF
autocorrelation function
self‐correlation function
autocorrelation coefficient
autocorrelator
autocorrelogram
autocovariance
autopower spectral density
autospectrum
automatic electroslag welder
automatic electroslag welding machine
stran 29 od 326
EN ‐DE: slovar avtomatizacije in robotike Automat für die Dekodierung
automaton for decoding
Automat für die Dekodierung
decoding automaton
Automat in Modulbauweise
modular automaton
Automat mit Endspeicher
automaton with final memory
Automat mit reduzierten Eingaben
automaton with reduced inputs
Automat ohne Ausgaben
automaton without outputs
Automat ohne Informationsverluste
information lossless automaton
Automatenalgebra der Ereignisse
automaton algebra of events
Automatengeneration
generation of automatons
Automatennetz
automaton network
Automatenschweißen
automatic [machine] welding
Automatensteuerungstechnologien
control technologies for automatons
Automatenüberwachung
supervision of automatons
Automatenüberwachung supervision of automatons automatic fault signalling
automatic fault signalling
Automatik‐Kontrollsystem
automatic check system
Automatiksystem
automatic system
Automationsplan
automation plan
Automatisation
automati[zati]on
automatisch
automatic
automatisch
self‐acting
automatisch abgleichendes Digitalmessgerät
automatically balancing digital instrument
automatisch betätigte Schutzeinrichtung
automatic‐actuated protective equipment
automatisch erzeugter Teilebaum
automatically produced piece tree, automatically generated pi
automatisch geführtes Fahrzeug
automatic guided vehicle
automatisch gesteuerte Zeicheneinrichtung
automatically controlled drawing equipment
automatisch gesteuertes Maschinensystem
automatic‐controlled machine system
automatisch gesteuertes Maschinensystem automatiquement automatic‐controlled machine system
automatisch programmierte Werkzeuge
automatically programmed tools
automatisch programmierte Werkzeuge
automatically programmed tools, APT
automatisch registrierende elektronische Fotokamera
automatically registering electronic photocamera
automatische
automatic alarm
automatische (selbsttätige) Steuerung
automatic control
automatische Abfrage
autopoll[ing]
automatische Abläufe bei Handhabungsprozessen
automatic operations at manipulation processes
automatische Abschaltung
automatic disconnection
automatische Addition
automatic addition
automatische Akkumulation
automatic accumulation
automatische Amplitudensteuerung
automatic amplitude control
automatische Anforderung für Wiederholung
automatic request for repetition
automatische Anlassen
automatic start[‐up]
automatische Anpassung automatic working matching
automatische Anzeige
automatic indication
automatische Arbeitsanpassung
automatic working matching
automatische Arbeitsanpassung (Anpassung an Arbeitsfunktioautomatic working matching
automatische Arbeitshände
automatic working hands
automatische Aufgabenzuordnung
automatic task coordination
automatische Ausgabe
automatic output (of data)
automatische Ausrückung
automatic ejection
automatic selection unit
automatische Auswahleinheit
automatic selectivity control, ASC, automatic selection control
automatische Auswahlsteuerung
automatic selectivity control
automatische Auswahlsteuerung
automatische Auswahlsteuerung
automatic selection control
automatic selective
automatische Auswahlsteuerung
automatische Baugruppenmontage
automatic assembly mounting
automatische Beantwortung
automatic answering
automatic adjustment of exposure
automatische Belichtungseinstellung
automatische Belichtungszeitregelung
automatic control of exposure time
automatische Berichtigung
autocorrection
automatische Betriebsart
automatic mode of operation
automatische Betriebsart
automatic operation mode
automatische Betriebsweise
automode
automatische Bildübertragung
automatic picture transmission, APT
automatische binäre Datenverbindung
automatic binary data link
automatische binäre Datenverbindung
automatic binary data link, ABDL
automatische Blendeneinstellung
automatic diaphragm setting
automatische Blockierung
automatic blocking
automatische Blockierung
automatic interlocking
automatische Blockierung
automatic lockout
automatische Brennschneidmaschine
automatic flame‐cutting machine
automatische Brennschneidmaschine
automatic gas‐cutting machine
automatische Bündelung
automatic focussing action
automatic data recording
automatische Datenaufzeichnung
automatische Dateneingabe introduction automatic data input
automatische Datenübernahme
automatic acceptance of the data
automatische Datenüberwachung
automatic data surveillance
stran 30 od 326
EN ‐DE: slovar avtomatizacije in robotike automatische Datenverarbeitung
automatische Defektlokalisierung
automatische Defektlokalisierung (Fehlerlokalisierung)
automatische Division
automatische Dosierung
automatische Dosierung
automatische Eichung
automatische Einschaltung der Reserveeinrichtung
automatische Einstellung
automatische elektronische Datenverarbeitung
automatische Empfindichkeitsregelung
automatische Entladung
automatische Fabrik
automatische Fadenbruchbehebung
automatische Farbeinstellung
automatische Farbeinstellung automatische Fehlerbeseitigung
automatische Fehlererkennung
automatische Fernmessung der Position
automatische Fernmessung der Position
automatische Fernsteuerung
automatische Frequenzdetektorschaltung
automatische Frequenzregelung
automatische Frequenzregelung
automatische Funktion
automatische Generierung
automatische Greifersteuerung
automatische Greifertechnik
automatische Greiferwechseleinrichtung
automatische Handhabeeinrichtung
automatische Handhabeoperation
automatische Helligkeitssteuerung
automatische Informationserfassung informations
automatische Informationsreduzierung
automatische Informationsregistrierung
automatische Informationsregistrierung
automatische Informationsverarbeitung
automatische interne Diagnose
automatische interne Diagnose
automatische Ionisationskammer
automatische Konstante
automatische Kontrastregelung
automatische Kontrolle
automatische Kontrolle
automatische Kontrolle
automatische Konzentration
automatische Korrektur
automatische Korrektur
automatische Kostenschätzung
automatische Kraftwerksteuerung
automatische Kurvenabtastung
automatische Lastbegrenzung
automatische Lichtbogenschweißanlage
automatische Lichtbogenschweißanlage
automatische Linie
automatische Löschung
automatische Maschinenauswahl
automatische Maschinenoperation
automatische Maschinensteuerung
automatische Maschinenverarbeitung
automatische Meldeanlage
automatische Mess‐ und Kontrolleinrichtung
automatische Messstation
automatische Messwerterfassung
automatische Mittelwertbildung
automatische Modellerkennung
automatische Montage
automatische Montage
automatische Montage von Schraubverbindungen
automatische Multiplikation
automatische Musterprogrammierung
automatische NC‐Datensicherung
automatische Niveauregelung
automatische Niveauregelung
automatische Nullkontrolle
automatische Nullpunkteinstellung
automatic data processing
automatic defect localization
automatic defect localization
automatic division
automatic proportioning
automatic dosage
automatic calibration
automatic reserve equipment switching
automatic regulation, automatic adjusting
automatic electronic data processing
automatic sensitivity control
automatic discharge
automatic plant
automatic thread breakage removal
automatic colour matching
automatic colour matching
automatic error recovery
automatic error detection
automatic position telemetering
automatic position telemetering, APT
automatic remote control
automatic discriminator switching
automatic frequency control
AFC
automatic function
automatic generation
automatic gripper control
automatic gripper technique
automatic device of gripper change
automatic handling device
automatic handling operation
automatic brightness control, ABC
automatic information acquisition
automatic information reduction
automatic message registering
automatic message registering, AMR
automatic information processing
automatic internal diagnosis
automatic internal diagnosis, AID
automatic ionization chamber
automatic constant
automatic contrast control
automatic check[ing]
automatic test[ing]
automatic inspection
automatic focussing action
automatic balancing
automatic compensation
automated cost estimating, ACE
automatic power plant control
automatic curve scanning
automatic load limitation
automatic arc welding equipment
automatic arc welding machine
automatic line
automatic clearing
automatic machine selection
automatic machine operation
automatic machine control
automatic machine processing
automatic alarm
automatic measuring and checking device
automatic measuring station
automatic logging
automatic mean value determination
automatic model recognition
automatic assemblage, automatic mounting
automatic assembly
automatic mounting of screw fastenings
automatic multiplication
automatic pattern programming
automatic numerical control data backup
automatic level control
automatic level control, ALC
automatic zero check
automatic zero adjustment
stran 31 od 326
EN ‐DE: slovar avtomatizacije in robotike automatische Parolenverarbeitung
automatic parole processing
automatische Phaseneinstellung
automatic phase adjustment
automatische Phasenregelung
automatic phase control
automatische Phasenregelung
automatic phase control, APC
automatische pneumatische Geräte
automatic pneumatic devices
automatische pneumatische Geräte
pneumatic automation installations
automatische Positionierung
self‐positioning
automatische Prägemaschine
automatic embossing machine
automatische Prioritätengruppe
automatic priority group
automatische Prioritätengruppe
automatic priority group, APG
automatische Programmgenerierung
automatic program generation
automatische Programmierung
automatic programming
automatische Programmierung
self‐programming
automatische Programmkorrektur
autopath
automatische Programmregelung programme
automatic program control
automatische Prozesssteuerung
automatic process control
automatische Prüfeinrichtung
automatic test equipment
automatische Prüfung
automatic check[ing]
automatische Prüfung
automatic test[ing]
automatische Prüfung
automatic inspection
automatische Prüfzeichengeneration (Prüfzeichenerzeugung) automatic test pattern generation, ATPG
automatische Qualitätskontrolle
automatic quality control
automatische Regeleinrichtung
automatic control device
automatische Regelung
automatic control
automatische Regelung
automatic regulation
automatische Regelung
self‐regulation
automatic control engineering
automatische Regelungstechnik
automatische Regelungsvorrichtung
automatic control gear
automatische Registriervorrichtung
data logger
automatische Reihenauswahl
automatic range selection
automatische Reserveeinschaltung
automatic standby start[‐up]
automatische Richtigkeitsprüfung
automatic accuracy check
automatische Rotationslinie
automatic rotary line
automatische Rückfrage
automatic request
automatische Rückfrage
automatic return question
automatische Rückführung
automatic reset
automatische Rückstellung
self‐resetting
automatische Rückstellung auf Null
self nulling
automatische Rückübertragungsanforderung
automatic retransmission request
automatische Rückübertragungsanforderung
automatic retransmission request, ARQ
automatic call recording, ACR
automatische Rufaufzeichnung
automatische Rufeinrichtung
automatic calling equipment, ACE
automatische Scharfabstimmung
automatic tuning control
automatische Schneideanlage
automatic cutting equipment
automatische Schnellabschaltung
automatic emergency shutdown
automatic protection
automatische Schutzeinrichtung
automatische Servoanlage mit geschlossener
Schleife
automatic closed‐loop servosystem
automatische Spanntechnik
automatic clamping technique
automatische Spannungsregelung
automatic voltage regulation
automatische Speicherung der Roboterinformation
automatic storage of robot information
automatische Speisung
automatic feed
automatische Sperrung
automatic blocking
automatische Sperrung
automatic interlocking
automatische Sperrung
automatic lockout
automatische Stabilisierung
automatic stabilization
automatische Stiftmontage
automatic pin assembly (mounting)
automatische Stillsetzung
automatic stopping
automatische Stillstandsüberwachung
automatic idling control
automatische Störsignalisation
automatic alarm
automatische Störsperre
automatic noise gate
automatische Synchronisiereinrichtung
automatic synchronizer
automatische Synchronisierschaltung
automatic locking circuit
automatische Synchronisierschaltung
automatic locking circuit, ALC
automatische Synthese
automatic synthesis
automatic translation
automatische Übersetzung
machine translation
automatische Übersetzung
automatic translation device
automatische Übersetzungseinrichtung
automatic monitoring
automatische Überwachungsanlage
automatische Umschaltung
automating reverse switching
automatische Umstellbarkeit
automatic shifting
automatische Umwelterfassung
automatic environment acquisition
automatische Verfahrenskreislauf‐ Regelvorrichtung
automatic process cycle controller
automatische Verriegelung
automatic blocking
automatische Verriegelung
automatic interlocking
automatische Verriegelung
automatic lockout
stran 32 od 326
EN ‐DE: slovar avtomatizacije in robotike automatische Verschlüsselung
automatic coding
automatische Verstärkungsregelung
automatic gain control
automatische Verzerrungskorrektur
automatic distortion correction
automatic branch control
automatische Verzweigungssteuerung
automatische Verzweigungssteuerung {Zweigstellensteuerungautomatic branch control, ABC
automatische Video‐Rauschbegrenzung
automatic video noise limiting
automatische Wähleinrichtung
automatic dialing unit, ADU
automatische Wählervermittlung
automatic circuit exchange
automatische Werkstückhandhabung
automatic handling
automatische Werkstückhandhabung
automatic work piece handling
automatische Widerstandsschweißanlage
automatic resistance welder
automatische Wiederholanforderung
automatic repeat request
automatische Wiederholanforderung
automatic request for repeat, automatic repeat request, ARQ
automatische Zeitschachtelung
automatic time sharing
automatische zentrale Bearbeitung
automatic central proccessing
automatische Zielerkennung
automatic target recognition
automatische Zweigstellensteuerung
automatic branch control
automatischer Abgleich
automatic balancing
automatischer Abgleich
automatic compensation
automatischer Antrieb
automatic drive
automatischer Anzeiger
automatic indicator
automatic operation
automatischer Arbeitsablauf
automatischer Aufnahmebunker
automatic receiving bunker
automatischer Bandaufwickelroboter
automatic tape winding robot
automatischer Bandgeber
automatic tape dispenser, ATD
automatischer Bandwickler
automatic tape winder, ATW
automatischer Bearbeitungsvorgang
automatic treatment process
automatischer Datenzuordner
automatic data translator, ADT
automatischer Digitalrechner
automatic digital computer, ADC
automatischer Einschienenmanipulator
automatic monorail manipulator
automatic wiring design
automatischer Entwurf der Verdrahtung
automatischer Entzerrer
automatic equalizer
automatischer Fügevorgang
automatic joining process
automatischer Gasanalysator
automatically operating gas analyzer
automatischer Gleichschalter
autostabilizer
automatischer Greifer Greifer
automatic gripper
automatischer Greiferaustausch
automatic gripper exchange
automatischer Greiferverschluss
automatic gripper closure
automatischer Kompensator
automatic compensator
automatic cycle
automatischer Kreislauf
automatischer Lautstärkeregler m
automatic gain controller
automatischer Lautstärkeregler m
automatic grading
automatischer Lautstärkeregler m
automatic sorting method
automatischer Lautstärkeregler m
automatic volume controller
automatischer Lochbandabtaster
automatic tape reader, ATR
automatischer Lochbandleser
automatic tape reader, ATR
automatischer Manipulator
automatic manipulator
automatischer Manipulator mit fünf Freiheitsgraden
automatic manipulator with five degrees of freedom
automatischer Mechanismus
automatic mechanism
automatischer Mechanismus mit elektromagnetischer Steueruautomatic mechanism with electromagnetic control
automatischer Monitor
automonitor
automatischer Montagevorgang
automatic assembly process
automatischer Montagevorgang (Montageprozess)
automatic assembly process
automatischer Netzspannungsregler
automatic network voltage regulator
automatic zero step
automatischer Nullschritt
automatischer Phasenvergleichskreis phase
automatic phase comparison circuit
automatischer Probenwechsler
automatic sample changer
automatischer Programmablauf
automatic program sequence, automatic program flow
automatischer Prüfvorgang
automatic operation of testing
automatischer Regelkreis
automatic control loop
automatischer Regler
automatic controller
automatischer Roboter
automatic robot
automatischer Röntgenspektrograf
automatic X‐ray spectrograph
automatischer Rückgang
automatic reset
automatic call
automatischer Ruf
automatischer Rufverteiler (Anrufverteiler)
automatic call distributor, ACD
automatischer Stabilisator
autostabilizer
automatischer Suchkreis
automatic search circuit
automatic supervision room
automatischer Überwachungsraum
automatischer Verschluss
automatic shutter
automatischer Verstärkungsregler
automatic gain controller
automatischer Verstärkungsregler
automatic grading
automatischer Verstärkungsregler
automatic sorting method
automatischer Verstärkungsregler
automatic volume controller
automatischer Viskositätsregler
automatic viscosity controller
automatischer Vorschub
automatic feed
stran 33 od 326
EN ‐DE: slovar avtomatizacije in robotike automatischer Wechsel der Greifeinheiten
automatischer Wechsel der Greifeinheiten grippion
automatischer Werkstückwechsel
automatischer Werkzeugwechsel
automatischer Werkzeugwechsel
automatischer Werkzeugwechsel
automatischer Wiederanlauf und Wiederherstellung
automatischer Wiederanlauf und Wiederherstellung
automatischer Zähler
automatischer Zähler
automatischer Ziffernerkenner
automatischer Zyklus
automatisches Arbeitssystem
automatisches Ausprüfungssystem
automatisches Auswerfen
automatisches Bearbeiten
automatisches Betriebs‐ und Planungsprogramm
automatisches Datenerfassungssystem
automatisches Datensammlungssystem
automatisches Datenübertragungssystem
automatisches Datenwiederauffinden
automatisches Digitalisiersystem
automatisches Digitalisierungssystem
automatisches Doppeln
automatisches Druckentlastungssystem
automatisches Duplizieren
automatisches Empfängerprogramm
automatisches Fehlerkorrektursystem
automatisches Flussdiagrammpaket
automatisches Generieren von Roboterprogrammen
automatisches Greifen (Ergreifen)
automatisches Greifersystem
automatisches Greiferwechselsystem
automatisches Indizieren
automatisches Kodierungssystem
automatisches Kontrollgerät
automatisches Kontrollsystem
automatisches Konturendigitalisierungsgerät
automatisches Layout‐Design
automatisches Lichtbogenschweißen
automatisches Luftraumkontrollsystem
automatisches Manipulationssystem
automatisches Mischen
automatisches Polarimeter mit magnetooptischer Drehung
automatisches Positioniersystem
automatisches Präzisionsspektrofotometer
automatisches programmierbares Montagesystem
automatisches Programmiersystem für Montage
automatisches Prüfsystem
automatisches Rechnen
automatisches Regelventil
automatisches Reihenfolgeverfahren
automatisches Roboterfahrzeug
automatisches Robotermontagesystem
automatisches Schmelzschweißen
automatisches Schützentor
automatisches Schweißen
automatisches Testsystem
automatisches Verteilungsuntersystem
automatisches Wechselsystem
automatisches Wiederauffinden von Informationen
automatisches Zählgerät
automatisches Zählgerät
automatisches Zeitteilungsverfahren
automatisches Zielsuchen durch Lichtstrahlen
automatisches Zubringen von Werkstücken
automatisches Zubringen von Werkstücken
automatisieren
automatisierte Baugruppenmontage
automatisierte Datenverarbeitung
automatisierte Einzelmaschine
automatisierte Fertigungsplanung
automatisierte Fertigungsüberwachung
automatisierte Handhabung
automatisierte Informationsverarbeitung
automatisierte Konstruktionstechnik
automatic alternation of grip units
automatic alternation of grip units
automatic change
automatic tool change, automatic tool exchange
automatic tool change
automatic tool exchange
automatic backup and recovery
automatic backup and recovery, ABR
automatic scaler
autoscaler
automatic digit recognizer
automatic cycle
automatic working system
automatic checkout system
automatic ejection
automatic machining (of control disks)
automatic operating and scheduling program, AOSP
automatic data acquisition system
automatic data collecting system
automatic data transmission system
automatic data retrieval
automatic digitizing system
automatic digitizing system
automatic duplication
automatic pressure suppression system
automatic duplication
automatic receiver program
automatic error‐correcting system, A ECS
automatic flow‐charting package
automatic generation of robot programs
automatic gripping
automatic gripper system
automatic gripper change system
automatic indexing (of informations)
automatic coding system
automonitor
automatic check system
automatic contour digitizer
automatic layout technique
automatic arc welding
automatic air control system
automatic manipulation system
automatic collating
Faraday rotation automatic polarimeter
automatic positioning system
automatic precision spectrophotometer
APAS (automatic programmable assembly system)
APAS (automatic programmable assembly system)
automatic testing system
automatic computing
automatic control valve
automatic sequencing procedure
automatic robot vehicle
automatic robot assembly system
automatic fusion welding
self‐acting shutter
automatic [machine] welding
automatic test system, ATS
automatic distribution subsystem
automatic change system
automatic information retrival
automatic scaler
autoscaler
automatic time sharing
light‐homing guidance
automatic feeding of s
automatic feeding of work pieces
automatize v
automated assembly mounting
automated data processing
automated single machine
automated manufacturing planning
automated monitoring of manufacturing
automated handling
automated information processing
automated construction engineering
stran 34 od 326
EN ‐DE: slovar avtomatizacije in robotike automatisierte Leitung
automatisierte Leitung
automatisierte Leitwegverwaltung
automatisierte Leitwegverwaltung
automatisierte Montage
automatisierte Präzisionsgerätetechnik
automatisierte Produktion
automatisierte Produktionsentwicklung
automatisierte selektive Präzisionsmontage
automatisierte Serienfertigung
automatisierte Steuerung
automatisierte Steuerung
automatisierte Verarbeitungsmethode
automatisierte Werkzeugmaschine
automatisierter Arbeitsablauf mittels Industrieroboters
automatisierter Arbeitsplatz
automatisierter Arbeitsplatz
automatisierter Informationsfluss
automatisierter ingenieurtechnischer Entwurf
automatisierter ingenieurtechnischer Entwurf
automatisierter Lernprozess
automatisierter Lernprozess
automatisierter Logikentwurf
automatisierter Manipulator
automatisierter Produktionsbereich
automatisiertes Datenaustauschsystem
automatisiertes Datenaustauschsystem
automatisiertes Dateneingabesystem
automatisiertes Dateneingabesystem
automatisiertes Datensystem
automatisiertes Datensystem
automatisiertes digitales Ein‐ und Ausgabesystem
automatisiertes Element
automatisiertes Entgraten
automatisiertes Entwurfstechnikprinzip
automatisiertes Informationssystem
automatisiertes Leitungsinformationssystem
automatisiertes Leitungsinformationssystem
automatisiertes logisches Diagramm
automatisiertes Montagesystem für Teile
automatisiertes Schweißverfahren
automatisiertes Transport‐ und Lagersystem
automatisiertes Transportsystem
automatisiertes Transport‐und Lagersystem
Automatisierung
Automatisierung der Fertigungssteuerung
Automatisierung der Lagerung
Automatisierung der Technologie
Automatisierung der Zeichenarbeiten
Automatisierung der Zeichenarbeiten
Automatisierung des Überwachungsprozesses
Automatisierung diskontinuierlicher Prozesse
Automatisierung mittels Industrierobotern
Automatisierung von Hilfsoperationen
Automatisierungsanlage
Automatisierungsaufgabe
Automatisierungselemente für Fertigungsstraßen
automatisierungsfreundlicher Entwurf
automatisierungsfreundlicher Entwurf
automatisierungsgerechte Gestaltung
automatisierungsgerechte Gestaltung
Automatisierungsgrad
Automatisierungsgrad
Automatisierungsgrad
Automatisierungsgrad der Montage
Automatisierungsgrad der Montage
Automatisierungsmittel
Automatisierungsmittel in Messkreisen
Automatisierungsobjekt
Automatisierungssprache (für lR)
Automatisierungsterminus
Automatismus
Automonitor
automorphe Abbildung
Automorphismus
autonom
automated control
automated direction
automated route management
automated route management, ARM
automated assembly
automated precision device engineering
automated production
automated production development
automated selective precision mounting
automatic sequence manufacture
automated control
automated direction
automated processing method
automated machine tool
automated sequence of operation by industrial robot
automated workplace
automatized working place
automated information flow
automated engineering design
automated engineering design, AED
automated learning process
automated teaming process, ALP
automated logic design
automated manipulator
automated workshop
automatic data interchange system
automatic data interchange system, ADIS
automated data entry system
automated data entry system, A DES
automated data system
automated data system, ADS
automatic digital input‐output system
automated element
automated trimming
automated design engineering principle
automated information system
automated management information system
automated management information system, AMIS
automated logic diagram
AUTOPASS (automated parts assembly system)
automated welding process
automated transport and storage system
automated transport system
automated transport and storage system
automati[zati]on
production control automation
storage automation
automation of technology
automation of drawing work
drawing work automation
automation of supervising process
automation of discontinuous processes
robot automation
automatization of auxiliary operations
automation equipment
automation task
automation elements for production lines
design meeting the demands of automation
automation‐friendly design
design meeting the demands of automation
automation‐friendly design
degree of automatizationautomatisation (US)
degree of automatization
automation degree
automatisation degree of assembly
automatization degree of assembly
automation medium
automation means in measuring circuits
plant (US)
ALFA (a language for automation)
automation term
automatism
automonitor
automorphism
automorphism
offline
stran 35 od 326
EN ‐DE: slovar avtomatizacije in robotike autonom
autonome
autonome
autonome Speisung
autonome Verarbeitungseinheit
autonomer linearer Automat
autonomes Regelsystem
autonomes Robotersystem
autonomes selbsttätiges Regelungssystem
autonomes System
autonomes tragbares Gammaspektrometer
autonomes tragbares Gammaspektrometer
Autonomie
Autopolarisation
Autoradiograf
Autoradiograf
Autoradiograf
Autoradiograf
Autoradiografie
Autoradiografie als Resultat einer Druckreaktion
Autoradiografie als Resultat einer Druckreaktion
Autoradiografie in der Elektronenmikroskopie
autoradiografische Regelung
autoradiografisches Verfahren
Autoradiogramm
Autoradiogramm
Autoradiogramm
Autoradiogramm
autoregressive Folge
autoregressive Reihe
autoregressives Modell
autoregressives Modell mit externen Variablen
autonomous
offline
autonomous
self‐contained supply
autonomous processor
autonomous linear automaton
independent control system
autonomous robot system
non‐interaction control system
autonomous system
autonomous portable gamma‐ray spectrometer
independent portable gamma‐ray spectrometer
autonomy
autopolarization
autoradiogram
autoradiograph
radioautograph
radioautogram
autoradiography
autopressuregraph
autopressuregrapm
autoradiography in electron microscopy
autoradiographic method
autoradiographic method
autoradiogram
autoradiograph
radioautograph
radioautogram
autoregressive series
autoregressive series
AR model, auto‐regressive model
ARX model, auto‐regressive model with extra (exogenous) variable
autoregressives Modell mit gleitender Mittelwertbildung
ARMA model
autoregressives Modell mit gleitender Mittelwertbildung mit ARMAX model, auto‐regressive moving‐average model with externer Variablen
extra (exogenous) variable
auto‐regressive moving‐average model with extra autoregressives Modell mit gleitender Mittelwertbildung mit e(exogenous) variable automatic
autorisierter Programmanalysebericht
authorized program analysis report, APAR
autorisiertes Programm
authorized program
Autospektraldichte
autopower spectral density
autospektrale Leistungsdichte
autopower spectral density
Autospektrum
autospectrum
Autostrahlung
autoradiation
Autotest‐System
autotest‐system
Axial‐ Transsonikverdichter
axial flow tran[s]sonic compressor
axiale Stömung
axial flow
axiale Verschiebung
axial displacement
axiale Verteilung
axial distribution
axial expansion coefficient
axialer Ausdehnungskoeffizient
axialer Diffusionskoeffizient
axial diffusion coefficient
Axialgebläse
axial flow fan
Axialpumpe feines Roboters
axial pump of robot
Axial‐Radial‐Verdichter
mixed‐flow compressor
Axialstrahlturbine
axial flow turbine
Axial‐Transsonikkompressor
axial flow tran[s]sonic compressor
Axialventilator
axial flow fan
Axiom
axiom
Axiom
postulate
Axiomatik der Theorie der Wahrscheinlichkeiten
axiomatics of theory of probabilities
axiomatisches System
axiomatic system
azyklischer Vorgang
acyclic process
Bachbildung
channelling
Backen
jaw
Backenbewegung
jaw movement
Backenflächen (eines Greifers)
surface of jaws (of gripper)
Backengeometrie
jaw geometry
Backenprofil
jaw profile
Bahnabweichung
path deviation
Bahnabweichung eines IR‐Arbeitsorgans
path deviation of IR working organ
Bahnabweichungsregelung
path deviation regulation
Bahnausgabedaten pi
path output data
Bahneingabedaten pi
path input data
path error of IR
Bahnfehler eines IR
Bahngeschwindigkeitsprofil
speed profile of path
bahngesteuerte Fertigung
path‐controlled production
stran 36 od 326
EN ‐DE: slovar avtomatizacije in robotike bahngesteuerter Roboterarm (Industrieroboterarm)
Bahninterpolation
Bahnkontrolle
Bahnkurve zwischen den Bestimmungspunkten
Bahnplanung
Bahnplanungsrechner (für Roboter)
Bahnplanungssystem
Bahnposition eines Industrieroboters
Bahnprogramm eines IR
Bahnsegment
Bahnsollwertgenerator
Bahnsteuerung
Bahnsteuerung
Bahnsteuerung Bahnsteuerung eines Industrieroboters (IR)
Bahnsteuerung eines Manipulators
Bahnstruktur
Bahnstützpunkt
Bahnvektorbetrag
Bahnvektorwert
Bahnwiderstand
Bahnzustand
Bajonettverbindung
Band
Bandanfang (eines Robotersteuerbandes)
Bandanfangsmarke
Bandantrieb
bandbegrenzt
bandbegrenzt
Bandbereich
Bandbereich
Bandbreite
Bandbreite des optischen Verstärkers
Bandbreite des parametrischen Verstärkers
bandbreitebegrenzter Betrieb Bandbreitenregelung
Bandbreitenregler
Bandbreitensteuerung
Bandfilter
Bandgeber
bandgesteuert
bandgesteuert
Bandinductosyn eines Greiferarms
Bandlaufwerk
Bandpass
Bandpassverstärker
Bandsperre
Bandsperre
Bandumschalter
Bandvorschubeinrichtung
Bandwickler
Bang‐Bang‐Regelung
Bang‐Bang‐Regelung
Bang‐Bang‐Regelung
Barrierekapazität
Barrierekapazität
Basis
Basis
Basis
Basis eines Industrieroboters
Basis‐Abbildungsunterstützung
Basis‐Abbildungsunterstützung
Basisadresse
Basisadresse
Basisalgorithmus
Basisalgorithmus Grundbandsignalgabe
Basisband
Basisband‐Übertragungsfunktion
Basisband‐Videosignal
Basisbetriebssystem
Basisbetriebssystem
Basisbewegungszeit
basisbezogene Variable
Basisbezugssystem (Roboterpositionierung)
Basisblockprotokoll
Basisdatendarstellung
path‐controlled robot arm, track‐controlled industrial robot ar
trajectory interpolation
trajectory checking
path curve between determination points
path planning
path planning computer (for robots)
path planning system
path position of [industrial] robot, path position of IR
path program of IR
path segment
interpolator
continuous path control, CP control, path control
path control
manipulator track control
path control of [industrial] robot, path control of IR
manipulator track control
path structure
point of support of path
path vector value
path vector value
trajectory resistance, path resistance
path state
bayonet socket
tape
beginning of tape, BT
beginning of tape marker
tape drive
bandlimited
frequency‐band limited
frequency domain
frequency range
bandwidth
optical amplifier bandwidth
parametric amplifier bandwidth
bandwidth‐limited operation
bandwidth control
strip‐width controller
bandwidth control
band‐pass filter
tape dispenser
tape controlled
tape operated
bandinductosyn of gripper arm
tape drive
band‐pass filter
band‐pass amplifier
band elimination filter
band rejection filter
band switch
tape drive
tape winder
bang‐bang control
two‐stage control
two‐step control
barrier capacity
barrier‐layer capacitance
base
basis for n‐dimensional state space
basis
robot base, IR base
basic mapping support
basic mapping support, BMS
base address
basic address
base algorithm
base algorithm baseband signalling, US: base algorithm baseba
baseband
baseband transfer function
baseband video signal
basic operating system
basic operating system, BOS
basic motion time, BMT
based variable
base reference system (robot positioning)
basic block protocol, BBP
basic data representation
stran 37 od 326
EN ‐DE: slovar avtomatizacije in robotike Basisfunktion
Basishardware
Basiskoordinate
Basiskoordinate feines Robotereffektors
Basislösung
Basisprogrammzugriffsmethode
Basisregister (eines Roboterrechners)
Basisschaltung
Basissynchronwerkzeuge
Basissystem
Basisteil (einer Robotermontage)
Basisübertragungseinheit
Basisübertragungseinheit
Basisvariable
Basisvektor
Basisverarbeitungseinheit
Basisverfahren
Basiszähleinheit
Bauart einer Greifereinheit Baueinheit
Baueinheit für Schweißroboter
Baueinheitensystem
Baueinheitensystem
Bauelement
Bauelement
Bauelement
Bauelement in bipolarer Technik
Bauelement mit Tri‐State‐Ausgang
Bauelement mit Tri‐State‐Ausgang
Bauelemente
Bauelementeanordnung feiner IR‐Montage
Bauelementebeziehung einer IR‐Montage
Bauelementedatenbank
Bauelementedimensionierung
Bauelementeeigenschaften
Bauelementeintegration
Bauelementekennwerte
Bauelementelebensdauer
Bauelementemodell
Bauelementeprüfeinrichtung
Bauelementereihenfolge"einer IR‐Montage
Bauelementetechnologie
Bauelementetester
Bauelementezuverlässigkeit
Baugruppe
Baugruppe feines Greifers
Baugruppenauswahl
Baugruppenhandhabung
Baugruppenkonstruktion
Baugruppenmontage
Baugruppenpräzisionsmontage
Baugruppenprüfung
Baugruppenprüfung
Baukasten für Handhabungstechnik
Baukastengreifer
Baukastengreifer
Baukastenkonstruktion
Baukastenkonzeption
Baukastenlösung
Baukastenprinzip
Baukastenprinzip
Baukastenprinzip
Baukastenprinzip
Baukastensystem
Baukastensystem
Baukastensystem
baumartige Datenstruktur
Baumstruktur
Baustein
Baustein
Baustein
Baustein
Baustein bloc fonctionnel
Baustein bloc fonctionnel
Baustein bloc fonctionnel
bausteinartig
basis function
basic hardware
base coordinate
effector base coordinate, base coordinate of robot effector
basis solution
basic program access method, BPAM
base register, BR (of robot computer)
common base circuit
basic synchronous tools
basic system
base part (of robot assembly)
basic transmission unit
basic transmission unit, BTU
base variable
basis vector
basic processing unit, BPU
basic approach
basic counter unit, BCU
type of gripper unit
standard component
construction unit for welding robot
construction unit system
building‐block system
component part
construction unit
structural member
bipolar device
three‐state device
tristate device hardware
components arrangement of IR‐assembly
components relation of IR‐assembly
component data bank
dimensioning of components
component characteristics
component integration
component characteristics
component life
model of component parts
component tester
components order of IR‐assembly
component technology
component tester
component reliability
assembly
assembly of gripper
sub‐assembly selection, group of parts selection
assembly handling
construction of subassembly
assembly mounting
precision mounting of components
assembly check[ing]
assembly checking]
handling technique building block
building block gripper
building‐block gripper
building block construction
building block concept
assembly unit solution
building‐block principle
principle of assembly unit
modular principle
building‐block concept
building‐block system
unit‐assembly principle (system)
construction unit system
arborescent data structure
tree structure
module
circuit element
switching element
network element
component part
construction unit
structural member
modular
stran 38 od 326
EN ‐DE: slovar avtomatizacije in robotike Bausteine
Bausteine für Digitaltechnik
Bauteil der Regelung
Bauteilaufnahme
Bauteilezuführung
Bauteilezuführung
Bauteilezuführung
Bautieldichte
Bauweise
Bauweise des Programmes
bearbeiten (durch Roboter)
Bearbeiten von Handhabungsobjekten
Bearbeitung mittels Industrieroboters
Bearbeitung von Ausnahmebedingungen
Bearbeitungsablauf
Bearbeitungsautomat
Bearbeitungsautomatisierung
Bearbeitungsfolge
Bearbeitungsmaschine
Bearbeitungsperiode
Bearbeitungsphase
Bearbeitungsschritt
Bearbeitungsstufe
Bearbeitungssystem
Bearbeitungszeit
Bearbeitungszentrum
Bedarfsdeskription
Bedarfshaltepunkt
bedeutende Information
bedienarmer Fertigungsprozess
Bediendaten pl eines Roboterprogramms
Bedienelement eines Roboters
bedienen
Bedienerbefehl
bedienerlose Werkstatt
Bedienerrufsignal
Bedienkomfort (einer Robotersteuerung)
Bedienkomfort eines IR
Bedienprogramm
Bedienprogrammkommando
Bedienprozessor
Bediensequenz
Bedientableau eines IR
Bedienung feines Roboters
Bedienungsanweisung
Bedienungselemente zur Prametereinstellung
Bedienungsfehler
Bedienungsfehler
Bedienungsmaßnahme
Bedienungspult
Bedienungspult
Bedienungsseite feines IR
Bedienungssteuerung
Bedienungstaste
Bedienungsvorschrift
bedingt konvergent
bedingt vollständiges System
bedingte Anweisung
bedingte Disjunktion
bedingte mathematische Erwartung
bedingte Operation
bedingte Sprungoperation
bedingte Stabilität
bedingte Steuerung
bedingte Vereilungsfunktion
bedingte Wahrscheinlichkeit
bedingter Befehl
bedingter Befehl
bedingter Sprung
bedingter Sprung
bedingter Sprungbefehl
bedingter Sprungbefehl
bedingter Stoppbefehl
bedingter Übergang
bedingter Übergang
bedingter Übergang der Steuerung
hardware
constituting components of numerical control
control component
element reception
alimentation of parts, feeding of parts
alimentation of parts
feeding of parts
component density
equipment engineering
configuration of the program
work to (by robot)
treatment of handling objects
processing by industrial robot
exception handling
treatment run‐off
treatment automatic machine, machining automaton
treatment automation
sequence of operation
treatment automatic machine, machining automaton
processing period
machining phase
processing step
machining step
treatment system
machining time
treatment centre
requirement description
breakpoint
considerable information
low‐operation manufacturing process
operational data of robot program
operator element of robot
operate v
operator instruction
unmanned machine shop
operator call signal
operational comfort (of robot control)
operator comfort of robot
service program
service program command
operator processor
operating sequence
teach‐in‐tableau
robot operator attenuation
instruction manual
parameter adjustment control
operating error
faulty operator intervention
action
control board
control panel
robot operating side
congestion control, CGC
control key
direction for use
conditionally convergent
conditional complete system
conditional statement
conditional disjunction
conditional mathematical expectation
conditional operation
operation of conditional transfer of control
conditional stability
automatic sequence control
conditional distribution function
conditional probability
conditional instruction
conditional order
conditional jump
conditional transfer
conditional jump instruction
conditional transfer instruction
conditional breakpoint instruction
conditional jump
conditional transfer
conditional transfer of control
stran 39 od 326
EN ‐DE: slovar avtomatizacije in robotike bedingter Überleitungsbefehl
bedingter Überleitungsbefehl
bedingter Zustand
Bedingung
Bedingung der Endregelung
Bedingungen der Realisierbarkeit
beeinflussungsfreies Kriterium
beenden
Befehl
Befehl
Befehl zur Zyklusbeendigung und Rückstellung auf Null
Befehls[verarbeitungs]einheit
Befehlsadresse
Befehlsadressenänderung
Befehlsanlage
Befehlsanlage
Befehlsanordnung
Befehlsaufbau
Befehlsaufhebung
Befehlsausführung
Befehlsausführungszeit
Befehlsbereitstellung
Befehlsdekodierer
Befehlsdekodierer
Befehlseinheit
Befehlselement
Befehlselement
Befehlsfeld
Befehlsfolge
Befehlsfolgeregister
Befehlsgerät
Befehlshauptleitung
Befehlsklassifizierung
Befehlskode
Befehlskode
Befehlsnachricht
Befehlsnachricht
Befehlsprozessor
Befehlsregister
Befehlsregister
Befehlsreihe eines Teilprogrammausschnitts
Befehlssatz
Befehlssteuerblock
Befehlssteuerung
Befehlsstruktur
Befehlssystem Befehlssystem Befehlsübertragung
Befehlsverteilerkanal
Befehlszähler
Befehlszähler
Befehlszähler
befestigen (durch Roboter)
Befestigungsglied
Befestigungsprinzipien pl
Befestigungsschraube
Befeuchtungsanlage l'humectation
Befeuchtungsausrüstung
Befeuchtungssystem
Befeuchtungswirkungsgrad
Beförderungsfehler
befreien
befreien
befreien
befriedigen
Beginn der Nachricht
Beginn des Testprogramms
Beginn des Testprogramms
Begleitprozessor
begrenzende Bedingung
begrenzende Rückkopplung
begrenzende Vorwärtswirkung
Begrenzer
Begrenzer
Begrenzer
Begrenzer
conditional jump instruction
conditional transfer instruction
conditional state
premise
final control condition
feasibility conditions
criterion of non‐interaction
terminate v
instruction
command
end cycle control and return to zero
instruction processing unit
command address, CAD
instruction address change
command device
control centre
order structure
order structure
order cancel
instruction execution, command realization
command realization time
fetch of instruction
instruction decoder
command decoder
command module
instruction element
order element
instruction array
instruction sequence
sequence‐control register
control appliance
instruction main line
instruction classification
instruction code
order code
control message
command message
command processor
instruction register
order register
coding section
command set
command control block, CCB
command control
order structure
instruction system
command system
order transmission
instruction distribution channel
control counter
control register
instruction counter
attach to, to apply (by robot)
fastening device
attachment principles
assembly screw
moistening plant
humidifying machinery
humidification system
humidification efficiency
conveying error
unlock v
unblock v
deblock v satisfy v
start of message, SOM
check program beginning
test program beginning
companion processor, coprocessor, auxiliary processor
limiting condidion
limiting feedback
limiting feed forward
clipper
limiter
restrictor
delimiter
stran 40 od 326
EN ‐DE: slovar avtomatizacije in robotike Begrenzerkennlinie
Begrenzerschaltung
Begrenzerschaltung
Begrenzerstufe
Begrenzerstufe
Begrenzerstufe
Begrenzerstufe
begrenzt durch das Detektorrauschen
begrenzte Differenz
begrenzte Einwirkung
begrenzte Größe
begrenzte Leistung
begrenzte Summe
begrenzte Variable
begrenzter Ausgang
begrenzter Eingang
Begrenzung
Begrenzung der Folgen
Begrenzung des Übergangsverhaltens
Begrenzungssymbol
Begrenzungssymbol
Begrenzungssymbol
Begrenzungssymbol
Begrenzungsvorrichtung
Begrenzungswiderstand
Begrenzungszeichen für Parameter
Begriffsbildung
behandeln
behandeln
Behandlung binärer Probleme
Behandlungsmethode
beharrend Beharrungsvermögen
Beharrungswert
Beharrungszustand
Beharrungszustand
behebbare Singularität
beherrschbare Montagesequenz
beherrschbare Robotermontage
beherrschbare Roboterregelung
Beiwert des Frequenzauflösungsvermögens
Beladeeinrichtung
Beladungsplan
Belagsdickenmessung
belanglose Information
belastbar
Belastbarkeit
Belastungsänderung
Belastungsbegrenzungswiderstand
Belastungsdauer
Belastungsdauer des Manipulatorarmes
Belastungsdauer von Roboterelementen
Belastungsdiagramm
Belastungseinfluß
Belastungseingriff
Belastungseinwirkung
Belastungsfaktor
Belastungsgrad
Belastungskennlinie
Belastungskennlinie
Belastungskurve
Belastungslinie
Belastungsmoment
Belastungspunkt
Belastungsregelung
Belastungsregler
Belastungsschwankung
Belastungsstromkreis
Belastungstest
Belastungsvektor
Belastungsvermögen
Belegbearbeitung
Belegungsdauer
Belegungsrelais
Belehrungsalgorithmus
Beleuchtungsanlage
limiter characteristic
limiter circuit
white noise limiting circuit
clipper
limiter
restrictor
delimiter
detector‐noise limited
bounded difference
limited action
limited quantity
limited power
bounded sum
limited variable
bounded output
bounded input
limiting
limitation of the consequences
performance limitation
clipper
limiter
restrictor
delimiter
limiting device
limiting resistance
parameter delimiter
concept formation
handle v
manipulate v
treatment of binary problems
processing method
steady inertia
conservative value
steady state
steady‐state regime removable singularity
controllable assembly sequence
controllable robot assembly
controllable robot regulation
frequency resolution constant
loading device
loading pattern
coating thickness measurement
dummy information
chargeable
carrying capacity
load change
load limiting resistor
load duration, duration of load
loading duration of manipulator arm
loading duration of robot elements
loading diagram
load action
load action
load action
load factor
load factor
characteristic under load
load characteristic curve
load curve
loading line
moment of load
load point
load regulation
load controller
change in load
load circuit
load test
load vector
loading capacity
document handling
holding time
busy relay
instruction algorithm
lighting installation
stran 41 od 326
EN ‐DE: slovar avtomatizacije in robotike Beleuchtungspegel
Beleuchtungsregulierung
beliebig definierte Raumkurve
beliebige Folge
beliebige Konstante
beliebige Parametervariation
Belüftungsanlage
Belüftungsanlage
Benutzerausgangsinformation Benutzerbibliothek
Benutzerkode
benutzerorientierte Robotertrajektorie
Benutzerprogramm
Benutzerstation
Benutzung der Steuerung
Benutzungsdauer
Benzindruckmesser
beobachtbares System
Beobachtbarkeit
Beobachtbarkeitsmatrix
beobachten
Beobachterfehler
Beobachtung
Beobachtung
Beobachtungsfehler
Beobachtungsfehlergleichung
Beobachtungsmatrix
Beobachtungsmodell
Beobachtungsnormalform
Beobachtungsvektor
berechnen
berechnen
berechnete Gasgeschwindigkeit
berechnete Leistung
berechnete Roboterbahnsegmente npi
berechnete Roboterkinematik
berechnete Robotertrajektorie Berechnung
Berechnung
Berechnung der Gelenkreaktion
Berechnung von Integralen
Berechnungsalgorithmus
Berechnungsinitialisierung
Berechnungsinitialisierung
Berechnungsmathematik
Berechnungsmethode
Berechnungsprinzip
Berechnungsprinzip
Berechnungssystem
Bereich
Bereich für die zulässigen Abweichungen
Bereich höchster Strommessergenauigkeit
Bereichsinstellung
Bereichsinstellung
Bereichssteuerungstask
Bereichssteuerzentrale
Bereichsumschaltung
Bereichsumschaltung
Bereitschaftsbetrieb
Bereitschaftsbetriebsstrom Bereitschaftssystem
Bereitschaftssystem
Bereitschaftszustand
Bereitschaftszustand
Bereitserweiterung
Bereitstellung von Werkstücken
Bereitstellungsmethode
Bergbauroboter
Berichtigung
Berichtigungsangaben
Berichtigungsbefehl
Berichtigungsfaktor
Bernoullische Gleichung
beruhigen
Beruhigungszeit
Berührungselement
illumination level
lighting control
arbitrary definite space curve
arbitrary sequence
arbitrary constant
random parameter variation
air ventilation system
fan system
user exit information
user library
user code
user‐oriented robot trajectory
user program
user station
use of control period of use
gasoline pressure gauge
observable system
observability
observability matrix
observe v
personal error
observer
observer based control
observer‐error
observer‐error state equation
observer matrix
observer model
observable canonical form
observer vector
calculate v
compute v
calculated gas velocity
calculated power
calculated robot path segments
calculated robot kinematics
calculated robot trajectory
calculation
computation
calculation of joint reaction
evaluation of integrals
calculation algorithm
calculation initialization
computation initiation
calculus mathematics
calculation method
calculation principle
computing principle
computing system
range
region of admissible deviations
accurate current range of a meter
band adjustment
range adjustment
region control task
area control centre, ACC
range changing
range switching
standby mode
standby current backup system
standby system
standby condition
standby status
range extension
making available of work‐pieces
method of solutions sewing
mining robot
corrective action
correction data
adjustment instruction
correction factor
Bernoulli equation
deenergize
damping time
contact element, contact piece
stran 42 od 326
EN ‐DE: slovar avtomatizacije in robotike Berührungselement
Berührungselement
Berührungselement
berührungsfreier Drehzahlmesser
berührungsfreies Messverfahren
Berührungskontakt
berührungslose
berührungslose
berührungslose
berührungslose Dichtemessung
berührungslose Dickenmessung
berührungslose Zeigerabtastung
berührungsloser Sensor
Berührungssensor
Berührungssensor eines IR
Berührungssensorsystem
Berührungsspannungsmesser
beschichtete Sensorfaser
Beschicken eines IR
Beschickung
Beschickungsaufgabe (eines Roboters)
Beschickungseinrichtung
Beschickungsfaktor
Beschickungskoeffizient
Beschickungsmanipulator
Beschickungsmanipulator
Beschickungsmanipulator
Beschickungsprogramm
Beschickungsroboter
Beschickungsschema
Beschickungssystem
Beschickungstechnik
Beschickungsvorrichtung
Beschickungsweise
Beschickungszyklus
beschleunigen
Beschleuniger
beschleunigte Prüftechnik
beschleunigter Speicheradapter
beschleunigter Speicheradapter
beschleunigter Speicheradapter
Beschleunigung
Beschleunigungsabweichung
Beschleunigungsanzeiger
Beschleunigungsaufnehmer
Beschleunigungsaufnehmer
Beschleunigungsaufnehmer
Beschleunigungsbetrag
Beschleunigungselektrode
Beschleunigungsfehlabgleichung
Beschleunigungsfühler
Beschleunigungsfühler
Beschleunigungsfühler
Beschleunigungskonstante
Beschleunigungsmesser
Beschleunigungsmessung
Beschleunigungsphase eines Roboters
Beschleunigungsraum
Beschleunigungsregler
Beschleunigungsrelais
Beschleunigungssensor eines Roboters
Beschleunigungsspannung
Beschleunigungsstörung
Beschleunigungsträgheit
Beschleunigungsverzögerung
Beschleunigungswandler
Beschleunigungswert
Beschleunigungszeit (eines Roboters)
beschränkt
beschränkte Ausgangsgröße f
beschränkte Eingangsgröße f
beschreibbarer Steuerspeicher
beschreibendes Modell
Beschreibungsdatei
Beschreibungsfunktion
Besetztrelais
contact member
contact element
contact piece
touchless revolution counter
non‐contact measurement technique
tangential contact
contactless pick‐up
non‐contact feeler device
non‐contacting sensor
non‐contacting density measurement
non‐contacting thickness gauging
contactless scanning of pointers
non‐contacting sensor
contact sensor
robot contact sensor, IR contact sensor
contact sensor system
contact voltmeter
coated sensor fibre
feeding of IR, loading (charging) of IR
loading
loading task (of robot), feeding task
loading device
load factor
charge coefficient
charging manipulator, loading handler
charging manipulator
loading handler
charging program
feeding robot, charging (loading) robot
loading pattern
feed[ing] system
loading technique
feeding equipment
method of charging
charging cycle
accelerate v
accelerator
accelerated test technique
accelerated storage adapter
ASA, accelerated memory adapter, accelerated memory adapte
accelerated memory adapter
acceleration
acceleration misalignment
acceleration indicator
acceleration gauge
acceleration pickup
acceleration sensitive element
acceleration value
accelerating electrode
acceleration misalignment
acceleration gauge
acceleration pickup
acceleration sensitive element
acceleration constant
accelerometer
acceleration measurement
acceleration phase of robot
acceleration space
acceleration controller
accelerating relay
acceleration sensor, accelerating sensor (of robot)
accelerating voltage
acceleration misalignment
acceleration lag
acceleration lag
acceleration transducer
acceleration value
acceleration time (of robot)
bounded
bounded output
bounded input
writable control store
descriptive model
description file
describing function
busy relay
stran 43 od 326
EN ‐DE: slovar avtomatizacije in robotike Besetztsignal
besonderes System
Bessel‐Funktion
bestimmungsgemäßer Betrieb
Bestimmungsgleichung
Bestimmungsmethode
Bestkodierung
Bestückungskopf
Bestückungsroboter
Bestzeitprogramm
Bestzeitprogramm
betätigen
Betätigung durch Stellmotor
Betätigung einer Schutzeinrichtung
Betätigung mit Kraftantrieb
Betätigungsfolge
Betätigungsgröße
Betätigungsimpuls
Betätigungsimpuls
Betätigungsimpuls
Betätigungsorgan
Betätigungsorgan
Betätigungsorgan
Betätigungsorgan
Betätigungsorgan
Betätigungssignal
Betätigungssystem
Betätigungsvorrichtung
Betätigungszeichen
betonen
betonen
Betrachtungsweise
Betragsoptimum
Betragsregelfläche
betreiben
Betrieb in mehreren Arbeitsweisen
Betrieb mit Vorbereitung
Betrieb oberhalb der Schwelle
Betrieb von Anlagen
betriebliches Abfahren
Betriebsanleitung
Betriebsart
Betriebsart des Informationsaustausches
Betriebsart einer Arithmetik‐Logik‐Einheit
Betriebsart eines Nachrichtensystems
Betriebsartenänderung
Betriebsarteneinstellung
Betriebsartenschalter
Betriebsartenwahlschalter
betriebsbedingte Abschaltung
betriebsbedingter Fehler
betriebsbedingter Fehler
Betriebsbedingungen
Betriebsbereitschaft
Betriebsbereitschaft
betriebsbezogener Schaden
Betriebscharakteristik
Betriebscharakteristik
Betriebsdaten pl
Betriebsdaten pl
Betriebsdaten pl
Betriebsdaten pl eines Robotersteuerungssystems
Betriebsdiagnostik
Betriebsdruck
Betriebsdruck
Betriebseinspeisung
Betriebseinspeisung
Betriebseinstellung
Betriebserfahrungen
betriebsfähig
betriebsfähig
Betriebsfähigkeit
Betriebsfähigkeit
Betriebsfaktor
Betriebsfehler
Betriebsfehler
busy signal
particular system
Bessel function
normal operation
defining equation
method of determination
optimum coding
mounting head
mounting robot, assemblage robot, industrial robot for mount
minimum access routine
optimally coded program
actuate v
power operation
protective equipment operation
power operation
operation sequence
actuating quantity
actuating pulse
control pulse
driving pulse
actuating appliance
actuating unit
regulating element
effector
regulating unit
actuating signal
actuating system
actuating device
acknowledge[ment] signal
accentuate v
emphasize v
approach
amplitude optimum
integral of absolute value of error (IAE)
operate v
multimode operation
delay basis operation
above‐threshold operation
plant operation
operational shutdown
operating instruction
operation mode
communication mode
operation mode of arithmetic‐logic unit, ALU‐mode of operatio
communication system mode
mode change
adjusting of mode of operation
operating mode switch
operating mode switch
operational shutdown
abuse
operation error
operating conditions
operability
operational capability
operation's related defect
operating characteristic
working characteristic
operating values, operating data
operating values
operating data
functioning values of robot control system, operating values o
operational diagnostics
operating pressure
working pressure
process feed
operational feed
operating adjustment
operating experience
operable
workable
operability
operational capability
duty factor
abuse
operation error
stran 44 od 326
EN ‐DE: slovar avtomatizacije in robotike Betriebsfernmeldung
Betriebsforschung
Betriebsfrequenz
Betriebsgrenze
Betriebsinformationssystem
Betriebsinstrument
Betriebskennwert
Betriebskoeffizient
Betriebskondensator
Betriebskondensator
Betriebskontrolleinrichtung mit Datenabtastung
Betriebslast
Betriebsleistung
Betriebsmanometer
Betriebsmesstechnik
Betriebsmittelüberwachung Betriebsoptimierung
Betriebspunkt
Betriebsrechnersystem
Betriebsschema
Betriebssicherheit eines Industrieroboters
Betriebssicherheit service
Betriebssicherheit service
Betriebsspannung
Betriebsspannung
Betriebsstellung
Betriebsstellung
Betriebsstellung
Betriebsstörung
Betriebsstörung
Betriebsstrom
Betriebssystem
Betriebssystem (für Robotersteuerung)
Betriebssystem für alphanumerische Datenendstellen
Betriebssystemsoftware (eines Roboterrechners)
Betriebstemperaturbereich
Betriebstransiente
Betriebstüchtigkeit
Betriebstüchtigkeit
Betriebsüberwachung
Betriebsüberwachungsgeräte
Betriebsüberwachungsgeräte
Betriebsüberwachungsgeräte
Betriebsweise
Betriebswinkel
Betriebswirkungsgrad
Betriebswissenschaft
Betriebszustand
Betriebszustand
Betriebszustand
Betriebszustand
Betriebszustand
Betriebszustandsüberwachung
Bettführungsbahn
Bettführungsbahnen mit gehärteten Stahlleisten
Beugungsfinger
bevorzugte Roboterorientierung
bewegbarer Greiferbacken
Bewegen eines Bauteils
bewegliche Ladung
beweglicher (fahrbarer) Roboter
beweglicher Einfügekopf
beweglicher Erfassungssensor
beweglicher Kopf
beweglicher Manipulatorschlitten
beweglicher Sensor
bewegliches Festkörperglied bewegliches Robotermagazin
bewegliches System
Beweglichkeit des Manipulators
Beweglichkeitsgrad
Beweglichkeitsgrad eines IR
Bewegung
Bewegung eines Transportbandes
Bewegungsablauf
Bewegungsachse
industrial remote signalling
industrial research
operating frequency
operating limit
operating information system
industrial instrument
operating parameter
operation factor
operating condenser
process condenser
monitoring machine with scanning
rated capacity
operating power
operating gauge
production measuring technique
supervision of production facilities operating optimization
operating point
plant computer system
engineering flow sheet
operation safety of industrial robot, reliability in service of ind
equipment reliability
safety of operation
operation voltage
normal voltage
working position
operative position
operating position
operating trouble
service failure
process stream
operating system
operation system (for robot control)
alphanumeric terminal executive, ANTEX
operating system software (of robot computer)
operating temperature range
operational transient
operability
operational capability
production control
process instrumentation
monitoring instrumentation
monitoring equipment
mode
operating angle
operating efficiency
management science
operating state
operational condition, working condition
operational condition
operating status
working condition
operational condition monitoring
bed way, bed slide way
bed ways equipped with hardened steel gibs
diffraction finger
preferred robot orientation
movable gripper jaw
movement of element
mobile charge
mobile robot
mobile insertion head
mobile acquisition sensor
moving head
mobile manipulator sled, mobile manipulator carriage
mobile sensor
mobile solid[‐state] element mobile magazine of robot
moving system
manipulator mobility, mobility of manipulator
mobility degree
degree of mobility of IR, robot mobility degree
motion
movement of conveying belt
sequence of motions
movement axis
stran 45 od 326
EN ‐DE: slovar avtomatizacije in robotike Bewegungsanfangspunkt
Bewegungsbedingung"eines Werkstücks
Bewegungsbedingung eines !R
Bewegungsbefehl
Bewegungsbefehl eines Manipulators
Bewegungsbefehl eines Roboters
Bewegungsbegrenzung
Bewegungsbegrenzung
Bewegungsbereich eines Greifers
Bewegungseinheit
Bewegungseinheit eines Greifers
Bewegungsendkontrolle (des Manipulatorarms)
Bewegungsendpunkt
Bewegungsführung
Bewegungsgleichung
Bewegungsgleichung
Bewegungsgleichung
Bewegungsglied
Bewegungsgröße eines IR
Bewegungskoordinatensystem
Bewegungsparameter eines Greifers
Bewegungsposition
Bewegungsprogramm einer IR‐Software
Bewegungsprogrammierung
Bewegungspunkt (einer Greiferbahn)
Bewegungspunktprogrammierung
Bewegungsraum eines Roboters
Bewegungsschritt
Bewegungsschritt eines Industrieroboters
Bewegungssequenz
Bewegungssimulation
Bewegungsstabilität
Bewegungssteuerung
Bewegungssteuerung (eines
Bewegungsstopp
Bewegungsstopp eines Roboters
Bewegungsstrategie
Bewegungsverhalten
Bewegungszyklus
Bewegungszyklus eines .IR
Bewegungszyklus eines Manipulators
Beweismethode
Bewertung
Bewertung
Bewertungsergebnis einer Robotermontage
Bewertungsfaktor
Bewertungsgröße
Bewertungsmethoden
Bewertungsmodell
Bewertungssteuerung
Bewertungstest
Bewilligungsebene
bezeichnen
Bezeichnung der Bewegungsachsen
Beziehung
Beziehung zwischen Manipulator und Speicher
bezogene Genauigkeit
bezogene Größe
bezogene Größe
bezogene Größe
bezogener Regelbereich
Bezugsangaben
Bezugsdämpfung ### Übertragungssystems
Bezugsdaten pl
Bezugselement
Bezugsgerät
Bezugsgröße
Bezugsgröße
Bezugsmenge
Bezugspegel
Bezugspunkt
Bezugsrückkopplung
Bezugssignal
Bezugsspannung
Bezugsspannungsstabilisator
Bezugssystem
initial point of movement
movement condition of condition of movement of IR, robot movement condition
movement instruction
manipulator movement instruction
robot movement instruction
movement ifmitation
movement limitation
region of gripper motion (movement)
movement unit, motion unit
movement unit of gripper, motion unit of gripper
checking of movement finish (of manipulator arm)
end point of movement
movement guiding
equation of motion
equation of motion, motion equation
motion equation
joint, acting element
movement quantity of tR, motion quantity of IR
movement coordinate system
gripper movement parameter
movement position
movement program of IR~ software, motion program of IR‐so
movement programming
movement point, point of movement
programming of movement points
space of movement of robot
movement step
robot movement step, industrial robot movement step
movement sequence
simulation of movement
movement stability
movement control
movement control (of manipulator)
movement stop
robot movement stop
movement strategy
behaviour of motion
welding robot movement cycle
movement cycle of IR, robot movement cycle
manipulator movement cycle, handler movement cycle
method of proof
appreciation
evaluation
valuation result of robot assembly
evaluation factor
evaluation quantity
evaluation methods
evaluation model
evaluation control
rate test
compliance level
identify v
marking of axis
relation[ship]
memory‐manipulator relation, store‐manipulator relation
calibrated accuracy
dimensionless coefficient
dimensionless value
non‐dimensional value
relative control range
reference data
effective transmission equivalent
reference data
reference element
reference instrument
reference quantity
reference value
reference quantity
reference level
reference point
reference feedback
reference signal
reference voltage
reference voltage stabilizer
reference system
stran 46 od 326
EN ‐DE: slovar avtomatizacije in robotike Bezugstaktgeber
Bezugswicklung
Biaxspeicherelemente für Programmspeicher
bidirektionaler Koppler
Biegeverlagerung eines IR
biegsame Abdichtung
biegsamer Antrieb eines Industrieroboters
biegsamer Roboterantrieb
bikonischer Taper
Bilanzgleichung
Bilanzierungsvariable
bilateraler Wandler
bilaterales Schaltelement
bilaterales Servosystem
bilaterales Servosystem
Bild
Bild Verarbeitungsmodul
Bildanalyse
Bildanalysesoftware
Bildaufnahme durch Sensor
Bildauswertesystem
Bilddsignalamplitude
Bildeingabeinterface
Bilderfassung
Bilderkennung
Bildfeldzerlegung
Bildfeldzerlegung
Bildfeldzerlegung
Bildflächensensor
Bildgleichrichter
Bildimpuls
Bildprozessor
Bildschirm eines IR
Bildschirmeinheit
Bildschirmeinheit
Bildschirmgerät
Bildschirmkonsole
bildschirmorientierte Datenstruktur
bildschirmorientierte Datenstruktur vision
bildschirmorientierter Arbeitsplatz
Bildschirmprogramm
Bildschirmterminal
Bildschirmüberwachung
Bildsensor
Bildsignal
Bildsignalamplitude
Bildsignalverarbeitung
Bildspeicher
Bildspeicherrahmen
Bildspeicherung
Bildspeicherzugriff
Bildsteuerung
Bildsystem
Bildübertrager
Bildübertragung der Stufenfunktion
Bildung der Konjunktion
Bildverarbeitung
Bildverarbeitungsmodul
Bildverarbeitungssystem
Bildvermessung
Bildvermessung
Bildvermessung
Bildvorbehandlung
Bildwandlerchip
Bildwandlerröhre
Bildwandlersystem
Bilinearform
Bilineartransformation
Binär‐ Dezimal‐Umwandlung
binär kodierte Zahl
binär kodierte Zahl
Binärbild
Binärbilderzeugung
Binärdarstellung
Binär‐Dezimalkonvertierung
binäre Aufzeichnung
reference clock
reference winding
bias storage elements for program registers
bidirectional coupler
bending displacement of IR
flexible sealing
flexible robot drive, flexible IR drive
flexible robot drive, flexible IR drive
biconical taper
balance equation
balancing variable
bilateral transducer
bilateral switching element
bilateral servosystem
bilateral servo‐system
image
image processing module
image analysis
image analysis software
vision pick‐up by sensor
picture evaluation system
video amplitude
image input interface
image acquisition
image identification
balayage
scanning
exploration
image area sensor
video detector
frame impulse
image processor
robot display
display device
display unit
screen device
display console
screen‐oriented data structure
screen‐oriented data structure
screen‐oriented workplace
display program
screen terminal
screen monitoring
image sensor
picture signal
picture signal amplitude
image signal processing
image memory, image store
frame of image storage
image storage
image memory access, image store access
picture control
visibility system
image translator
step function transformation conjunction operation
image processing
image processing module
image processing system
photogrammetry
picture measuring
image measuring
image pretreatment
optical image chip
image converter tube
image transducer system
bilinear form
bilinear transformation
binary‐[to‐]decimal conversion
dual‐coded number
binary‐coded number
binary image
production of binary image
binary representation
binary‐[to‐]decimal conversion
binary recording
stran 47 od 326
EN ‐DE: slovar avtomatizacije in robotike binäre Information
binäre Operation
binäre PCM‐Modulation
binäre Schreibweise
binäre Skalenschaltung
binäre Struktur
binäre synchrone Kommunikation
binäre synchrone Kommunikation
binäre synchrone Steuerung
binäre synchrone Steuerung
binäre Übertragung
binäre Zahlendarstellung
binäre Ziffer
binäre Ziffer
Binärelement
binärer arithmetischer Rechner
binärer Ausgang
binärer Automat
binärer Befehl
binärer Befehl
binärer Digitalrechner
binärer symmetrischer Kanal
binärer Tastsensor
binäres Ausgangssignal
binäres Informations‐ und Steuersignal binäres Problem
binäres Signal
binäres Signal
binäres Speicherglied
binäres Suchen
binäres Suchverfahren
binäres Symbol
Binärgeber
Binärgewicht
Binärkette
Binärkode
Binärkomma
Binär‐Reflex‐Kode
Binärsensor
Binärskale
binär‐synchrone Übertragung f(von Roboterdaten)
Binärsystem
Binärwerte
Binärziffer
Binärziffer
Bindefähigkeit
Bindungsenergie
Bindungsenergie
Bindungsenergiedichte
Binghamsches Modell
Binomialkoeffizient
Binomialsatz
binomischer Koeffizient
Bin‐Picking‐Roboter
biochemischer Sensor
Biocomputer
Biocomputer
Biofilmreaktor
Bio‐Hand feines IR
Biokybernetik
Biokybernetik
biologische Simulation
biologischer Sensor
biologisches Informationssignal
biologisches System
biometrische Identifizierungssysteme
Bionik
Bionik
Bioniksystem
bionische Simulation
bionisches System
Bipolarbaustein
bipolarer Festwertspeicher m
bipolarer mikroprogrammierter Mikrorechner
bipolarer mikroprogrammierter Mikrorechner
bipolarer Mikroprozessor
binary information
binary operation
binary pulse‐code modulation
binary notation
binary scaling circuit
binary structure
binary synchronous communication
binary synchronous communication, BSC
binary synchronous control
binary synchronous control, BSC
binary translation
binary notation
binary digit
bit
binary element
binary arithmetic computer
binary output
binary automaton
binary command
binary signal
binary digital computer
binary symmatric channel
binary touch sensor
binary output signal
binary information and control signal
binary problem
binary command
binary signal
binary storage element
binary look‐up
binary search method
binary symbol
binary sensor
binary weight
binary chain
binary code
binary point
binary reflex‐code
binary sensor
binary scale
binary synchronous transmission (of robot data)
binary number system
binaries
binary digit
bit
binding property
binding energy
linking energy
cohesive energy density
Bingham model
binomial coefficient
binomial theorem
binomial coefficient
bin‐picking robot
biochemical sensor
biological computer
biocomputer
biofilm reactor
bio‐hand of IR, robot bio‐hand
biocybernetics
bionics
biologic simulation
biological sensor
biological information signal
biologic system
biometric identification systems
biocybernetics
bionics
bionic system
bionic simulation
bionic system
bipolar device
bipolar read‐only memory,
bipolar microprogrammed microcomputer
bipolar micro‐programmed microcomputer
bipolar microprocessor
stran 48 od 326
EN ‐DE: slovar avtomatizacije in robotike bipolarer Nur‐Lese‐Speicher
bipolarer Transistor (einer Robotersteuerung}
bipolares Scheibenelement
Bipolarschaltkreis
Bipolartechnik
Biprozessorsystem
Biprozessorsystem
bistabile Einrichtung
bistabile Kippschaltung
bistabile Schaltung
bistabiler Multivibrator
bistabiles Element
bistabiles Impulsrelais
bistabiles Lasergerät
bistabiles optisches Element
Bit
Bit
Bitaper
Bitdichte
Bitfolgefrequenz
Bitgeschwindigkeit
Bitkontrolle
Bitmarke
Bitmarkenfolge
Bitniveau
Bits pro Sekunde
Bits pro Zoll
Bitscheibenrechner
Bitstand
Bit‐Übertragungsgeschwindigkeit
Bitverkehr
Blackbox
Blackbox‐Analyse black‐box
Blackbox‐Methode
Blasenspeicherbaustein
bleibende Regelabweichung
bleibende Regelabweichung
bleibende Regelabweichung
bleibende Regelabweichung
bleibende Regelabweichung bleibende Ungleichförmigkeit
bleibendes Hauptsteuerprogramm permanent
Blinddiagrammpaneel
Blindleistungsmesser
Blindleistungsmessung
Blindstromverbrauchsmesser
Blindstromverbrauchsmesser
Blindwiderstand
Blinksignal
Block
Block[ier]generator
Block[ier]generator
Blockadresse
Blockanpassung
Blockaustausch
Blockaustausch
Blockbild
Blockbild
Blockbild
Blockbild‐Compiler
Blockdiagramm
Blockierbefehl
Blockierdetektor
Blockierimpuls
Blockierimpuls
Blockierkondensator
Blockierkontakt
Blockierschaltung
Blockiersignal
Blockiersignal
Blockierung
Blockierung
blockierungsfrei
blockierungsfreie Anordnung
Blockierverstärker
Blocklänge
BROM, bipolar fixed memory
bipolar transistor (of robot control)
bipolar slice element
bipolar integrated circuit
bipolar technique
biprocessor system
Bi‐processor system
bistable device
trigger pair circuit
bistable circuit
bistable multivibrator
bistable element
bistable pulse relay
laser bistable device
bistable optical element
binary digit
bit
biconical taper
bit density
bit rate, BR
bit rate, BR
bit check
bit mark
bit mark sequencing, BMS
bit level
bits per second, BPS
bits per inch, BPI
bit disk computer
bit level
bit rate
bit traffic
black box
black‐box method
black‐box method
bubble [memory] chip
droop
offset
offset steady‐state deviation
steady‐state error
sustained deviation permanent droop
permanent main control program
mimic diagram panel
varmeter
reactive power measurement
reactive‐energy meter
var‐hour meter
reactance
flashing signal
block
blocking generator
blocking oscillator
block address
block adaptation
block changing
block changing, BCH
block diagram
schematic diagram
functional block diagram
block diagram compiler
block diagram
blocking order
lock‐in detector
blocking impulse
disabling pulse
blocking capacitor
blocking contact
clamping circuit
inhibiting signal
disabling signal
blocking
interlock[ing]
nonblocking
nonblocking configuration
lock‐in amplifier
block size
stran 49 od 326
EN ‐DE: slovar avtomatizacije in robotike Blockname
blockorientierte Simulation
blockorientierte Struktur
blockorientierter Rechner
blockorientierter wahlfreier Zugriff
blockorientierter wahlfreier Zugriff
Blockprotokoll
Blockprüffolge
Blockschaltbild
Blockschaltbild
Blockschaltbild
Blockschalter
Blockschema
Blockschema
Blockschema
Blocksignal
Blockstromkreis
Blockstromkreis
blockweise Verarbeitung
Blockzeichnung f
Blockzeichnung f
Blockzeichnung f
Bode‐Diagramm
BODE‐Diagramm
BODE‐Diagramm
Bode‐Methode
bohren (durch Roboter)
bohren (durch Roboter)
Bohrroboter für gedruckte Schaltungen
Bolometer
bolometrisches Instrument
Boltzmann‐Konstante
Boltzmannsches Superpositionsprinzip
Bolzenfügesystem
Bondgeschwindigkeit thermocompression
Boolesche Algebra
Boolesche Algebra
Boolesche Algebra
Boolesche Darstellung
Boolesche Funktion
Boolesche Logik
Boolesche Logik
Boolesche Rechnungsart
Boolesche Variable
Boolescher AL‐Ausdruck
Boolescher Prozessor
Boolescher Wert
Bordrechner
Box‐Jenkins‐Modell
Box‐Jenkins‐Modell
Brandbekämpfungsroboter
brauchbarer Bereich Braunsches Elektrometer
Breaksignal
Breaksignal
Breitbandfilter
Breitbandfilter
breitbandiges Fernmeldesystem
breitbandiges Infrarotsystem
Breitbandimpulsverstärker
Breitbandmodulation
Breitbandoszillograf
Breitbandregler
Breitbandtemperaturregler
Breitbandverstärker
Breitbereichregler
Breiteneinstellung
Breitwinkelkoordinator
Bremsdynamometer
Bremsdynamometer
Bremselement
Bremsventil
Brennschneidautomat
Brennschneidautomat
Brettschaltung
BROM
block name
block‐oriented simulation
block‐oriented structure
block‐oriented computer, BOC
block‐oriented random access
block‐oriented random access, BORAM
block protocol
block check sequence
block diagram
schematic diagram
functional block diagram
gating switch
block diagram
schematic diagram
functional block diagram
blocking signal
blocking circuit
interlock circuit
batch processing
block diagram
schematic diagram
functional block diagram
Bode diagram
Bode plot
frequency response graph
Bode method
bore to
drill to (by robot)
drill robot for printed circuits
bolometric instrument
bolometric instrument
Boltzmann constant
Boltzmann's superposition principle
joint system of bolt
bonding speed
Boolean logic
algebra of logic
Boolean algebra
Boolean representation
Boolean function
Boolean logic
crisp logic
Boolean calculation
Boolean variable
Boolean AL expression
Boolean processor
Boolean value
board computer
BJ‐model
Box‐Jenkins model
fire‐fighting robot
usable range Braun electrometer
interrupt[ing] signal
break signal
all‐pass filter
all‐pass element
wideband communication system
wide‐passband infrared system
wideband pulse amplifier
broadband modulation
wideband oscillograph
wideband controller
wide range temperature controller
broadband amplifier
wideband controller
width adjustment
wide‐angle coordinator
absorption dynamometer
brake dynamometer
braking element
brake valve
automatic flame‐cutting machine
automatic gas‐cutting machine
breadbord circuit
BROM, bipolar fixed memory
stran 50 od 326
EN ‐DE: slovar avtomatizacije in robotike Brückendetektor
Brückengleichgewicht
Brückenkreis mit Nullanzeige
Brückenmessungen
Brückenmethode
Brückenschaltung
Brückenschaltung
Brückenstruktur
Brummspannung
Brummspannungsdifferenz
Brummspannungsverhältnis
Buchsenfeld
Buchstabe
Buechesches Modell
Burgers‐Frenkelsches Modell
Busaufruf
Busfamilie
Busfreigabe
Buskommunikationskarte
Buslogik
Buslogik zur Behandlung vektorisierter Unterbrechungen
Busoperation
Busorganisation (eines Roboterrechners)
busorganisierte Struktur
Busprioritätssteuerung
Busprotokoll
Busschienensystem
Busschnittstelle
Bussteuerschaltkreis
Bus‐steuerschaltkreis
Bussteuerschaltung
Busstruktur
busstrukturiertes System
Bussynchronisationstakt
Bussystem
Bustakt
Bustakt
Busverbindung
Busverkehr
Busvermittlungssignal
Buszuweisung
Byte
Bytebetrieb
Bytegeschwindigkeit
Bytegrößensteuerung
byteorientierter Rechner
Byterechner
Byte‐Seriendaten pl bytes
Bytespezifizierung
Bytestrom
Bytestromprotokoll
byteweiser Betrieb
Cachespeicher‐Steuerregister
CAD
CAD manufacturing s 2870
CAD manufacturing s 2870
CAD manufacturing s 2870
CAD‐Bibliothek
CAD‐Technik ordinateur
Carnot‐Wirkungsgrad
Cauchy‐Folge
Cauchysche Lineargleichung
Cauchy‐Schwarzsche Ungleichung
Cayley‐Hamiltonsches Theorem
CCD‐Bauelement
CCD‐Kamera
CCD‐Sensor
CCD‐Sensor
CCD‐Sensor
Chapman‐Kolmogoroffsche Gleichung
Charakterisierung von logischen Schaltungen
Charakteristik
Charakteristik
Charakteristikenmethode
charakteristische Angaben des Rechners
charakteristische Funktion
bridge detector
bridge equilibrium
null‐type bridge circuit
bridge measurements
bridge method
bridge circuit
bridge connection
bridge structure
ripple voltage
ripple potential difference
percent ripple voltage
jack panel
alphabetic character
Bueche model
Burgers‐Frenkel model
bus enable, BUSEN
bus family
bus enable, BUSEN
communication card for bus
bus logic
bus vectored interrupt logic
bus operation
bus organization (of robot computer)
bus‐organized structure
bus priority control
bus protocol
bus bar system
bus interface
bus control circuit
bus control circuit
bus control circuit
bus structure
bus‐structured system
bus clock
bus system
bus clock
bus dock
bus connection
bus traffic
bus exchange signal
bus allocation
byte
byte mode
byte rate
byte size control
byte‐oriented computer
byte‐oriented computer
byte serial data
byte specification
byte stream
byte stream protocol
byte mode
cache control register
computer‐aided drafting and design, CAD, computer‐aided des
computer‐aided design
CAD
computeraided conception
computer‐aided design library
computerized design technique
Carnot efficiency
Cauchy sequence
Cauchy's linear equation
Cauchy‐Schwarz inequality
Cayley‐Hamilton theorem
CCD‐component
CCD camera
charge‐coupled device sensor, CCD‐sensor
charge‐coupled device sensor
CCD‐sensor
Chapman‐Kolmogoroff equation
characterization of logic circuits
characteristic
characteristic curve
characteristic method
characteristic data of computers
characteristic function
stran 51 od 326
EN ‐DE: slovar avtomatizacije in robotike Charakteristische Funktion einer Menge
Charakteristische Gleichung
charakteristische Gleichung
charakteristische Limitfunktion
charakteristische Roboterflexibilität
charakteristische Servomechanismuskonstanten
charakteristische Zeit
charakteristischer Abstand
charakteristisches Gleichungssystem
charakteristisches Polynom
charakteristisches Polynom
chargenweise
Chargierung
chemische Verfahrenstechnik
chemisch‐technologisches System
chemisch‐technologisches System
Chip eines SRAM‐Speichers
Chipauswahlsignal
Chipklebeautomat
Chipkleben durch Roboter
chromatografisches Analysiergerät
Chrominanz‐Austastkreis
Clausius‐Rankine‐Prozess
Clipper
Clipper
Clipper
Clipper
CNC für IR
CNC‐Komponente eines IR
Coanda‐Effekt
Compiler
Compiler
Compiler einer Robotersoftware
Compiler‐Beschreibungssprache
Compiler‐Programmübersetzung
Compiler‐Simulation
Compiler‐Zwischenkode
Compoundierung von Elektromaschinen
Computer
Computer
Computer
Computer
Computer für Qualitätskontrolle
Computer für Reaktortechnik
Computeranimation
Computerarbeitsmodell
Computerbauelemente
computergesteuertes Anheben von Stoffballen
computergestützte Diagnostik
computergestützte Fertigung production computergestützte Herstellung
computergestützte Steuerdatenerzeugung
computergestützte Untersuchung
Computergrafik
Computergrafik
Computergrafikanwendung
computergrafisches Arbeitsmodell
Computerindustrie
Computerterminal
computerunterstützte Verfahrenserkennung ordinateur
computerunterstützter Entwurf
computerunterstützter Entwurf
computerunterstützter Entwurf
computerunterstütztes Ingenieurwesen
Copy‐Prüfung
Coulombsche Reibung
Coulombsche Reibung
CP‐Robotersteuerung
CP‐Steuerung
Cramersche Regel
Cross‐Assemblierung
Cross‐Entwicklungssystem
Cross‐Simulation‐Testsystem
Cross‐Simulator
CRST
D > 1
characteristic function
characteristic equation
eigenvalue equation
limiting characteristic function
characteristic robot flexibility
servomechanism characteristic constants
characteristic time
characteristic spacing
characteristic equation system
characteristic polynom
characteristic polynomial
batchwise
batching
chemical process engineering
chemical‐technological system
chemical process system
SRAM‐chip, chip of static random access memory
chip select signal
chip adhering automaton
adhering of chips by robot
chromatographic analyzer
burst gating circuit
Clausius‐Rankine process
clipper
limiter
restrictor
delimiter
computerized numerical control of IR
CNC‐component of IR
Coanda effect
compiled program
compiler
compiler of robot software
compiler description language, CDL
compiler program translation
compiling simulation
compiler intermediate code
electric machine compounding
computer
computing machine
calculating machine
calculator
computer for quality control
computer for reactor engineering
computer animation
computer operation model
computer hardware
computer‐controlled lifting of cloth bales
computer‐assisted diagnostics
computer‐aided manufacturing
computer‐aided production
computer‐aided control data generation
computer‐aided investigation
computer graphic
computer graphics
computer graphics application
computer‐graphical operation model
computer industry
computer terminal
computer‐aided process identification
computer‐aided design
CAD
computeraided conception
computer‐aided engineering
copy check
Coulomb friction [force]
dry friction
continuous path robot control
continuous path control, CP control, path control
Cramer's rule
cross‐assembly (by assembler)
cross‐development system
cross‐simulation testing] system, CRST
cross simulator
cross‐simulation testing] system, CRST
aperiodic damping
stran 52 od 326
EN ‐DE: slovar avtomatizacije in robotike D > 1
overdamped
Daisy‐Chain‐Interruptbedienung
daisy‐chain interrupt servicing
daisy‐chain priority interrupt logic
Daisy‐Chain‐Interruptprioritätslogik
Daisy‐Chain‐Interruptstruktur
daisy‐chain interrupt structure
Daisy‐Chain‐Struktur
daisy‐chain structure
DAM‐Baustein
DAM element
Dampfabwurfregler
main steam maximum pressure controller
Dampfapparat steam apparatus dämpfende Spitzenfrequenz
attenuation peak frequency
Dämpfer
damper
Dämpfer
damping device
Dämpfer
antivibrator
Dämpfer der Flusspulsierung oscillations pulsatoires
flow‐pulsation damping system
Dämpfer eines Robotergetriebes
robot antivibrator
Dampfregler steam regulator attenuation
Dämpfung
damping
Dämpfung
Dämpfung
damping action
Dämpfung durch zufallsverteilte Krümmungen
random bend loss
Dämpfungsabnahme
damping decrement
Dämpfungsausgleicher
attenuation compensator
dämpfungsbegrenzter Betrieb
attenuation‐limited operation
Dämpfungsbereich
attenuation region
Dämpfungsbetrieb
attenuation regime
attenuation characteristic
Dämpfungscharakteristik
Dämpfungsdekrement
damping decrement
Dämpfungseinstellung
damping adjustment
Dämpfungselement
damping element
Dämpfungsentzerrer
attenuation compensator
Dämpfungsfaktor
attenuation factor
damping factor
Dämpfungsfaktor
Dämpfungsfaktor
damping coefficient
Dämpfungsglied
damper
Dämpfungsglied
damping device
Dämpfungsglied
antivibrator
Dämpfungsgrad
attenuation degree
Dämpfungsgrad
degree of attenuation
damping coefficient
Dämpfungskoeffizient
damping constant
Dämpfungskonstante
Dämpfungskonstante
decay constant
Dämpfungskreis
damping circuit
Dämpfungsmagnet
damping magnet
Dämpfungsmedium
attenuating medium
Dämpfungsmesser
decremeter
Dämpfungsmessung
attenuation measurement
Dämpfungsmoment
damping couple
Dämpfungsmoment
damping moment
Dämpfungsmoment
damping torque
Dämpfungsnetzwerk attenuator
Dämpfungsspektrum spectral attenuation damping ratio
Dämpfungsverhältnis
Dämpfungsvorrichtung
damper
Dämpfungsvorrichtung
damping device
Dämpfungsvorrichtung
antivibrator
attenuation value
Dämpfungswert
Dämpfungswiderstand
damping resistance
damping time
Dämpfungszeit
Dämpfwirkung
damping action
DANN‐Teil
conclusion
consequent
DANN‐Teil einer Regel
rule‐consequent part
DANN‐Teil einer Regel
Darstellung einer Erscheinung
event representation
presentation device
Darstellungseinrichtung
Darstellungsfehler
display error
darstellungsorientierte (zeichnungsorientierte) Beschreibungrepresentation oriented description
darstellungsorientierte Erfassung
representation oriented acquisition
Datei
file
Datei für Technologiebeschreibung
technology description file
Datei für Prüf Operationen
checking operation file
Datei zur Beschreibung von Montageoperationen
assembly operation file
Dateibeschreibungsattribut
file description attribute
Dateiformat
file format
Dateischutzfunktion
file protection function
Dateisteuerung
file control
Dateiverwaltungssystem
file management system
Daten der Tragekapazität
supporting capacity data
stran 53 od 326
EN ‐DE: slovar avtomatizacije in robotike Daten einer Manipulatorsteuerung
Daten eines Industrieroboters
Daten für Montagegeschwindigkeit
Daten pi des Robotergewichts
Daten pl
Daten pl einer Manipulatorsteuerung
Daten pl eines Handhabeprozesses
Daten pl für Fertigungszeiten
Datenabnehmer
Datenabnehmer
Datenadresse
Datenannahme
Datenanzeiger
Datenart
Datenausgabe
Datenausgaberate
Datenausgangsleitung
Datenaustausch
Datenbank für Robotik
Datenbankabfrage
Datenbank‐Dateiverwaltung
Datenbanksystem
Datenbasis
Datenbereitschaftssignal
Datenbereitstellzeit
Datenbitumsetzer
Datenblock
Datenbus
Datenbusanforderung
Datenbyte
Datenbyte
Datenbytelesen
Datenbyteschreiben
Datendarstellung
Datendarstellungstafel
Dateneinführung
Dateneingabe
Dateneingabe in Analogrechner
Dateneingabe in einen Ziffernrechenautomaten
Dateneingabetechnik
Dateneinheit konstanter Länge
Datenempfänger
Datenempfänger
Datenendstelle
Datenendstellensystem
Datenerfassung
Datenerfassung
Datenerfassung
Datenerfassung am Entstehungsort
Datenerfassungsanlage
Datenerfassungseinheit
Datenerfassungsmodul
Datenerfassungssystem
Datenfernübertragung
Datenfernverarbeitung
Datenfernverarbeitungssteuereinheit
Datenfernverarbeitungs‐Zugriffsmethode distance
datengesteuert
Datengültigkeitssignal
Datenhandhabungssprache
Datenkanal
Datenkanal communication
Datenkanalzusatzeinrichtung
Datenkategorie
Datenkodier[ungs]system
Datenkodierung
Datenkommunikationsendgerät
Datenleitungssteuerung
Datenlesemaske
Datenleser
Datenlesezeiger
Datenmanagement
Datenmanipulation
Datenmarkierimpuls
Datenmodem
Datenmultiplexeinrichtung
data of manipulator control
robot parameters, robot data, data of industrial robot
speed data, data of assembly speed
robot weight data
data
data of manipulator control
handling process data
manufacturing time data
acceptor of data
acceptor of data, AD
data address
data acceptance
data recorder
data type
data output
data output rate
bus‐out
data exchange
data bank for robotics
data bank inquiry
data bank file management
data bank system
data basis
data ready signal
data setup time
data bit converter
data block
data bus
data bus request, DBR
byte of data
data byte
reading of data byte
data byte writing
data presentation
data display panel
insertion of data
data input
data input into analog computer
data input into digital computer
data input technique
constant‐length data unit
acceptor of data
acceptor of data, AD
data terminal
data terminal system
data acquisition
data logging
data collection
local data collection
data logging machine
data‐acquisition unit
data acquisition module
data‐acquisition system
data remote transfer
data remote processing
telecommunication control unit
basic teleprocessing access method
data‐directed
data‐valid signal
data manipulation language, DML
data channel
information channel
data channel attachment
data category
data coding system
data encoding
data communication terminal
data link control
data reading mask, data read mask
data reader
data reading pointer, data pointer
data management
data manipulation
data strobe
data modem
data multiplex device
stran 54 od 326
EN ‐DE: slovar avtomatizacije in robotike Datenmultiplexierung
data multiplexing
data net control
Datennetzsteuerung
Datenpaketsystem
data packet system
Datenpaketvermittlungssystem
data packet switching system
Datenprüfanzeiger
data check indicator
Datenprüfprogramm
data checking program
Datenprüfung
data checking
Datenreduktion
data reduction
Datenregenerierungsperiode
refresh period
Datenregenerierungszyklus
refresh cycle
Datenregistriergerät
data recorder
Datensatzglied
data member
Datenschutz
data protection
Daten‐Sender/Empfänger
data transceiver
Datensicherung
data backup
Datensichtstation
video data terminal
Datenspeicher
data logger
Datenspeicher
data memory
Datenspeicherungsvorrichtung
data storage device
Datensteuerblock
data control block
Datenstrobe
data strobe
Datenstruktur
data structure
Datenstrukturauswahl
data structure selection
Datensystem für Ausbildungszwecke
educational data system
Datenterminal
data terminal
Datenträgerdiskette
information carrier disk, data carrier disk
Datentyp
data type
Datentyp einer IR‐Sprache
data type of IR language
Datentyptransformation
data type transformation
Datentypumwandlung
data type transformation
Datenübermittler
data transmitter
Datenübermittlungseinrichtung
data communication equipment
data communication control
Datenübermittlungssteuerung
Datenübernahme
data acceptance
Datenübernahmezustand
accept data state
Datenübernahmezustand
accept data state, ACDS
Datenübertragung mit konstanter Übertragungsgeschwindigkconstant‐data rate system
Datenübertragungsoperation
data transfer operation
Datenübertragungsprotokoll
data communication protocol
Datenübertragungssystem
data link system
Datenübertragungssystem
data transmission system
data transmission technique
Datenübertragungstechnik
Datenübertragungsverbindung
data transmission link
Datenübertragungsverfahren
data transmission technique
Datenumsetzer
data converter
Datenumsetzer
data translator
Datenunterdrückung suppression of data Datenverarbeitung
data processing
Datenverarbeitungsgeschwindigkeit
data processing rate
Datenverarbeitungsmaschine
data processing machine
Datenverarbeitungssystem
data processing system
Datenverarbeitungstheorie
data processing theory
Datenverarbeitungszentrum
data processing centre
Datenverarbeitungszentrum
computing centre
Datenverarbeitungszentrum für Roboterprogramme
data processing centre of robot programs
Datenverbindungssteuerung
data link control
Datenvereinbarung
data convention
Datenverkehrseinrichtung
data communication equipment
Datenverkehrssteuerung
data communication control
Datenverkehrssteuerzeichen
data link espace character, DLE
Datenverkehrsterminal
data communication terminal
overrun (of data)
Datenverlust
Datenverminderung
data reduction
Datenvermittlung
data switching
Datenverwaltung
data management
Datenwandler
data converter
Datenwandler
data translator
Datenwegpuffer
data bus buffer
Datenwort
data structure
data access
Datenzugriff
Dauerabweichungskoeffizient
offset coefficient
Daueraktionssystem
continuous action system
Daueranforderung
continuous request
Daueraufsicht f
continuous monitoring
continuous supervision
Daueraufsicht f
Dauerbelastung
permanent load
stran 55 od 326
EN ‐DE: slovar avtomatizacije in robotike Dauerbetrieb
Dauerbetrieb
Dauerbetrieb
Dauerbetrieb mit periodisch veränderlicher Belastung
Dauerbetriebsservogerät
Dauermagnet
dauernde Ungleichförmigkeit
Dauernennstrom
Dauerschwingungen
Dauerstricherreger
Dauerstricherregungsquelle
Dauerstrichlaser
Dauertest
Dauertest
Dauerwirkung
Dauerzustand
Dauerzustand
DCS‐System
Dead‐Beat
Dead‐Beat‐Regelung
Dead‐Beat‐Sprungantwort
Deckenmanipulator
Defektlokalisierung
Defektoskopie
Defektstruktur
definierte Achslage
definierte Bewegung
definierte Bewegungsgröße eines IR
definierte Einzelbewegung (eines Roboters)
definierte Greiferstellung
definierte Ist‐Position feines IR
definierte Koordinatenlage
definierte Koordinatenorientierung
definierte Montageaufgabe
definierte Roboterbeschleunigung
definierte Roboterbewegung
definierte Roboterführung
definierte Robotergeschwindigkeit
definierte Roboterorientierung
definierte Roboterschnittstelle
definierte Robotertrajektorie
definierte Schnittstelle
definierte Teilfunktion eines Roboters
definierter Arbeitspunkt
definierter Datentyp
definierter Montagepunkt
definierter Roboterarbeitspunkt
definiertes Effektorverhalten
definiertes Interface eines Roboters
definiertes Roboterverhalten
definiter Automat
Definition feiner Roboterraumkurve
Definitionsbereich
Defokussierung
Deformationspotential
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Defuzzifizierungsverfahren
Dehnbarkeitsmesser
Dehnmessstreifen
Dehnung (Modifikator)
Dehnung (Modifikator)
Dehnungsmesser
Dehydrierungsanlage
permanent action
continuous action
continuous operation
periodic duty
continuous‐action servomechanism
permanent magnet
permanent droop
continuous rated current
continuous oscillations
continuous exciting source
continuous exciting source
continuous laser
long‐run test
long‐time test
permanent action
steady state
steady‐state regime diagnostic communication system of IR
deadbeat
deadbeat control
deadbeat step response
covering manipulator
defect localization
defectoscopy
defects structure
defined axis position
defined movement
defined motion quantity of IR
defined single movement, defined individual movement (of ro
defined gripper position
defined actual position of IR
defined coordinate position
defined coordinate orientation
defined assembly task
defined robot acceleration
defined robot movement
defined robot guide
defined robot speed
defined robot orientation
defined interface of robot
defined trajectory of robot
defined interface
defined partial function of robot
defined working point
definite data type
definite assembly point
defined robot working point
defined effector behaviour
defined interface of robot
defined robot performance
definite automaton
definition of space curve, definition of robot space curve
domain of definition
defocusing
deformation potential
center of gravity defuzzification
centroid defuzzification method
COG defuzzification
defuzzification
defuzzification method
defuzzification, defuzzification method
middle of maxima defuzzification
Center of area (COA) defuzzification
center of gravity (COG), defuzzification
center of largest area defuzzification
center of sums (COS) defuzzification
first of maxima (FOM) defuzzification
last of maxima (LOM) defuzzification
max‐height defuzzification
weighted average defuzzification
ductilimeter
resistance strain gauge
dilatation
dilation
ductilimeter
dehydrogenation plant
stran 56 od 326
EN ‐DE: slovar avtomatizacije in robotike Dehydrierungsprozess
D‐Einfluß‐Koeffizient
D‐Einfluß‐Koeffizient
Dekadenblock
Dekadenschalter
Dekadenwiderstand
Dekadenwiderstand
Dekadenzähler
dekadische Konduktanz
dekadischer Frequenzteiler
dekadischer Kondensatorensatz
Dekodieranlage
Dekodieranlage
dekodieren
Dekodierer
Dekodierer
Dekodierer mit Verzögerungsleitung
Dekodierschaltung
Dekodierung
Dekodierungsautomat
Dekodierungsautomat
Dekomposition
Dekompositionsmethode
Dekompositionsverfahren
Dekrement
Dekremeter
D‐Element
D‐Element
Deltafunktion
Deltafunktion
Deltarauschen
Demodulator
demodulieren
Demonstrationsmodell
Demultiplexer
den vorherigen Zustand wiederherstellen
Densitometrie
Depolarisation
Depolarisationsgrad
der dir Laserlinienbreite bestimmt
derzeitige Systeme
Destillationsanlage
destruktives Lesen
destruktives Lesen
detaillierter Arbeitsablaufplan
detaillierter Arbeitsablaufplan
Detektion Detektionsgrenze
Detektionsschwelle
Detektor
Detektor
Detektor
Detektor
Detektor mit hohem Auflösungsvermögen
Detektor mit hohem Auflösungsvermögen
Detektor mit hohem Auflösungsvermögen
Detektor mit hoher Empfindlichkeit
Detektor mit hoher Empfindlichkeit
Detektor mit niedrigem Auflösungsvermögen
Detektoranalysator
Detektorbaugruppe
Detektorbereich
Detektorblock
Detektorelement
Detektorelement
Detektorelement
Detektorelement
determinierte Maschine
determinierte Maschine
determinierter Bewegungsablauf
determinierter Prozess
determinierter Roboterablauf
determiniertes System
deterministisch
deterministischer Prozess
deterministisches System
dehydrogenation process
derivative action coefficient
derivative action factor
decade block
decade switch
decade resistance box
decimal resistance
decade scaler
decade conductance box
decade frequency divider
decade capacitance box
decoder
decoding machine
decode v
decoder
decoding machine
delay‐line decoder
decoding circuit
decoding
automaton for decoding
decoding automaton
decomposition
method of decomposition
decomposition process
decrement
decremeter
D‐element
derivative‐element
delta function
unit impulse function
delta noise
demodulator
demodulate v
demonstration model
demultiplexer
undo v densitometry
depolarization
degree of depolarization
laser‐linewidth determining mechanism
current systems
multiphase contactor
destructive reading
destructive read‐out
detailed planning
detailled planning
inphase amplitude detection
detection limit
detection limit
detector element
sensing element
sensor
detector
high‐resolution detector
high‐detectivity detector
high‐sensitivity detector
high‐detectivity detector
high‐sensitivity detector
low‐resolution detector
detector analyzer
detection subassembly
detection range
detection subassembly
detector element
sensing element
sensor
detector
determinated machine
disciplined machine
determinated sequence of motions
deterministic process
determinated sequence of robot
deterministic system
deterministic
deterministic process
deterministic system
stran 57 od 326
EN ‐DE: slovar avtomatizacije in robotike dezentrale Abfrageeinheit
dezentrale Datenbank
dezentraler Greiferantrieb
dezentraler Greiferantrieb
dezentrales Prozessleitsystem
dezentrales Prozessleitsystem
dezentralisierte Informationserfassung
dezentralisierte Informationsverarbeitung
dezentralisierte Prozesssteuerung
dezentralisierte Steuerung
Dezibel (dB)
Dezibelmessgerät
Dezibelmessgerät
Dezimaladdierkreis
dezimal‐binärer Kode
Dezimal‐Binär‐Konvertierung
Dezimal‐Dual‐Umwandler
Dezimal‐Dual‐Umwandlung
dezimale Schreibweise
dezimale Zahlendarstellung
Dezimalpunkt‐Programmierung
Dezimalverarbeitung
Dezimalwert
Dezimeterwellengerät
Diagnose
Diagnose
Diagnose Diagnosebus
Diagnosedaten pl
Diagnosedaten pl
Diagnoseeinrichtung
Diagnosehilfen für Roboter
Diagnoseinformation diagnostic
Diagnoseinformation diagnostic
Diagnosemaschine
Diagnosemitteilung
Diagnosenachricht
Diagnoseprogramm
Diagnoseprogramm
Diagnosesignal
Diagnosestrategie
Diagnosesystem eines IR
Diagnosetest
Diagnosetest
Diagnosetestsystem
Diagnoseverfahren
Diagnoseverfahren für Suchfehler recherche
Diagonalisierung von Matrizen
Diagonalmatrix
Diagonalverdichter
Diagramm mit gepunkteten Werten
Dialogbetrieb
Dialogbetrieb
Dialogbetrieb
Dialogbetrieb
Dialogcompiler
Dialog‐Dateneingabe
Dialogeigenschaft
dialoges System eines Roboters
Dialogfähigkeit
Dialogmodus
Dialogmodus
Dialogmodus
Dialogprogrammierung eines Roboters
Dialogprogrammierung für Industrieroboter
Dialogroboter
Dialogsprache
Dialogsteuerung
Dialogterminal
Dialogverarbeitung
Dialogverkehr
Diaphanometer
Diastimeter
Dichteänderung
Dichteanzeiger
Dichtegradient
decentralized inquiry unit
decentralized data bank
decentral drive of gripper
decentralized drive of gripper
decentral process guide system
decentralized process guide system
decentralized information acquisition
decentralized information processing
decentralized process control
decentralized control
decibel
decibelmeter
noise test set
decimal add circuit
bidecimal code
decimal‐to‐binary conversion
decimal‐to‐binary converter
decimal‐to‐binary conversion
decimal notation
decimal notation
Decimal point programming
decimal processing
decimal value
microwave device
diagnostic
diagnosis
software diagnostic
diagnostic bus
diagnostic data
diagnostic information
diagnostic device
diagnostic aids of robot
diagnostic data
diagnostic information
diagnostic machine
diagnostic message
diagnostic message
diagnostic program
diagnostic routine
diagnostic signal
diagnostic strategy
diagnostic communication system of IR
diagnostic checking
diagnostic test
diagnostic test system
diagnostic procedure
seek error diagnostic procedure
diagonalization of matrices
diagonal matrix
mixed‐flow compressor
point‐to‐point mapping graph
conversational mode, dialogue mode
conversational mode
dialogue mode
session mode
conversational compiler, dialogue compiler
conversational data entry
interactive feature
dialogue system of robot
dialogue capability
conversational mode
dialogue mode
session mode
dialogue programming of robot
conversational programming of industrial robot, dialogue prog
conversational robot, dialogue robot
conversational language, dialogue language
dialogue control
interactive terminal
interactive processing
conversational communication
diaphanometer
diastimeter
density change
density indicator
density gradient
stran 58 od 326
EN ‐DE: slovar avtomatizacije in robotike Dichtekurve
Dichteregelung
Dichteregler
Dichteschwankung
Dichteverteilung
dielektrische Beanspruchung
dielektrische Belastung
dielektrische Erwärmung im Hohlraumresonator
dielektrische Erwärmung von Thermoplasten
dielektrische Heizung
dielektrische Verluste
dielektrischer Gradient
dielektrischer Heizungsgenerator
dielektrisches Interferenzfilter
dielektrisches Trocknen
Dielektrizitätsverlustmessung
Dienstprogramm Differential
differential wirkende Regelung
Differentialabsorptionsmethode
Differentialabsorptionsverfahren
Differentialanalysator
Differentialanordnung
Differentialausdruck
Differentialbrücke
Differential‐Differenzgleichung
Differentialdruckschalter
differentiale Kaskadenregelung
differentiale Temperaturregelung
differentiale Temperatursteuerung
Differentialelement
Differentialempfänger
differentiales Folgeregelungssystem
differentiales Synchro
Differentialfernmesssender
Differentialform
Differentialgeber
Differentialgleichung
Differentialgleichung 1. Ordnung
Differentialgleichung II. Ordnung
Differentialgleichung mit nacheilendem Argument
Differentialhebel
Differentialimpuls
Differentialimpuls
Differentialimpuls
Differentialkalorimeter
Differentialkapazität
Differentialkoeffizient
Differentialkurve
differential‐logarithmische PCM‐Modulation
Differentialmessmethode
Differentialmethode
Differentialmodulation
Differentialquotient
Differentialrelais
Differentialrelais
Differentialringmanometer
Differentialschaltung
Differentialschutz
Differentialstromkreis
Differentialsynchroempfänger
Differentialsynchrosender
Differentialsynchroübertrager
Differentialthermoanalyse
Differentialthermogravimetrie
Differentialthermometer
Differentialverstärker
Differentiationsbeiwert
Differentiationsbeiwert
Differentiationssymbol
Differentiator
Differentiator
Differentiator
Differentiatorzeitkonstante
differentielle Gewinnregelung
differentielle Gewinnsteuerung
density curve
density control
density controller
fluctuation of density
density distribution
dielectric stress
dielectric stress
dielectric heating in cavity resonator
dielectric heating of thermoplastic materials
dielectric heating
dielectric losses
dielectric gradient
dielectric heating generator
dielectric interference filter
dielectric drying
dielectric leakage measurement
utility program
differential gear
rate action
differential absorption method
differential absorption method
differential analyzer
differntial configuration
differential expression
differential bridge
differential‐difference equation
differential pressure switch
differential concatenation control
differential temperature control
differential temperature control
differential element
differential receiver
differential servo
differential selsyn
differential telemeter transmitter
differential form
differential pick‐up
differential equation
first order differential equation
second order differential equation
differential equation with retarded argument
differential lever
difference pulse
difference signal
differential pulse
differential calorimeter
differential capacitance
differential coefficient
differential curve
differential‐logarithmic pulse code modulation
differential measurement
differential method
differential modulation
derivative
differential relay
balanced relay
ring‐balance differential manometer
differential connexion
differential protection
differential circuit
differential synchroreceiver
differential synchrotransmitter
differential selsyn
differential thermal analysis
differential thermogravimetry
differential thermometer
differential amplifier
derivative action coefficient
derivative action factor
differentiation symbol
derivative element
differentiating element
differentiator
differentiator time constant
differential gain control
differential gain control
stran 59 od 326
EN ‐DE: slovar avtomatizacije in robotike differentielle Spektralempfindlichkeit
differentieller Regler
differentieller Regler
differentieller Regler
differentieller Widerstand
differentieller Wirkungsquerschnitt
differentiellkohärentes Übertragungssystem
Differenz zwischen Aufgabenwert und Sollwert
Differenzdruckmanometer
Differenzdruckwächter
Differenzdruckwächter
Differenzengleichung
Differenzenrechnung
Differenzier
differenzierbare Struktur
Differenzierbeiwert
Differenzierelement 1. Ordnung
differenzierende Schaltung
differenzierendes Glied
differenzierendes Glied
differenzierendes Glied
differenzierendes Netzwerk
differenzierendes Netzwerk
differenzierendes Netzwerksteuerungssystem
differenzierendes Verhalten
differenzierendes Verhalten
differenzierendes Verhalten
Differenzierglied
Differenzierglied
Differenzierglied
Differenzierglied
Differenzierzeitkonstante
Differenzimpuls
Differenzimpuls
Differenzimpuls
Differenzsignal
Differenzsignal
Differenzsignal
Differenzstrom
diffuses Strahlungsspektrum
Diffusionsapparat
Diffusionsmodell
Diffusionsprozess
digital dargestellte Funkenkammer
digital gesteuertes Element
Digital‐Analog‐ Konverter
Digital‐Analog‐Umsetzer
Digital‐Analog‐Wandler
Digital‐Analog‐Wandler
Digitalaufzeichnung
Digitalausgabe
Digitalausgang
Digitaldaten pl von Messwerten
Digitaldifferentiator
digitale automatische Maschine
digitale Bildverarbeitung
digitale Darstellung
digitale Darstellung
digitale Datenverarbeitung
digitale Greifersteuerung
digitale Kodierung von Begriffen
digitale Lagemessung
digitale Lageregelung
digitale Lagesteuerung
digitale Längenmessung
digitale Laserstrahlablenkungseinrichtung
digitale Mehrgrößenregelung
digitale optische Signalverarbeitung
digitale Rechenanlage
digitale Regelung
digitale Simulation
digitale Steuerung
digitale Steuerung
digitale Steuerung
digitale Verarbeitungseinheit
digitale wissenschaftliche Rechenanlage
differential spectral sensitivity
rate action controller
differential controller
D‐controller
differential resistance
differential cross‐section
differentially coherent transmission system
difference between desired value and set value
differential pressure gauge
differential pressure indicator
pressure difference indicator
difference equation
calculus of differences
derivative
differentiable structure
derivative constant
first‐order lead element
differentiating circuit
derivative element
differentiating element
differentiator
differential circuit
differentiating network
differentiating network control system
derivative action
differentiating action
rate action
derivative element
differential element
differentiating element
differentiator
derivative time constant
difference pulse
difference signal
differential pulse
difference pulse
difference signal
differential pulse
differential current
diffuse radiation spectrum
diffuser
diffusion model
diffusion process
digitized spark chamber
digitally controlled element
digital‐analog converter
digital‐analog converter
digital‐to‐analog‐converter
digital‐analog converter
digital recording
digital output
digital output
numerical characteristics of measurement results
digital [integrating] differential analyzer
digital automatic machine
digital image processing
digital display
digital representation
digital data processing
digital gripper control
digital coding of conceptions
digital position measurement
digital position control
digital position control
digital length measurement
digital laser beam deflector
multiloop digital control
digital optical processing
digital computer
digital control
digital simulation
digital control
numerical control
discrete control
digital processing unit
digital scientific computing system
stran 60 od 326
EN ‐DE: slovar avtomatizacije in robotike Digitaleinheit
digitaler Analysator von Übergangserscheinungen
digitaler Automat
digitaler Differentialanalysator
digitaler Eingang
digitaler Integrator
digitaler IR‐Ausgabekanal
digitaler Kode
digitaler Kraftsensor
digitaler Prozessor
digitaler Rechenautomat
digitaler Regelungsalgorithmus
digitaler Regler
digitaler Steuerrechner
digitaler Verstellservomechanismus
digitales
digitales Ausgangssignal
digitales Fernmessverfahren
digitales Filter
digitales Integralvoltmeter
digitales Kommunikationssystem
digitales logisches System
digitales Positionierungssystem
digitales Relaisfolgesystem
digitales Signal
digitales Steuerungssystem
digitales System für die Produktion
digitales Winkelmesssystem
Digitalfehler
Digitalfilter
Digitalgeber
Digitalgeber
digitalgesteuerter Schreiber
Digitalgröße
Digitalhauptleitung
digital‐inkrementale Wegmessung
Digitalisierer
Digitalisierer
Digitalisierroboter
Digitalisiersystem
digitalisierte Struktur
digitalisierte Thermoelementkompensation
digitalisierte Zeichnung
digitalisiertes Bild
digitalisiertes Roboterbild
digitalisiertes Werkstück
digitalisiertes Werkstück
Digitalisierung
Digitalisierung
Digitalisierung grafischer Vorlagen
Digitalmessgerät
Digital‐Mittelwertsbildner
Digitalohmmeter mit Grenzwertkontrolle limites
Digitalphasenmesser
Digitalrechner
Digitalrechnerkonstruktion in Mikromodulbauweise
Digitalsensor
Digitalsignalverteiler
Digitalsimulator
Digitalspeicher
Digitalsteuerungstyp
Digitalsteuerungstyp Digitaltechnik
Digitaltechnik
Digitalteil
Digitalteil eines Hybridrechners
Digitalübertragung
Digitalumsetzer
Digitalverbindung
Digitalwandler digital
Dimension
dimensionale Toleranzen
Dimensionierung feines Greiforgans
Dimensionierung roboterbestückter Fertigungszellen
Dimensionsanalyse
dimensionslos
digital unit
digital transient analyzer
digital automaton
digital [integrating] differential analyzer
digital entry
digital integrator
digital IR output channel
digital code
digital force sensor
digital processor
automatic digital computer, ADC
digital regulation algorithm
digital controller
digital control computer
digital position servo
digital transient analyzer
digital output
digital telemetering
digital filter
integrating digital voltmeter
digital communication system
digital logic system
digital positionning system
digital relay servosystem
digital signal
digital control system
digital system for production
digital angle measuring system
digital error
digital filter
digitizer
digitized device
digital recorder
digital quantity
digital main line
digital‐incremental odometry
digitizer
digitized device
digitizing robot
digitizing system
digitized structure (of information)
digitized thermocouple compensation
digitized drawing
digitized image
digitalized robot image
digitalized digitalized work piece
digitizing
digitalization
digitalizing of graphical sheets
digital measuring device
digital averager
digital ohmmeter with limit value checking
digital phase meter
digital computer
micromodule digital computer construction
digital sensor
digital distribution frame
digital simulator
digital store
type of digital control
type of digital control numerical techniques
digital technique
digital part
digital part of hybrid computer
digital transmission
digital converter
digital connection
digital converter
dimension
dimensional tolerances
dimensioning of grip organ
dimensioning of robot equipped manufacturing units
dimensional analysis
non‐dimensional
stran 61 od 326
EN ‐DE: slovar avtomatizacije in robotike dimensionslose Größe
dimensionslose Größe
dimensionslose Größe
dimensionslose Kennlinie
dimensionslose Kurve
dimensionslose Variable
dimensionslose Variable
dimensionslose Variable
dimensionsloser Koeffizient
dimensionsloser Koeffizient
dimensionsloser Koeffizient
dimensionsloser Parameter
Dimensionsstabilität
Dimensionssteuerung
dinamischer Dämpfer
dinamischer Stoßdämpfer
Diodenbereich
Diodenbereichskamera
Diodenfunktionsgenerator
Diodengleichrichtung
Diodenschaltung
Diodenstrombegrenzer
Diodenvervielfacher
Diodenzähler
Dirac‐Funktion
Diracsche Funktion
Directbeziehungsfernmesser
directer Kode
direkt anzeigendes Dosimeter
direkt betätigter Schreiber
direkt betätigtes Registrierinstrument
direkt betätigtes Ventil
direkt gesteuertes Regelventil
direkt gesteuertes Regelventil
direkt wirkender Regler
direkt wirkender Regler
direkt wirkendes System
Direktausführung
direkte Abbildung mit Laserstrahlen
direkte Datenverarbeitung
direkte digitale Regelung
direkte digitale Robotersteuerung
direkte Eingabe
direkte Frequenzmodulation
direkte Kaskadenregelung
direkte Kraftbestimmung
direkte Manipulatorsteuerung
direkte Methode von Ljapunow
direkte Methode von Lyapunow
direkte Momentenbestimmung
direkte NC‐Steuerung
direkte numerische Steuerung
direkte Signalsteuerung signalisation
direkte Simulation
direkte Steuerung
direkte Steuerung von Werkzeugen
direkte Steuerungsüberwachung
direkte Steuerungsüberwachung
direkte Steuerungsüberwachung
direkte visuelle Überwachung
direkter Antrieb
direkter Datenaustausch
direkter Datenkanal
direkter Datenverkehr
direkter digitaler Mehrkanalregler
direkter digitaler Regler
direkter Eingang
direkter Greifer
direkter Informationsaustausch
direkter Kode
direkter Körperkontakt (Kontakt)
direkter Zugriff
direkter Zugriff
Direktkühlsystem
Direktkurzschlußabschaltung
Direktleitung
dimensionless coefficient
dimensionless value
non‐dimensional value
non‐dimensional response curve
non‐dimensional curve
dimensionless variable
reduced variable
non‐dimensional variable
dimensionless coefficient
dimensionless value
non‐dimensional value
non‐dimensional parameter
dimensional stability
dimension control
dynamic damper
dynamic damper
diode area
diode area camera
diode function generator
diode detection
diode circuit
diode current limiter
diode multiplier
diode counter
Dirac delta‐function
Dirac delta‐function
direct relation telemeter
bidecimal code
direct reading dosimeter
direct acting recording instrument
direct acting recording instrument
directly operated valve
direct controlled regulation valve
direct‐controlled regulation valve
direct acting controller
direct operating controller
direct control system
direct execution
laser direct imaging
direct data processing
direct digital control
direct digital robot control
direct input
direct frequency modulation
direct concatenation control
direct force destination
direct manipulator control
direct method of Liapunov
direct method of Lyapunov
direct moment destination
direct numerical control
direct numerical control
direct signal control
direct simulation
direct control
direct control of tools
direct control supervision, direct control checking
direct control supervision
direct control checking
direct visual supervision
direct drive
direct data change
direct data channel
direct data traffic
direct digital controller
direct digital controller
direct input
direct gripper
direct information exchange
direct code
direct body contact
immediate access
instantaneous access
direct cooling system
direct short‐circuit interruption
direct line
stran 62 od 326
EN ‐DE: slovar avtomatizacije in robotike Direktregler
Direktregler
Direktregler
Direktserienauslöser
Direktzugriffsmethode
Disassembler
Disassembler‐Analyse
Disjunktion
disjunktive Normalform
Diskette
Diskettenlaufwerk
Diskettenleser
Diskettenspeicher
Diskettenspeichersteuerung
diskontinuierlich arbeitender Reaktor
diskontinuierlich wirkender Regler
diskontinuierliche Produktion
diskontinuierliche Regelung
diskontinuierliche Regelung
diskontinuierliche Wirkung
diskontinuierlicher Servomechanismus
diskontinuierliches Signal
diskontinuierliches Signal
diskontinuierliches System
diskontinuierliches System
diskontinuierliches System
diskrete Darstellung
diskrete Einwirkung
diskrete Einwirkung
diskrete Größe
diskrete Impulse
diskrete Laplace‐Transformation
diskrete Logik
diskrete Optimierung
diskrete Schaltung
diskrete Selbstschwingungen
diskrete Steuerung
diskrete Steuerung
diskrete Steuerung
diskrete und stetiges System
diskreter Automat
diskreter Bahnzustand
diskreter Prozess
diskreter stochastischer Mehrstufenentscheidungsprozess
diskreter Zeitpunkt einer Armbewegung
diskretes Bauelement
diskretes Filter
diskretes Maximumprinzip
diskretes Optimisierungssystem
diskretes System
diskreteVerteilung
Diskretisierung eines stetigen System
Diskriminatorglied
Dispatcherpult
Dispatchersystem
Dispatchersystem
Dispersion
Dispersion der Zufallsgröße
Dispersion der Zufallsgröße
Dispersionsindex
Dispersionskoeffizient
Dispersionsmessung mit Refraktometer
Dispersionsnullstelle
Displaysteuerlogik
Dissipation
Dissipationseinwirkung
dissipative Funktion
Distanzmesser
Distanzschutz
Distanzschutz mit stetiger Auslösekennlinie
Distanzschutz mit Stufenkennlinie Distanzsensor
distributive Zufallszahl
Distributivroboter
divergent
Divergenzschwingungen
directly operated valve
direct acting controller
direct operating controller
direct series trip
direct access method
disassembler
disassembler analysis
disjunction
disjunctive normal form
diskette
floppy‐disk drive
diskette reader
floppy disk
floppy‐disk control
batch reactor
discontinuous‐action controller
discontinuous production
discontinuous control
intermittent control
discontinuous action
discontinuous‐action servomechanism
discontinuous signal
intermittent signal
batch system
intermittent system
discontinuous system
discrete representation
discrete input
intermittent input
discrete quantity
discrete pulses
z‐transform
discrete logic
discrete programming
discrete circuit
interrupted autooscillations
digital control
numerical control
discrete control
discrete‐continuous system
discrete automaton
discrete path state
discrete process
discrete stochastic multistage decision process
discrete instant (moment) arm movement
discrete component
discrete filter
discrete maximum principle
discrete optimizing system
discret‐time system
discrete distribution
discretization of continuous‐time system
discriminating element
dispatching desk
dispatching system
supervisory control system
variance
random value variance
variance of random value
dispersion index
dispersion coefficient
measuring of the dispersion by refractometer
zero dispersion
display control logic
dissipation
dissipation effect
dissipation function
diastimeter
distance protection
continuous curve distance‐time protection
stepped curve distance‐time protection distance sensor
distributed random number
distributive robot
divergent
divergent oscillations
stran 63 od 326
EN ‐DE: slovar avtomatizacije in robotike Divergenzwinkel
divergieren
Dividierkreis
Dividierkreis
Divisionsalgorithmus
Divisionsalgorithmus
Divisionsschaltung
Divisionsschaltung
DMA‐Schaltkreis
DNC
Dokumentation feines Roboterprogramms
doppelarmiger Roboter
Doppelarmmanipulator
Doppelbetätigung
Doppelgreifeinheit
Doppelgreifer
Doppelheterostrukturlaser mit schmaler Streifengeometrie
Doppelimpulsgenerator
Doppelimpulsmodulation
Doppelleitung
Doppelleitungswiderstand
Doppelleitungszerlegung f
Doppelmessgerät
Doppelprogrammierung eines Roboters
Doppelrechnersystem
Doppelschalttafel
Doppelschleifenservomechanismus
Doppelschleifenservomechanismus
Doppelsteuerung
doppelt verstärkende Schaltung
doppelt verstärkende Schaltung
doppeltperiodischer Vorgang
Doppelwirkungsweise
DOS
DOS
Dosierer
Dosierer
Dosiermessgerät
Dosiermessgerät
Dosierpumpe
Dosierung
drahtgebundene Fernmesstechnik
drahtgeführter Wagen <
drahtlose Steuerung
Drahtpotentiometer
Drahtvorschubsystem
drastische Summe
drastisches Produkt
D‐Regler
D‐Regler
D‐Regler
D‐Regler
Drehbewegung (eines Greifers)
Drehbewegung einer Greiferhand
Drehbewegung r*um die x‐Achse
Drehbewegung um die u‐Achse
Drehbewegung um die v‐Achse
Drehbewegung um die w‐Achse
Drehbewegung um die y‐Achse
Drehbewegung um die z‐Achse
Drehbewegungsgeschwindigkeit eines Roboters
Drehdrossel
Drehdrossel
Dreheinheit
Dreheinheitenantrieb
Dreheisenspannungsregler
Drehfeldleistungsmesser
Drehfeldrichtungsanzeiger
Drehfrequenz H
Drehgelenk
Drehgelenk einer Zangengreifeinheit
Drehgelenk eines Greifers
Drehgelenk eines Zangengreifers
Drehgelenkroboter
Drehgelenkstruktur
Drehimpuls
angular divergence
diverge v
dividing circuit
division circuit
algorithm for division
division algorithm
dividing circuit
division circuit
switching circuit for direct memory access, DMA switching cir
direct numerical control
documentation of robot program
double‐arm robot, two‐arm robot
double arm manipulator
dual operation
double grip unit
double‐gripper
narrow‐stripe‐geometry double heterostructure laser
double pulse generator
double pulse modulation
loop[ed] circuit
loop resistance
loop resolution
dual measuring instrument
double programming of robot
double computer system
dual switch board
double‐loop servomechanism
two‐loop servomechanism
dual[‐mode] control
double amplification circuit
reflex circuit
biperiodical regime
dual operation
disk operating system
DOS
batch meter
dosimeter
batch meter
dosimeter
metering pump
batching
wire link telemetry
wire‐guided vehicle
radio control
wire‐wound potentiometer
wire feed system
drastic sum
drastic product
derivative controller
rate action controller
differential controller
D‐controller
rotation motion (movement) (of gripper)
gripper hand rotation
x‐rotary motion
u‐rotary motion
v‐rotary motion
w‐rotary motion
y‐rotary motion
z‐rotary motion
rotation speed of robot
adjustable inductor
variometer
rotation unit
rotation unit drive
moving‐iron voltage regulator
induction wattmeter
phase‐sequence indicator
gyro‐frequency
swivel joint
rotation joint of pincer
rotation joint of gripper
swivel joint of a pincer gripper
swivel joint robot
swivel joint structure
rotary impulse
stran 64 od 326
EN ‐DE: slovar avtomatizacije in robotike Drehlage
Drehlageabweichung
Drehlageerkennung von Objekten
Drehlagenermittlung
Drehmechanismuskonstruktion eines Roboters
Drehmelder
Drehmelder
Drehmelder mit zwei Geschwindigkeiten
Drehmelderfernübertragung
Drehmeldersteuerung
Drehmoment
Drehmomentantrieb
Drehmomentsensor
Drehmomentverstärker
Drehrichtung
Drehschalter
Drehteller
Drehteller (für Eingabe von Werkstücken)
Drehtisch
Drehumformer
Drehumwandler
Drehung der Zangengreifeinheit
Drehung eines Greiforgans
Drehung eines Robotergreifers
Drehvorrichtung
Drehwinkel
Drehwinkel eines Greiferarms
Drehwinkelantrieb
Drehwinkelmotor
Drehzahlmesser
Drehzahlregelung
Drei‐Achsen‐Roboter
dreiarmiger Manipulator
Dreibackengreifer
dreidimensionale geometrische Datenbasis
dreidimensionale Motorführung
dreidimensionale Roboterbahn
dreidimensionale Wärmeströmung
dreidimensionale werkstückorientierte Sprache
dreidimensionaler optischer Sensor
dreidimensionaler Phasenraum
dreidimensionaler Vektor
dreidimensionales Objekt
dreieckförmige Zugehörigkeitsfunktion
Dreiecksnorm
Dreiecks‐Norm
Dreiecks‐Norm
Dreiersteuerung
Dreiexzesskode
Dreiexzessverschlüsselung f
Dreifinger (Roboter)
Dreifingergreifeinheit
Dreifingerhand
Dreikoordinaten‐Montageroboter
Dreipegelsystem
Dreiphasenspeisung
Dreiphasensystem
Dreipunktaufhängung
Dreipunkt‐Element
Dreipunkt‐Element
Dreipunktgreifer
Dreipunktregelung
Dreipunktregelung
Dreipunktregelung
Dreipunktregelung
Dreipunkt‐Regelung
Dreipunktregler
Dreipunkt‐Regler
Dreipunkt‐Regler
Dreipunktverhalten mit Nullwert
Dreistufensteuerung dreistufiges Management‐Informationssystem
Dreiwegsteuerung
dreiwertige Funktionen Drektverarbeitung
rotating position
rotary position deviation
rotating position identification, identification of rotating posit
search of rotating position
rotating mechanism construction of robot
selsyn
synchro
dual speed synchro system
remote selsyn transmission
selsyn control
moment of motion
torque motor
torque sensor
torque amplifier
circulation direction
rotary switch
rotary table (for feeding of work pieces)
rotary table (for feeding of s)
rotating table
rotating converter
induction voltage regulator
pincer rotation, rotation of pincer unit
grip organ rotation ‐
robot gripper rotation
turntable device
angle of rotation
gripper rotation angle
drive of rotation angle
rotation angle motor
revolution indicator
control of rotation velocity
three‐axes robot
three‐armed manipulator
three‐jaw gripper
three‐dimensional geometric data basis
three‐dimensional motor control
three‐dimensional robot path
three‐dimensional heat flow
three‐dimensional ‐oriented language
three‐dimensional optical sensor
3‐dimensional phase space
three‐dimensional vector
three‐dimensional object
triangular membership function
t‐norm
triangular norm, r‐norm
triangular norm
triple device control
excess‐three‐code
excess‐three‐code
trifinger
three‐finger grip unit
three‐finger hand, three‐fingered hand
three‐coordinate assembly robot
three‐level system
three‐phase supply
three‐phase system
three‐point suspension
relay with dead zone
three‐step action element
three‐point gripper
three‐point action, three‐step action
three‐point action
three‐position control
three‐step action
three‐step control
dead zone (relay, on‐off‐controller, amplifier), dead band (backlash nonlinearity
three‐position controller
three‐step controller
positive‐negative three‐level action
three‐step control three‐stage management information system
three‐mode control
three‐valued functions direct processing
stran 65 od 326
EN ‐DE: slovar avtomatizacije in robotike Drift
Driftausfall
Driftfaktor
Driftfehler
driftkompensierter Verstärker
Driftkorrektur
Driftmesser
dritte Manipulatorgeneration dritte Robotergeneration (IR‐Generation)
drosselnde Wirkung
Drosselprozess
Drosselregelung
Drosselspule
Drosselspule
Drosselungskennwert
Drosselungskennwert
Drosselventil
Drosselverstärker
Drosselwirkung
Druckabfall
Druckabfall
Druckaufbau
Druckausgleich pression
Druckausgleich pression
Druckausgleichmethode
Druckbeanspruchung
Druckbeaufschlagung
Druckbelüftung
Druckdifferenzanzeiger
Druckdifferenzanzeiger
Druckdifferenzgeber
Druckdifferenzgeber
Druckdifferenzgeber
Druckdifferenzmessung
Druckdifferenzregelung
Druckdifferenzschreiber
Druckeinstellung
Druckentlastungstechnik
Druckentnahme
Drucker
Druckersteuerlogik
druckfester Feuchtefühler compression
Druckfestigkeit
Druckfiltration
Druckfühler
Druckfühler
Druckfühler auf Halbleiterbasis
Druckgasfeuchtigkeitsmesser
druckgeschweißte Verbindung
druckgesteuert
Druckgießmanipulator
Druckgradient
Druckkette
Druckknopfsteuerungsstation
druckkompensierter Durchflussmesser
Druckkontakt
Druckkontakt
Druckkontakt
Druckliste
Druckluft
Druckluftantrieb
druckluftgesteuert Druckluftkühlung
Druckluftmotor
Druckluftmotor Druckluftspeicher Druckluftversorgung"des Greifers
Druckluftverzögerungsrelais
Druckpuffer
Druckreduzierung
Druckregler
Druckregler
Druckregler
Druckroboter
Druckrückführung
Druckschalter pression
drift
progressive failure
drift factor
drift error
drift‐corrected amplifier
drift correction
driftmeter
third manipulator generation
third robot generation
throttling action
throttling process
throttling control
impedance coil
inductor
choking factor
throttling index
restrictor valve
choke‐coupled amplifier
throttling action
pressure drop
drop in pressure
pressure buildup
pressure balancing
pressure equalization
pressure balance method
compressive stress
pressurization
pressurization
differential pressure indicator
pressure difference indicator
differential pressure transducer
pressure difference transmitter
differential pressure transmitter
differential pressure measurement
differential pressure control
differential pressure recorder
pressure adjustment
pressure relief technology
pressure connection
printer
printer control logic
humidity feeler resistant to compression
compressive strength
pressure filtration
pressure sensitive element
pressure sensor
semiconductor pressure sensing device
humidity meter of the gas under pressure
pressure welded junction
pressure controlled
pressure cast[ing] manipulator, pressure moulding handler
pressure gradient
print chain
push‐button station
pressure‐compensated flowmeter
butt contact, pressure contact
butt contact
pressure contact
print list
compressed air
air actuator air‐operated forced ventilation cooling
air pneumatic motor
air pneumatic motor air accumulator compressed‐air provision of gripper
pneumatic time delay relay
print buffer
pressure reduction
pressure regulator
pressure adapter
pressure balance
press robot
pressure feedback
pressure[‐actuated] switch
stran 66 od 326
EN ‐DE: slovar avtomatizacije in robotike Drucksensor
pressure sensor
Drucksensor
pressure sensitive element
Drucksteuerung
print control
Drucktastenimpuls
push‐button pulse
printing technique
Drucktechnik
Druckteiler‐Schaltung
pressure‐dividing diagram
drop in pressure
Druckverlust
pressure drop rate
Druckverlustwert
Druckverteilung
pressure distribution
Druckwächter pressure reduction 500
pressure guard
print unit
Druckwerk
Druckwiederaufnahmekode
print restore code, PR code
DT1‐Element
D‐element with first order lag
DT1‐Element
derivative element with first order lag
dual kodierte Zahl
dual‐coded number
dual kodierte Zahl
binary‐coded number
duale Steuerung
dual[‐mode] control
dualer Zustandsraum
dual state space
duales Spektralverfahren
dual spectral method
duality
Dualität
Dualitätstheorem
dual theorem (operations research)
Dualitätstheorie
duality theory
Dualkanal‐Mikroprogramm
dual channel microprogram
Dualkomponente
dual component
dual[‐mode] control
Dualsteuerung
Dualsystem
binary number system
Duhamelsches Integral
Duhamel integral
Dunkelstrom
dark current
Dünnschicht‐Halbleiterlaser
semiconductor film laser
Duplex‐Addiermaschine
duplex adding machine
Duplexbetriebsweise
duplex mode
Duplexkanal
duplex channel
Duplexleitung
duplex circuit
durch Laserstrahlen verursachter Fehler
laser‐induced defect
durch Rechnergeschwindigkeit begrenztes System
machine‐limited system
durch Roboter manipuliertes Objekt
robot manipulated object by
durch Roboter montierte Lichtmaschine
robot‐assembled dynamo
durch Roboter montierte Maschine
robot‐assembled machine
durch Roboter montierte Scheibe
robot‐assembled disk
durch Roboter montierte Verschraubung
robot‐assembled screw cap
durch Roboter montierte Welle
robot‐assembled shaft
robot‐assembled refrigerator
durch Roboter montierter Kühlschrank
durch Roboter montierter Motor
robot‐assembled motor
durch Roboter montierter Staubsauger
robot‐assembled vacuum cleaner
durch Roboter montiertes Fahrzeug
robot‐assembled vehicle
durch Roboter montiertes Gehäuse
robot‐assembled housing
durch Roboter montiertes Kugellager
robot‐assembled ball bearing
durch Verzögerungsleitung geformter Impuls
delay‐line‐shaped pulse
piercing voltage
Durchbruchspannung
Durchdringung
penetration
Durchdringung
penetrating
Durchdringungsvermögen
penetrating power
Durchdringungsvermögen
penetration power
Durchflussdichte
flow density
Durchflusselement
flow element
Durchflussgröße
flow value
Durchflusskalorimetrie
flow calorimetry
flow capacity
Durchflusskapazität
Durchflussmengenanzeiger
flow indicator
Durchflussmengenmesser
flow controller
Durchflussmengenmesser
mass flowmeter
Durchflussmengenmesser für flüssige Metalle
flow meter for liquid metals
Durchflussmengenmesser mit pneumatischem Geber
flow meter with pneumatic transmitter
flow measuring instrument
Durchflussmengenmessgerät
Durchflussmengenregelung
flow [rate] control
Durchflussmengenregelung
basic rate system
Durchflussmesser
flow gauge
Durchflussmesser für offene Gerinne
open‐channel flowmeter
fast response flowmeter
Durchflussmesser mit kurzer Ansprechzeit
flow gauge
Durchflussmessgerät
Durchflussproportionalzähler flow‐pulsation damping systemflow proportional counter
Durchflussregler
flow regulator
flow ratio control
Durchflussverhältnisregelung
Durchflussverhältnisregler
ratio flow controller
Durchflusswächter
flow guard
flow value
Durchflusswert
stran 67 od 326
EN ‐DE: slovar avtomatizacije in robotike Durchflusszahl
Durchführungsumformer
Durchführungszone
Durchgangs
Durchgangsfaktor
Durchgangskapazität
Durchgangsmatrix
Durchgangsprüfer
Durchgangstransformator
Durchgangsvektor
Durchhangseinstellung
Durchlassband
Durchlasserholungszeit
Durchlasskennlinie
Durchlasswiderstand
Durchlauf
Durchlaufzeit
Durchmesser einer Greifvorrichtung
durchmischen
durchmischen
durchmischen
Durchsatz
Durchsatzprofil
Durchschlag
Durchschlag
Durchschlagsspannung
Durchschlagsspannung
durchschnittliche Operationszeit
durchschnittliche Satzverarbeitungszeit
durchschnittliche spezifische Leistung
durchschnittliche spezifische Leistung
durchschnittliche spezifische Leistung ????
durchschnittliche spezifische Leistung ????
durchschnittliche spezifische Leistung ????
Durchschnittsoperation bei Mengen
Durchschnittsoperation bei Mengen (UND‐Operation)
Durchsichtigkeit
Durchströmungsgeber
Durchtrittskreisfrequenz
D‐Verhalten
D‐Verhalten
Dynamic der Automatenoperation
Dynamik des linearen Servosystems
Dynamik eines Kleinroboters
Dynamik vermaschter Dampfsysteme
Dynamik verzweigter Regelkreise
Dynamik von Reaktoren
Dynamikbereich
dynamisch
dynamische
dynamische Abweichung mechanischer Baugruppen
dynamische Abweichung mechanischer Baugruppen
dynamische Abweichung von Simultanbewegungen
dynamische Analyse
dynamische Arbeitskurve
dynamische Berechnung
dynamische Daten pi
dynamische Daten pl
dynamische Definition
dynamische Eigenschaft dynamische Eigenschaft eines Manipulators
dynamische Einheit
dynamische Empfindlichkeit
dynamische Genauigkeit
dynamische Genauigkeit
dynamische Genauigkeit eines Roboters
dynamische Generatorkennlinie
dynamische Kennlinien von automatischen Messgliedern
dynamische Kompensation
dynamische Kompensation
dynamische Magnetspeichertechnik dynamique
dynamische Manipulatoreigenschaft
dynamische Massenspektrometer
dynamische Operation
dynamische Optimierung
dynamische parallele Programmstruktur programme
flow coefficient
bushing transformer
performance zone
feed through
feed through factor
transfer capacitance
feed through matrix
continuity tester
bushing transformer
feed through vector
sag adjustment
passing band
forward recovery time
transmission characteristic
forward resistance
throughput
turnaround time
diameter of grip device
blend v
mix v
mingle v
throughput
flow rate profile
breakdown puncture
slugging
disruptive voltage
breakdown voltage
average operation time
average record processing time, ARPT
average intensity
angle‐integrated intensity
average fuel rating
mean fuel rating
average specific power
intersection operation
intersection operation
transparency
flow‐through transmitter
crossover angular frequency
derivative action
rate action
dynamics of the operation of the automaton
linear servosystem dynamics
miniature robot dynamics
dynamics of interconnected steam systems
dynamics of ramified control circuits
reactor dynamics
dynamic range
dynamic
dynamic compensation
dynamic deviation of mechanical subassemblies
dynamic deviation of mechanical sub‐assemblies
dynamic deviation of simultaneous movement
dynamic analysis
dynamic characteristic
dynamic calculation
dynamic data
dynamic data
dynamic definition
dynamic manipulator property
dynamic manipulator property
dynamic unit
dynamic sensitivity
dynamic accuracy
dynamic precision
dynamic accuracy of robot
dynamic generator characteristic
dynamic responses of automatic measurement means
dynamic compensation
sweep balance dynamic magnetic storage technique
dynamic manipulator property
dynamic mass‐spectrometer
dynamic operation
dynamic optimization
dynamic parallel program structure
stran 68 od 326
EN ‐DE: slovar avtomatizacije in robotike dynamische Probe
dynamische Probe des Manipulationssystems)
dynamische Problemprüfung
dynamische Programmierung
dynamische Programmstruktur
dynamische Randbedingung
dynamische Reibung
dynamische Roboterbeanspruchung
dynamische Robotereigenschaft
dynamische Schaltung
dynamische Simulation
dynamische Verknüpfung
dynamische Verknüpfung
dynamische Verschiebung
dynamische Verzögerung
dynamische Wiedergabegenauigkeit
dynamische Zuordnung
dynamischer Ausgleich
dynamischer Bereich
dynamischer Betrieb
dynamischer Einmodenlaser
dynamischer Fehler
dynamischer Gleichgewichtszustand
dynamischer Gleichgewichtszustand
dynamischer Kräfteausgleich an Robotern
dynamischer Regelfaktor
dynamischer Regelfaktor
dynamischer Speicher
dynamischer Speicher
dynamischer Speicher mit wahlfreiem Zugriff
dynamischer Speicherauszug
dynamischer Wellenmesser
dynamischer Widerstand
dynamischer Zustand
dynamisches Betriebsverhalten
dynamisches Element
dynamisches Gerät
dynamisches Gleichgewicht
dynamisches Gleichgewicht
dynamisches Regelsystem
dynamisches Roboterverhalten
dynamisches Steuersystem
dynamisches System
dynamisches Unterprogramm
dynamisches Verhalten
Dynamoregler
ebene Bewegung r
ebene grafische Struktur
Echo durch Gerätefehler
Echoanzeiger
Echoimpulse
Echolot
Echoprüfung
Echoprüfung
Echosignal
Echozeichen
echte Totzeit
echte Totzeit
Echtzeitanforderung
Echtzeitanwendung
Echtzeitausgabe
Echtzeitbasis
Echtzeitbetrieb (eines Roboters)
Echtzeitbetriebssystem
Echtzeitbilderfassung
Echtzeitdaten pl
Echtzeitdatenausgang
Echtzeitdateneingang
Echtzeitdatenverabeitung
Echtzeit‐Datenverarbeitung
Echtzeiteingabe
Echtzeiteinsatz
Echtzeitmodellierung Echtzeitsimulator
Echtzeitsteuerprogramm
Echtzeittelemetrie
dynamic test (of manipulation system)
dynamic test (of manipulation system)
dynamic problem checking
dynamic programming
dynamic program structure
dynamic boundary condition
dynamic friction
dynamic robot load
dynamic robot property
dynamic circuit
dynamic simulation
dynamic link[ing]
dynamic binding
dynamic relocation
dynamic lag
dynamic fidelity
dynamic allocation
sweep balance dynamic range
dynamic regime
dynamic single‐mode laser
dynamic error
dynamic balance
dynamic equilibrium
dynamic force compensation on robots
deviation ratio
offset ratio
dynamic storage
dynamic memory
DRAM, dynamic random access memory
dynamic dump
dynamic wavemeter
dynamic resistance
dynamic state
dynamic operational behaviour
dynamic element
dynamic device
dynamic balance
dynamic equilibrium
dynamic control system
dynamic robot performance
dynamic control system
dynamic system
dynamic subroutine
dynamic behaviour
dynamo‐governor
flat movement
plane graphic structure
parasitic echo
blip
echo pulse
echo altimeter
echo checking
echo testing
echo signal
blip
pure time delay
real dead time
real‐time demand
real‐time application
real‐time output
real‐time base
real‐time operation (of robot)
real‐time operating system
real‐time image acquisition
real‐time data
real‐time output
real‐time input
real‐time data processing
real‐time data processing
real‐time input
real‐time application
analog computer simulation
real‐time simulator
real‐time control program
real‐time telemetry
stran 69 od 326
EN ‐DE: slovar avtomatizacije in robotike Echtzeitverarbeitung
Echtzeitverarbeitungssystem
Eck
Eckfrequenz
Eckfrequenz
Eckfrequenz
Eckkreisfrequenz
EDV‐System
EDV‐System
effektiv
effektive Arbeitszeit
effektive Leistung
effektive Spanne
effektiver Messbereich
effektiver Widerstand
Effektivfläche Effektivwert
Effektivwert
Effektor
Effektor
Effektor
Effektor
Effektor
Effektor eines Industrieroboters
Effektoradaption
Effektoranwendungsgebiet
Effektoranwendungsgebiet
Effektoranwendungsgebiet
Effektoraustausch
Effektorbahn
Effektorbasiskoordinate
Effektorbewegung
Effektorbewegungsführung
Effektorbezugssystem
Effektoreinwirkung auf die Roboterumwelt
Effektorenbewegung
Effektorfeinpositionierung
Effektor‐Feinpositionierung
effektorfester Referenzpunkt
Effektorfunktion
Effektorgeometrie
Effektorkoordinaten
Effektorkraftmessung
Effektormagazin
Effektororientierung in
Effektororientierungsdaten pl
Effektororientierungsdaten pt
Effektorort
Effektorort in Basiskoordinaten
Effektorort in Weltkoordinaten
Effektorposition
Effektorraumkurve
Effektorrechner
Effektorregelung
Effektorroboterorientierung
Effektorstellenergie
Effektortrajektorie
Effektorverhalten
Effektorzustand
effizienter Roboteralgorithmus
effizientes Programmiersystem
Effizienztheorem
eichen
Eichen
eichen
Eichfrequenz
Eichgenauigkeit eines Steuerungssystems
Eichgerät
Eichimpuls
Eichkreis
Eichkurve
Eichmessteilung
Eichpotentiometer
Eichsignal
Eichskale
Eichspannungsteiler
real‐time processing
real‐time system
corner
break point
corner frequency
corner frequency, break point
corner angular frequency
electronic data processing system
EDP system
effective
actual hours
actual capacity
actual range
effective range of measurement
effective resistance
effective area
effective value
virtual value
effector
actuating appliance
actuating unit
regulating element
regulating unit
robot effector, effector of Industrial robot
effector adaptation
effector field of use, effector field of application
effector field of use
effector field of application
effector exchange
effector path
effector base coordinate, base coordinate of robot effector
effector movement
effector movement guiding
effector reference system
effector action of robot environment
movement of effectors
fine positioning of effector
fine positioning of effector
effector‐fixed reference point
effector function
effector geometry
effector coordinates
effector force measurement
effector magazine
effector orientation in world
effector orientation data
effector orientation data
effector place
effector place in base coordinates
effector place in world coordinates
effector position
space curve of effector
effector computer
effector regulation
effector orientation of robot
effector adjusting energy
effector trajectory
effector behaviour
effector state
efficient robot algorithm
efficient programming system
efficiency theorem
gauge v
calibration
calibrate v
calibration frequency
calibration accuracy of control system
calibration instrument
calibration pulse
calibration circuit
calibration curve
calibration scale
calibrating potentiometer
calibrating signal
calibration scale
calibrating potentiometer
stran 70 od 326
EN ‐DE: slovar avtomatizacije in robotike Eichstrom
Eichstrom
Eichtemperatur
Eichtransformation
Eichung
Eichung des Regelstabes
Eichung von Messgeräten
Eichungsgenauigkeit
Eichwiderstand
Eigenabklingen
Eigenabklingen
Eigenadmittanz
Eigenbedarfsgenerator
eigene Modulation
Eigenenergie
Eigenfrequenz
Eigenfrequenz eines Roboters
Eigenfrequenzkennlinie
Eigenfunktion
Eigenkinetik
Eigenkreisfrequenz
Eigenlösung
eigenmächtige Funktion
Eigenrauschen
eigenrelative Adresse
Eigenscheinleitwert
Eigenschwingung
Eigenschwingung
Eigenschwingung
Eigenschwingung
Eigenschwingung
Eigenschwingungen in Servosystemen
Eigenstabilisierung
Eigenstabilität
eigentlich monoton
Eigenvektor
Eigenwert
Eigenwertaufgabe
Eigenwertgleichung
Eigenwertproblem
Eigenwertproblem
Eigenzustand
Eignung
Ein‐ und Ausgangssteuerung
Einachsenlasergyroskop
Einachsenlasergyroskop
einachsige Bahnbewegung
ein‐aus
Ein‐Aus‐Regler
Ein‐Aus‐Regler
Ein‐Aus‐Regler
Ein‐Aus‐Regler
Ein‐Aus‐Schalter
Ein‐Aus‐Schaltung
Ein‐Aus‐Servomechanismus
Ein‐Aus‐Steuerung
Ein‐Aus‐Tastung
einbauen
einbauen
Einchiprechner
eindeutig
eindeutig bestimmt eindeutige Funktion
eindeutige Funktion
eindeutige Koordinatenzuordnung
Eindeutigkeit einer Lösung
Eindeutigkeitssatz eindimensional
eindimensionale Abtastung dimension unique
eindimensionale Bewertung
eindimensionale Kette
eindimensionales Bewertungssystem
eindimensionales Datenfeld
Eindringen
Eindringen
Eindringenenergie
calibration current
calibration flow
calibration temperature
gauge transformation
calibration
control rod calibration
measuring instrument calibration
calibration accuracy
calibration resistance
natural attenuation
natural damping
self‐admittance
auxiliary generator
self‐modulation
characteristic energy
natural frequency
natural frequency of robot
natural frequency response of the system
eigenfunction
intrinsic kinetics
damped natural angular frequency
eigenfunction
arbitrary function
basic noise
differential address
self‐admittance
autooscillation
self‐oscillation
selfvibration
free oscillation
natural oscillation
autooscillations in servosystems
self‐stabilization
inherent stability
strongly monotonic
eigenvector
eigenvalue
eigenvalue problem
eigenvalue equation
characteristic value problem
eigenvalue problem
characteristic state
suitability
input‐output control
one‐axis laser gyroscope
single‐axis laser gyroscope
single‐axle orbital motion
on‐off
on‐off controller
on‐off regulator
twolevel controller
two‐position [action]
on‐off switch
stop‐start control
on‐off servomechanism
on‐off control
on‐off keying
install v
setup v
single‐chip computer
unique uniquely determined one‐valued function
simple function
unique coordinate assignment
uniqueness of solution uniqueness theorem one‐dimensional
one‐dimensional scanning
one‐dimensional evaluation
one‐dimensional circuit
one‐dimensional evaluation system
one‐dimensional data field
penetration
penetrating
penetration energy
stran 71 od 326
EN ‐DE: slovar avtomatizacije in robotike Eindringtiefe
Eindringtiefe
Einebenen‐Interruptsystem
Einerrücklauf
eines Schweißroboters
einfach zusammenhängend
Einfachbetrieb
einfache (leichte) Programmierung
einfache Dekomposition
einfache Einlegefunktion
einfache Funktion
einfache Funktion
einfache Genauigkeit
einfache Genauigkeit
einfache Handhabetechnik
einfache Montageoperation
einfache Robotersprache
einfache Signalauswertung
einfache Werkstückmontage
einfache Werkstückmontage
einfacher Abstandssensor (Distanzsensor)
einfacher Bewegungszyklus
einfacher Greiferantrieb
einfacher Kraftsensor
einfacher Manipulator
einfacher Montageautomat
einfacher Montageroboter
einfacher Regler
einfacher Roboter
einfacher Roboterservoregler
einfacher Sensor
einfacher Sensoraufbau
einfacher Sichtsensor
einfaches Einlegegerät
einfaches Fügen mittels Industrieroboters
einfaches Kontrollelement
einfaches Montagesystem
einfaches Regelkreissystem
einfaches Roboterfügen
einfaches Verzögerungsnetzwerk
einfachlogarithmisch
Einfachregelkreis
Einfachregister
Einfachroboter
Einfachstrom simple
Einfachstrom simple
Einfachstrom simple
Einfahren eines IR in eine Position
Einfahrverhalten
Einflussgröße
Einflußgröße
Einflussgröße
Einflußgröße
Einflussgröße
Einflusskorrektur
Einfügegerät
Einfügekopf
Einfügen der Bauteile
Einfügeoperation
Einfügeroboter
Einfügeroboter für Bauteile
Eingabe analoger Informationen
Eingabe geometrischer Strukturen
Eingabe von Steuerinformationen
Eingabeadressenbereich
Eingabe‐Ausgabe‐Einheit
Eingabe‐Ausgabe‐Einheit
Eingabe‐Ausgabe‐Gerät
Eingabe‐Ausgabe‐Gerät
Eingabe‐Ausgabe‐Interface
Eingabe‐Ausgabe‐Liste
Eingabe‐Ausgabe‐Modell
Eingabe‐Ausgabe‐Puffer
Eingabe‐Ausgabe‐Pufferspeicher
Eingabe‐Ausgabe‐Steuersystem
Eingabe‐Ausgabe‐Supervisor
penetration
penetrating
single‐level interrupt system
end‐around carry
welding robot movement cycle
simply connected
simplex operation
simple programming
simple decomposition
simple loading function
one‐valued function
simple function
single precision
single accuracy
simple handling technique
simple assembly operation
simple robot language
simple signal evaluation
simple assembly
simple work piece assembly
simple distance sensor
single‐movement cycle
simple gripper drive
simple force sensor
simple handler
simple assembly automaton
simple assembly robot
simple controller
simple robot, single robot
simple robot servo‐regulator
simple sensor
simple sensor structure
simple visual sensor
simple loading device
simple robot Jointing
simple check element
simple assembly system
one‐loop control system
simple robot Jointing
simple lag network
semi‐logarithmic
single‐variable control system
simple register
simple robot, single robot
neutral current
simple current
single current
initial operation of IR in the position
approach mode
actuating variable
influence size
influence size
influencing value
influencing variable
action correction
inserting device
insertion head
insertion of composants
insertion operation
insertion robot
insertion robot for compos‐
analog input
geometric structure input
input of control information
input address area
input‐output device
input‐output unit
input‐output device
input‐output unit
input‐output interface
input‐output list, I O list
input‐output model
input‐output buffer
input‐output buffer store
input‐output control system
input‐output supervisor, I O supervisor
stran 72 od 326
EN ‐DE: slovar avtomatizacije in robotike Eingabe‐Ausgabe‐Uberwachung
Eingabe‐Ausgabe‐Zyklus
Eingabebereich
Eingabe‐Bustyp
Eingabedaten pl
Eingabedaten pl (eines Roboterprogramms)
Eingabefluss
Eingabe‐Freigabesignal
Eingabefunktion
Eingabegerät
Eingabegerät
Eingabegerät
Eingabegeschwindigkeit
Eingabekanal
Eingabelochband
Eingabemaschine
Eingabemechanismus
Eingabeprogramm
Eingabeprogrammbeschreibung
Eingabespeicher
Eingabesteuereinheit
Eingabestrom
Eingabetor‐ Aktivierungssignal
Eingabeverfahren
Eingangs
Eingangsachse
Eingangsamplitudenbereich
Eingangsanzeigeleitung
Eingangsdaten pl
Eingangselement
Eingangsempfindlichkeit
Eingangsfilter
Eingangsgitterkapazität
Eingangsgleichspannung
Eingangsgroße
Eingangsgröße
Eingangsgröße mit Polynomcharakteristik
Eingangsimpuls
Eingangsinformation
Eingangsinformationsdauer
Eingangsinfrarotstrahl
Eingangskennwortleitung
Eingangskontrolle
Eingangskoordinate
Eingangsleistung
Eingangsmatrix
Eingangsscheinwiderstand
Eingangssignal
Eingangssignalwert
Eingangsspeicher
Eingangsstörung input power 332
Eingangsstrom
Eingangstransformator
Eingangsvariable
Eingangsvektor
Eingangsverstärker
Eingangsvorrichtung
Eingangsvorrichtung
Eingangswarenkontrolle
Eingangswicklung
Eingangswicklung
Eingangszeitkonstante
Eingangszustand
eingebaute Eichleitung
eingebaute Kontrolle
eingebaute Prüfung
eingebaute Schutzvorrichtung
eingebaute Weiderholautomatik
eingebauter Manipulator
eingebauter Mikroprozessor
eingebauter Minirechner
eingebauter Spannungsausfallschutz
eingebauter Temperaturfühler
Eingenverluste
eingeschwungene Datensignale
eingeschwungener Zustand
input‐output monitoring
input‐output cycle
input area
input bus type
input data
input data (of robot program)
input flow
input enable signal
input function
input equipment
input unit
sensing unit
input speed
input channel
input punched tape
input machine
input machine
input program
input program description
input store
input control unit
input flow
input enable signal
input action
input
input axle
input amplitude range
tag line in
input data
input element
input sensitivity
input filter
input grid capacity
direct current input voltage
input variable
input quantity
polynomial input
input pulse
input information
input information duration
infrared input flow
tag line in
incoming‐material control
input coordinate
input power
input matrix
input impedance
input signal
value of input signal
input store
input perturbation
input current
input transformer
input variable
input vector
input amplifier
input device
input element
incoming‐material control
input [power] winding
supply winding
input time constant
input state
built‐in gauge line
built‐in check
built‐in check
built‐in protection mechanism
built‐in repetition automatism
built‐in manipulator
built‐in microprocessor
built‐in minicomputer
built‐in power fail protection
embedded temperature detector
internal losses
stable data
state, steady
stran 73 od 326
EN ‐DE: slovar avtomatizacije in robotike eingeschwungener Zustand
Eingrenzung
Eingriffmöglichkeit
Eingriffsfunktion
Eingriffsignal
Eingriffsignal
Eingriffstelle
Eingrößensystem
Eingrößensystem
Einheit
Einheit für die Regelung
Einheitensystem
Einheitenunabhängigkeit f
einheitliche Maschinensprache
einheitlicher Datenträger
Einheitsanstiegs
Einheitsanstiegs
Einheitsanstiegsantwort
Einheitsanstiegsantwort
Einheitsanstiegsfunktion
Einheitsanstiegsfunktion
Einheitsimpuls
Einheitsimpuls
Einheitsimpuls
Einheitsimpuls Einheitsimpulsantwort
Einheitsimpulsfunktion
Einheitsimpulsfunktion
Einheitsimpulsfunktion
Einheitsimpulsreaktion
Einheitsintervall
Einheitskreis
Einheitsmatrix
Einheitsmatrix
Einheitsmethode Einheitssprung
Einheitssprung Einheitssprungantwort
Einheitssprungfunktion
Einheitssprungfunktion
Einheitssystem
Einheitsvektor
Einheitsvektorkomponente
Einhüllende
Einkanalanalysator
Einkoordinatenmodul
Einlaßsystem inlet temperature control 330
Einlegeeinrichtung
Einlegefunktion
Einlege‐Handhabetechnik
Einlegen
Einleger
Einlegeroboter
einleiten
Einleitung der Berechnung
Einleitung der Berechnung
einmalig einmalige Anwendung
Einmodenbetrieb
Einmodenlaser Einmodenverteilung einmodiger optischer Impuls
einordnen
Einphasenasynchronmotor r
Einphasenlinearmotor
Einphasensystem
Einphasentakt
Einprogrammbetrieb
Einpulslidar
Einpunktbetrieb
einreihen
Einrichtung mit wahlfreiem Zugriff
Einrichtung zur Informationsgewinnung
Einrichtungsendzustand
Ein‐Richtungsübertragung
Einsatz
steady state
localization
mesh possibility
influencing function
interrupt[ing] signal
break signal
point of engagement
single‐input single output system
SISO‐system (SISO = single‐input‐singel‐output)
unit
automatic controller
system of units
device independence
common machine language
common information carrier
unit ramp
unit‐ramp
unit ramp response
unit‐ramp response
unit ramp function
unit‐ramp function
unit‐impulse
delta function
unit impulse function
unit impulse unit‐impulse response
unit‐impulse function
delta function
unit impulse function
response to unit impulse
unit interval unit circle
identity matrix
unit matrix
standard method unit‐step
unit step unit‐step response
unit vector step function
unit‐step function
standard system
unit vector
unit vector component
envelope
single‐channel analyzer
one‐coordinate module
inlet system
loading device
loading function
loading handling technique
loading
loading device
loading robot, inserting robot
begin v
calculation initialization
computation initiation
unique one‐time application
single‐mode operation
unimodal laser unimodal distribution single‐mode optical pulse
arrange v
single‐phase asynchronous motor
single‐phase linear motor
monophase system
single‐phase clock
single‐program mode
monopulse lidar
burst mode
arrange v
random access device
device of information winning
device end status
unidirectional transfer
commitment
stran 74 od 326
EN ‐DE: slovar avtomatizacije in robotike Einsatz
Einsatz
Einsatz
Einsatz der Industrieroboter
Einsatz der Industrieroboter
Einsatz der Industrieroboter
Einsatz der Industrieroboter
Einsatz der Industrieroboter
Einsatz der Mikroelektronik in Roboter
Einsatz intelligenter Sensoren
Einsatz mehrerer Roboter
Einsatz mit zugeschnittenem Funktionsspektrum
Einsatzbedingung Einsatzbedingung eines IR
Einsatzbedingung eines Manipulators
Einsatzbedingung für Greifer
Einsatzbereich
Einsatzbereich eines Industrieroboters
Einsatzeffekt
Einsatzerprobung
Einsatzfall
Einsatzflexibilität
Einsatzproblem
Einsatztest
Einsatzvorbereitung von Schweißrobotern
Einsaugen
Einsaugen
Einschaltbefehl
einschalten
Einschalten Einschaltor normal magnetization curve 438
Einschaltspannung
Einschaltspannung
Einschaltstellung Einschaltstromspitze
Einschaltung
Einschaltverzögerung Einschaltverzug
Einschaltzeit Einschätzung
Einschätzung
Einschienenmanipulator
einschleifig
einschleifige Regelung
Einschubkreis
Einschubsystem interchangeable a fiches
Einschubverstärker
Einschwingeffekt
Einschwingimpuls Einschwingsignal
Einschwingvorgang m
Einschwingzeit
Einschwingzeit
Einschwingzeit
Einschwingzeit
Einschwingzustand
einseitige Laplace‐Transformation
einseitige Verzerrung
einseitiger Grenzwert
einseitiges Hybridsystem Einselement
einsetzen
einsteckbarer Mikroprozessor‐Emulator
Einsteckkreis
Einsteckverstärker
Einsteileinrichtung
Einstein Produkt
Einstein Summe
einstellbare Abformbacken
einstellbare Aussteuerung
einstellbare Backengeometrie
einstellbare Erregerkräfte
einstellbare Formbacken
einstellbare Greiferbacken
einstellbare Größe
einstellbare Länge
application
use
employment
robot operation, industrial robot operation, application of rob
applications of robots
industrial robot operation
robot operation
use of robots
application of microelectronics for robots
intelligent sensor application
multi‐robot application
dedicated‐function application
manipulator application condition
robot application condition
manipulator application condition
application condition of grip‐per
area of application
robot use region, use region of industrial robot
threshold effect field test
employment case
application flexibility
application problem
field test
operating preparation of welding robots
absorption
absorbing
closing order
connect v
switching‐on normally open gate
closing voltage
pull‐in voltage
switch‐on position peak making current
switching‐on turn‐on delay closing delay
turn‐on time appreciation
evaluation
monorail manipulator
single‐circuit
single‐loop feedback system
plug‐in circuit
plug‐in system
plug‐in amplifier
transient effect
transient pulse transient signal
transient [phenomenon] time of response
build[ing]‐up time
transient period
rise time
transient state
one‐sided Laplace transformation
bias distortion
one‐sided limit
unilateral hybrid system identity element
begin v
in‐circuit emulator
plug‐in circuit
plug‐in amplifier
adjusting device
Einstein product
Einstein sum
adjustable form jaws
adjustable drive
adjustable jaw geometry
adjustable exciter forces
adjustable form jaws
adjustable gripper jaws
regulating quantity
adjustable length
stran 75 od 326
EN ‐DE: slovar avtomatizacije in robotike einstellbare Zeitkonstante
einstellbarer Anschlag
einstellbarer Antrieb
einstellbarer Impulszähler mit automatischer Wiederholung
einstellbarer Kontakt
einstellbarer Regler
einstellbarer Schwellwert
einstellbarer Sensor
einstellbarer Spannungsstabilisator
einstellbares Drosselventil
einstellbares Gegengewicht
einstellbares Greiferspiel
einstellbares Grenzmoment
Einstellbefehl
Einstellbereich
Einstellbereich
Einstellbereich
Einstellcharakteristik
Einstellelement
Einstellelement
einstellen
einstellen
einstellen
einstellen
einstellen
Einstellen der Messkanäle
Einstellen der Schichtdicke am Spritzroboter
Einstellen des Aufzeichnungsgerätes
Einsteller
Einstellgenauigkeit
Einstellgerät
Einstellgerät
Einstellimpuls
Einstellimpuls
Einstellkennwert
Einstellkurve
Einstellmoment
Einstellmoment
Einstelloperation
Einstellpunkt der Warnung
Einstellregeln
Einstellskale
Einstellskale
Einstellskale
Einstellsystem füt Potentiometer
Einstellung
Einstellung"des Roboterarbeitsganges
Einstellungskennwert
Einstellungsschlüssel
Einstellverfahren
Einstellvorrichtung
Einstellwert
Einstellwert
Einstellwert
Einstellwert bei Teilehandhabung
Einstellwiderstand
Einstellzeit
Einstranganlage
Einstufenprozess
einstufige Robotermontage
einstufiger Verstärker
einstufiger Verstärker
Eintaktrelaissystem unique
Eintaktzyklusäquivalent
Einteilung
Einteilungssystem
eintretender Strom
eintretender Strom
Eintrittsdruck
Eintrittsstrom
Eintrittsstrom
Eintrittstemperaturregelung
Eintrittswahrscheinlichkeit
Eintrittswinkel
Einwegautomat
Einweggleichrichter
adjustable time constant
adjustable striking
adjustable drive
adjustable impulse counter with automatic rerun
adjustable contact
adjustable controller
adjustable threshold
adjustable sensor
adjustable voltage stabilizer
adjustable restriction valve
adjustable counter‐balance
adjustable gripper play
adjustable limit moment
adjustment instruction
adjustment range
range of set value
tuning range
adjusting characteristic
adjusting element
setting device
adjust v
set v
align v
tune v
trim v
adjustment of measuring‐channels
coat thickness adjustment on spray robot
recorder adjustment
adjuster
setting accuracy
adjusting element
setting device
set pulse
setting pulse
adjusting characteristic
adjustment curve
controlling torque
driving torque
adjusting operation
alarm setting tuning rules
regulation scale
tuning scale
tuning dial
potentiometer‐setting system
setting
adjustment of robot operation
adjusting characteristic
adjusting key
adjusting method
adjusting device
set point
setting
set value
adjustment value by manipulation of components
adjustable resistance
setting time
single‐stand unit
single‐stage process
single‐stage robot assembly
one‐stage amplifier
single‐stage amplifier
one‐tact relay system
single‐cycle equivalent
mapping
mapping system
incoming stream
input stream
input pressure
incoming stream
input stream
inlet temperature control
probability of occurrence
root‐locus, angle of arrival
one‐way automaton
half‐wave rectifier
stran 76 od 326
EN ‐DE: slovar avtomatizacije in robotike Einweisung eines Roboters
Einwirkungsdauer
Einwirkungsdauer
Einzeichensignalempfänger
Einzelbauelement
Einzelbusstruktur
Einzelfehlerkorrektur
Einzelgreiffläche
Einzelimpuls
Einzelimpulse
Einzelimpulsverzögerung
Einzelinstrumentierung
Einzelleitungssteuereinheit
Einzelobjekt
Einzelprogrammbetriebsart
Einzelpunktsteuerung
Einzelschaltkontrolle
Einzelschrittarbeitsweise
Einzelschrittarbeitsweise
Einzelschrittbetrieb Einzelschrittmodus
Einzelschrittverfahren
Einzelsteckeinheit‐Mikroprozessor unique
Einzelteil
Einzelverarbeitungsmodus
Einzelwert
Einzelzyklusbetrieb eines IR
Ein‐Zustand
Einzweckautomat
Einzweckautomat
Einzweckautomat
Einzweckautomat für Montage
Einzweckkanal
Einzweckmanipulator
Einzweckregler
Einzweckterminal
Einzweckterminal
elastische Elemente (einer IR‐Hand)
elastische Handelemente
elastische Membranlagerung
elastische Rückführung
elastische Rückführung
elastische Zwischenschicht
elastischer Auslegearm
elastischer Greiferfinger
elastischer Greiffinger
elastischer Körper
elastischer Robotergreiffinger
elastisches Getriebeglied
elastisches Greiferglied
electrodynamischer Durchflussmesser
electronic
electronisches Bahnabweichungsanzeigegerät
elektrisch
elektrisch angetriebene Hauptachsen
elektrisch angetriebene Lineareinheit
elektrisch angetriebener Roboterfaltarm
elektrisch angetriebener Roboterknickarm
elektrisch betriebene Roboterachse
elektrisch gesteuert
elektrisch löschbarer Speicher
elektrisch programmierbarer Speicher
elektrische Abfühlung
elektrische Abscheidung
elektrische Analogie
elektrische Anlage
elektrische Anpassung
elektrische Busstruktur
elektrische Datenabtastung
elektrische Datenausgabe
elektrische Datenspeicherung
elektrische Datenübertragung
elektrische Endlagensicherung
elektrische Feldstärke
elektrische Fernsteuerung
elektrische Fernübertragung
instruction of robot
duration of action
duration of effect
single‐signal receiver
separate component
single‐bus structure
single‐layer board
single‐grip surface, individual grip surface
individual pulse
discrete pulses
one‐pulse delay
single instrumentation
single‐line controller
individual object
single‐program mode
point‐to‐point positioning control
single‐switching test
single‐step mode
single‐step operation;
step‐by‐step operation step‐by‐step mode
single‐step method
single‐board microprocessor
one‐off part
dedicated mode
particular value
single‐cycle operation of IR
one state
single‐purpose automatic machine, single‐purpose automaton
single‐purpose automatic machine
singlepurpose
single‐purpose automatic machine for assembly, single‐purpo
dedicated channel
single‐purpose manipulator
single‐duty controller
application‐dedicated terminal
application‐dedicated terminal, ADT, dedicated terminal
elastic elements
elastic manual elements, elastic hand elements
elastic membrane support
elastic feedback
variable feedback
elastic intermediate layer
elastic jib, elastic arm
elastic gripper finger
elastic grip finger
elastic body
elastic robot finger‐grapping
elastic gear element
elastic gripper element
electrodynamic flowmeter
electronic
electronic trajectory deviation indicator
electric[al]
electric‐driven main axles
electric‐operated linear unit
electric‐driven buckling arm of robot
electric‐driven buckling arm of robot
electric‐operating robot axis
electrically operated
electric‐erasable memory
electric‐programmable memory
electrical sensing
electrical separation
electrical analogy
electrical installation
electric adapting
electric structure of bus
electric data scanning
electric data output
electric data storage
electric data transmission
electric limit fuse
electric field intensity
electric remote control
electric remote transmission
stran 77 od 326
EN ‐DE: slovar avtomatizacije in robotike elektrische Fourier‐Analyse
elektrische Informationsspeicherung
elektrische Informationstechnik
elektrische Interfacebedingung
elektrische IR‐Steuerung
elektrische Isolierung
elektrische Kenndaten pl
elektrische Kontrolle
elektrische Korrektur
elektrische Lasthebeeinrichtung
elektrische Leitfähigkeit
elektrische Leitfähigkeit
elektrische Mess‐ und Prüfeinrichtung
elektrische Nullstellung
elektrische Prüfung
elektrische Regelung
elektrische Regelung
elektrische Regelvorrichtung
elektrische Regelvorrichtung
elektrische Regelvorrichtung
elektrische Robotersteuerung
elektrische Rückführung
elektrische Sensoreigenschaft
elektrische Signalauswertung
elektrische Signalauswertung
elektrische Stellglieder
elektrische Verbindung
elektrische Verschiebung
elektrische Ziffernlesung
elektrischer Analysator
elektrischer Antrieb
elektrischer Antrieb
elektrischer Antrieb
elektrischer Antrieb des Manipulatorarmes
elektrischer Dehnungsmesser
elektrischer Dehnungsmesser
elektrischer Differenzdruckgeber pression
elektrischer Druck‐Messumformer pression
elektrischer Entfernungsmesser
elektrischer Entladungsvakuummesser
elektrischer Entladungsvakuummesser
elektrischer Erfassungssensor
elektrischer Geber mechanischer Größen
elektrischer Industrieroboter
elektrischer Kontaktregler
elektrischer Lochprüfer
elektrischer Manipulator
elektrischer Master‐Slave‐Manipulator
elektrischer Prüfer
elektrischer Regler
elektrischer Regler
elektrischer Regler
elektrischer Roboter
elektrischer Schreiber
elektrischer Servomotor
elektrischer Servomotor
elektrischer Spindelantrieb
elektrischer Stellmotor
elektrischer Stellmotor
elektrischer Steuermotor
elektrischer Steuermotor
elektrischer Steuerungsantrieb
elektrischer Widerstand
elektrischer Zeitplangeber
elektrisches Abtastgerät
elektrisches Fernmessgerät
elektrisches Fernmesssystem
elektrisches Gleichgewicht
elektrisches Interface
elektrisches Relaiselement
elektrisches Resonanzrelais
elektrisches Signal
elektrisches Speicherregister
elektrisches Steuerungsgerät
elektrisches Widerstandsthermometer
elektroakustischer Effekt
electrical Fourier's analysis
electric information storage
electric information technique
electric interface condition
electric robot control, electric IR‐control
electrical insulation
electrical characteristics
electric test[ing]
electrical correction
electric load lift device
electrical conductance
electric conductivity
electrical measuring and test equipment
electrical zero
electric test[ing]
electric control
electrically operated control
electrically operated controller
electric controller
electric regulator
electric robot control, electric IR‐control
electric feedback
electric sensor property
electric signal evaluation, electrical signal evaluation
electric[al] signal evaluation
electric final control elements
electric connection
electric displacement
electric digital reading
electrical analyzer
electrically operated drive
electric drive
electric propulsion
electric drive of manipulator hand
electrical dilatometer
electric strain gauge
electric transmitter of differential pressure
electrical pressure measuring converter
electric telemeter
electric discharge vacuum gauge
vacuum electric discharge gauge
electric acquisition sensor
electric transmitter of mechanical values
electric industrial robot, electrical industrial robot, electrical] electrical contact controller
electric verifier
electric manipulator, electrical manipulator
electric master slave manipulator
electric verifier
electrically operated controller
electric controller
electric regulator
electric industrial robot, electrical industrial robot, electrical] electrical recorder
electric actuator
electric servomotor
electric spindle drive
electric actuator
electric servomotor
electric actuator
electric servomotor
electric control gear
electric resistance
electric time schedule transmitter
electrical scanner
electric telemeter
electric telemetering system
electrical balance
electric interface
electrical relay element
electric resonance relay
electric signal
electric store register
electric control gear
electric resistance thermometer
electroacoustic effect
stran 78 od 326
EN ‐DE: slovar avtomatizacije in robotike elektroakustischer Wandler
electroacoustic transducer
Elektroanalyse
electroanalysis
Elektroantrieb
electrically operated drive
Elektroantrieb
electric drive
Elektroantrieb
electric propulsion
Elektroantrieb mit geradliniger Bewegung motion s 4716
electric drive with progressive movement
Elektroantrieb mit geradliniger Bewegung motion s 4716
electric drive with rectilinear motion
Elektroantriebsblockierung
electric drives blocking
elektroautomatische Leistungsregelung electrochemical proceelectroautomatic power control
elektrochemisches Verfahren
electrochemical process
elektrodynamische Analogie
electrodynamic analogy
elektrodynamischer Schwingungsgeber
electrodynamic vibration pick‐up
elektrodynamischer Strahler
electrodynamic radiator
elektrodynamisches Instrument
electrodynamic instrument
elektrodynamisches Relais
electrodynamic relay
Elektroentladungsvakuummesser
electric discharge vacuum gauge
Elektroentladungsvakuummesser
vacuum electric discharge gauge
elektroerosive Bearbeitung
electroerosion treatment
electrographic recording technique
elektrografische Aufzeichnungstechnik
elektrohydraulisch angetriben
electrohydraulically operated
elektrohydraulischer Effekt
electrohydraulic effect
elektrohydraulischer Greiferantrieb
electrohydraulic gripper drive
elektrohydraulischer Greiferantrieb
electro‐hydraulic gripper drive
elektrohydraulischer Regelkreis
electrohydraulic control circuit
elektrohydraulischer Regler
electrohydraulic controller
elektrohydraulischer Servomechanismus
electrohydraulic servomechanism
elektrohydraulischer Umformer
electrohydraulic converter
elektrohydraulisches Regelungssystem
electrohydraulic control system
elektrohydraulisches Servoventil
electro‐hydraulic servo valve
elektrohydraulisches Servoventil
electrohydraulic servovalve
Elektroinstallation
electrical installation
elektrokinetisches Potential
electrokinetic potential
Elektrokontaktbearbeitung
electrocontact machining
Elektrolumineszenzdarstellungsschirm
electroluminescent display panel
Elektrolumineszenzelement
electroluminescent element
Elektrolumineszenzgeber
electroluminescence sensor
Elektrolumineszenzschirm
electroluminescent screen
Elektrolumineszenzsensor
electroluminescence sensor
electroluminescence sensor for manipulator control
Elektrolumineszenzsensor für Manipulatorsteuerung
elektrolytische Polarisation
electrolytic polarization
elektrolytische Wanne
electrolytic tank
electrolytic solution pressure
elektrolytischer Lösungsdruck
elektrolytischer Speicher
electrolytic store
elektrolytischer Zeitschalter
electrolytic timer
elektrolytisches Hygrometer
electrolytic hygrometer
Elektrolytkondensator
electrolytic capacitor
Elektromagnetgreifer
electromagnet gripper
elektromagnetische Ablenkung
electromagnetic deflection
elektromagnetische Abschirmung
electromagnetic screening
elektromagnetische Abschirmung
electromagnetic shielding
elektromagnetische Auslenkung
electromagnetic deflection
elektromagnetische Auslösung
electromagnetic release
elektromagnetische Dämpfung
electromagnetic damping
elektromagnetische Einheit
electromagnetic unit
elektromagnetische Greifereinrichtung
electromagnetic gripper equipment
elektromagnetische Kompensation
electromagnetic compensation
elektromagnetische Konstante
electromagnetic constant
elektromagnetische Kopplung
electromagnetic coupling
elektromagnetische Kriterien
electromagnetic criteria
elektromagnetische Linse
electromagnetic lens
elektromagnetische Pumpe
electromagnetic pump
elektromagnetische Schichtdickenmessung
electromagnetic thickness measurement of layers
elektromagnetische Schwingungen
electromagnetic oscillations
elektromagnetische Speicherleitung
electromagnetic transmission line storage
elektromagnetische Steuerung
electromagnetic control
elektromagnetische Verriegelung
electromagnetic locking
elektromagnetische Verzögerungsleitung
electromagnetic delay line
elektromagnetischer Greifer
electromagnet gripper
elektromagnetischer Ordner
electromagnetic order device
elektromagnetischer Strömungsmesser
electromagnetic flowmeter
elektromagnetischer Vibrationsbunker
electromagnetic vibration‐type buncer
elektromagnetischer Wandler
electromagnetic transducer
elektromagnetischer Zähler
electromagnetic counter
elektromagnetisches kontaktloses Relais
electromagnetic contactless relay
elektromagnetisches Kopieren
electromagnetic copying
elektromagnetisches Schütz
electromagnetic contactor
stran 79 od 326
EN ‐DE: slovar avtomatizacije in robotike elektromagnetisches Ventil
elektromagnetisches Wahrnehmungssystem
elektromechanische Blockierung
elektromechanische Roboterhardware
elektromechanische Verriegelung
elektromechanischer Abtaster
elektromechanischer Antrieb
elektromechanischer Impulsschreiber
elektromechanischer Manipulator
elektromechanischer Niederfrequenzoszillator
elektromechanischer Regler
elektromechanischer Umschalter
elektromechanischer Verstärker
elektromechanisches Differentialanalysiergerät
elektromechanisches System
elektromechanisches Zählrelais
elektrometrischer Verstärker
Elektromotorenmontage
Elektron
Elektronenbandspektrum
Elektronenemission
Elektronenkaskade
Elektronenkopplung
Elektronenleitfähigkeit
Elektronenmikroanalysator
Elektronenoptik
elektronenoptischer Bildwandler
Elektronenstoß
Elektronenstrahl
Elektronenstrahlbehandlung
elektronenstrahlgeschweißte Verbindung
Elektronenstrahlmagnetometer
Elektronenstrahloszillograf
Elektronenstrahlröhre
Elektronenstrahlschwaißverbindung
Elektronenstrahlschweißparameter
Elektronenstrahlschweißtechnik
Elektronenstrahlschweißtechnologie
Elektronenstrahltechnologie
Elektronenstrahlumschmelzverfahren
Elektronenstrahlverteiler
Elektronenstrom
Elektronik einer Robotersteuerung
Elektronik feines Industrieroboters
Elektronikanwendung
Elektronikindustrie
elektronisch geregeltes Stromversorgungsgerät
elektronisch gesteuert
elektronisch gesteuerte Endmontage
elektronisch gesteuerter Umformer
elektronisch integrierter Arbeitsablauf
elektronische Abstimmempfindlichkeit
elektronische Auswuchtung
elektronische Automatisierung
elektronische Baugruppe
elektronische Baugruppe
elektronische Datenbank
elektronische Datenerfassung
elektronische Datensammlung
elektronische Datenstation
elektronische Datenverarbeitung
elektronische Datenverarbeitung
elektronische Drehzahlmessung
elektronische Fernsteuerung
elektronische Führung
elektronische IR‐Steuerung
elektronische Koordinateneinstellung
elektronische Kopplung
elektronische Leitung
elektronische Leseeinrichtung
elektronische Leseeinrichtung
elektronische Löschschaltung
elektronische Messergebniskompensation
elektronische Messwerterfassung
elektronische Münze
elektronische Niveauregelung
electromagnetic valve
electromagnetic perceptive system
electromechanical interlock
electromechanical robot hardware
electromechanical interlock
electromechanical scanner
electromechanical drive
electromechanical impulse recorder
electromechanical manipulator
electromechanical low‐frequency control oscillator
electromechanical controller
electromechanical change‐over switch
electromechanical amplifier
electromechanical differential analyzer
electromechanical system
electromechanical metering relay
electrometric amplifier
electric motor assembly
electron
electron band spectrum
electron emission
electron cascade
electron coupling
electron conductivity
electronic microanalyzer
electron optics
electron‐optical image converter
electronic impact
electron beam
electron‐beam treatment
electron beam weld[ed] joint
electron‐beam magnetometer
electron‐beam oscillograph
cathode‐ray tube
electron beam weld[ed] joint
electron beam welding parameters
electron beam welding technique
electron beam welding technology
electron‐beam technology
electron beam remelting process
electron‐beam distributor
electron current
electronics of robot control
robot electronics, industrial robot electronics
electronic application
electronics industry
electronically controlled power supplay unit
electronically controlled
electronic‐controlled final assembly
electronically controlled converter
electronic‐integrated processing
electronic tuning sensitivity
electronic balancing
electronic automation
electronic building brick
electronic building bloc
electronic data bank
electronic data collection
electronic data collection
electronic data station
electronic data processing
EDP
electronic measurement of revolutions
electronic remote control
electronic direction
electronic robot control, electronic IR control
electronic coordinate setting
electron coupling
electronic direction
electronic reader
electronic reading device
electronic quenching circuit
electronic measuring result compensation
electronic logging of measured values
electronic coin
electronic level control
stran 80 od 326
EN ‐DE: slovar avtomatizacije in robotike elektronische optische Eingabeeinrichtung
electron‐optical input device
elektronische Regelung
electronically operated control
elektronische Regelung
electronic control
elektronische Regelung der Leitfähigkeit
electronic conductivity control
elektronische Roboterhardware
electronic robot hardware
elektronische Robotersteuerung
electronic robot control, electronic IR control
electronic circuit technique
elektronische Schaltungstechnik
elektronische Schlupfmesseinrichtung
electronic slip measuring device
electronic voltage controller
elektronische Spannungskontrolleinrichtung f
electronic
elektronische Spannungskontrolleinrichtung f
elektronische Speichereinheit
electronic storage device
elektronische Steuerung
electronically operated control
elektronische Steuerung
electronic control
elektronische Uhr mit kodiertem Digitalsignal
electronic clock with coded digital signal
elektronische Zählschaltung
electronic couting circuit
elektronische Zeichenerkennung
electronic character recognition
elektronische Ziffernlesung
electronic digit reading
elektronischer Abstimmbereich
electronic tuning range
elektronischer Antrieb
electronic drive
elektronischer Antriebsregler
electronic drive regulator
elektronischer Anzeigesichtbereich
electronic display viewing area
elektronischer automatischer Schalter
electronic automatic swith
elektronischer Baustein
electronic building brick
elektronischer Baustein
electronic building bloc
elektronischer Belichtungszeitmesser
electronic exposure time indicator
elektronischer Dampfturbinenregler electronic control systemelectronic controller of vapour turbines
elektronischer Dekadenzähler
electronic decade counter
elektronischer Drehzahl‐Grenzwertschalter
electronic switch of marginal speed
elektronischer Drehzahlmesser
electronic tachometer
elektronischer Erfassungssensor
electronic acquisition sensor
elektronischer Fehlerdetektor
electronic error detector
elektronischer Feuchtigkeitsmesser
electronic hygrometer
elektronischer Funktionsblock
functional electronic block
elektronischer Generator sehr niedriger Frequenzen
electronic generator of very low frequencies
elektronischer Grenzwertmelder
electronic limiting value indicator
elektronischer Impulsregler
electronic impulse regulator
elektronischer Kompensationsferngeber
electronic compensation teletransmitter
elektronischer Kreis
electronic circuit
elektronischer Leser
electronic reader
elektronischer Leser
electronic reading device
elektronischer Löschkreis
electronic quenching circuit
elektronischer Messwerterfasser
electronic logger (of measured values)
elektronischer Multiplikator
electronic multiplier
elektronischer Paralleldigitalrechner
electronic parallel digital computer
elektronischer Profilprojektor
electronic profile projector
elektronischer Raumthermostat
electronic spatial thermostat
elektronischer Rechenautomat
electronic computing automaton
elektronischer Rechner
computer
elektronischer Rechner
computing machine
elektronischer Rechner
calculating machine
elektronischer Rechner
calculator
elektronischer Regler
electronic regulator
elektronischer Regler
electronically operated controller
elektronischer Regler
electronic controller
elektronischer Roboter
electronic robot
elektronischer Rückstromregler
electronic reverse current controller
elektronischer Schaltautomat
electronic automatic swith
elektronischer Schreibautomat
electronic writing automaton
elektronischer Stift
light pen
elektronischer Stift
light stylos
elektronischer Stift
beam pen
elektronischer Stift
electronic pen
electronic overload detector
elektronischer Überlastungsdetektor
elektronischer Vielkanalanalysator
electronic multichannel analyzer
elektronischer Wählautomat
electronic select automaton
elektronischer Zeitauslöser
electronic timer
elektronischer Zufallszahlengenerator
electronic random number generator
elektronisches
electronic data collection
electronic component
elektronisches Bauelement
electronic element
elektronisches Bauelement
elektronisches Bausteinsystem
electronic modular system
elektronisches Bauteil
electronic component
elektronisches Bauteil
electronic element
elektronisches Datenverarbeitungssystem
electronic data processing system
elektronisches Datenverarbeitungssystem
EDP system
elektronisches Geld
electronic coin
stran 81 od 326
EN ‐DE: slovar avtomatizacije in robotike elektronisches Gerät
electronic device
elektronisches Geschwindigkeitssteuergerät n
electronic speed controller
elektronisches Informationsverarbeitungssystem
electronic information processing system
elektronisches Klassiergerät
electronic classifying instrument
elektronisches Lenkungsgerät
electronic guidance equipment
elektronisches Manometer
electronic pressure gauge
elektronisches Modell
electronic model
elektronisches Polarimeter electronic pressure gauge 244
electronic polarimeter
elektronisches Programmiergerät
electronic programming device
elektronisches Rechengerät
electronic calculator device
elektronisches Regelsystem
electronic control system
elektronisches Relais
electronic relay
elektronisches Schrittgebersystem
electronic step‐by‐step system
elektronisches Simulieren electronic controller of vapour turbelectronical simulating
electronic control desk
elektronisches Steuerpult
elektronisches System für Temperaturregelung
electronic system for temperature control
elektronisches Untersystem
electronic subsystem
elektronisches Verfahren
electronic process
elektronisches Warnsignalgerät
electronic warning signal device
elektronisches Zeitfolge‐Steuergerät
electronic time sequence control unit
elektronisches Zeitrelais
electronic timer
elektronisch‐magnetischer Stabilisator
electronic magnetic stabilizer
elektrooptisch abstimmbarer Laser
electrooptically tuned laser
elektrooptische Abbildung und Speicherung
electrooptical imaging and storage
elektrooptische Kopplung
electrooptical coupling
elektro‐optischer Annäherungssensor
electrooptical approximation sensor
elektro‐optischer Annäherungssensor
electro‐optical approximation sensor
elektrooptischer Funktionsgenerator
electrooptical function generator
elektro‐optischer Geber
electrooptical sensor
elektro‐optischer Geber
electro‐optical sensor
elektrooptischer Kaskadenmodulator
cascade electrooptic modulator
elektro‐optischer Sensor
electrooptical sensor
elektro‐optischer Sensor
electro‐optical sensor
elektropneumatisch
electropneumatic
electropneumatically controlled feed slide
elektropneumatisch gesteuerter Zuführapparat
elektropneumatische Folgesteuerung
electropneumatic sequential control
elektropneumatische Sperre
electropneumatic interlock
elektropneumatische Steuervorrichtung
electropneumatic control device
elektropneumatischer Effektor
electropneumatic actuator
elektropneumatischer Fahrschalter
electropneumatic controller
elektropneumatischer Hochdruckumformer
electropneumatic high‐pressure converter
elektropneumatischer Kleinregler
small electropneumatical regulateur
elektropneumatischer Pegelregler
electropneumatic level controller
elektropneumatischer Regler
electronic‐pneumatic controller
elektropneumatischer Schalter
electric‐pneumatic switch
elektropneumatischer Stellungsregler positions
electropneumatic position governor
elektropneumatisches Ventil
electropneumatic valve
elektropneumonische Pegelregelung
pneutronic level control
Elektroregler
electrically operated controller
Elektroregler
electric controller
Elektroregler
electric regulator
elektrostatische Ablenkung
electrostatic deflection
elektrostatische Abschirmung
electrostatic screen
elektrostatische Abstoßung
electrostatic repulsion
elektrostatische Abtastung
electrostatic scanning
elektrostatische Anziehung
electrostatic attraction
elektrostatische Bündelung
electrostatic beaming
elektrostatische Bündelung
electrostatic focusing
elektrostatische Fokussierung
electrostatic beaming
elektrostatische Fokussierung
electrostatic focusing
elektrostatische Operation
electrostatic process
elektrostatische Technik
electrostatic technique
elektrostatischer Schirm
electrostatic screen
elektrostatisches Abfühlen
electrostatic sensing
Elektrotechnik
electrical engineering
elektrothermisch
electrothermal
elektrothermische Bearbeitung
electrothermal machining
elektrothermischer Drucker
thermal printer
elektrothermischer Drucker
electrothermic printer
elektrothermischer Drucker
thermoprinter
Element
member
Element
element
Element der Matrix
matrix element
Element eines IR
element of industrial robot
Element für digitale Automatisierung
element for digital automation
Element mit
saturating nonlinearity
stran 82 od 326
EN ‐DE: slovar avtomatizacije in robotike Element mit Begrenzung
Element mit eindeutiger Kennlinienfunktion
Element mit Hysterese
Element mit Lose
Element mit mehrdeutiger Kennlinienfunktion
Element mit mehrdeutiger Kennlinienfunktion
Element mit Sättigung
Element mit Spiel
Element mit Totzeit
Element mit verteilten Parametern
Element mit zweideutiger Kennlinienfunktion
Element mit Zweipunktverhalten
Element ohne Trägheit
Elementaralgorithmus
Elementaralgorithmus
Elementaranalyse
Elementarbaustein
Elementarbewegung feiner Greifereinheit
elementare Information
elementare logische Verknüpfungen
elementarer Automat
elementarer logischer Satz
elementarer Sensor
elementarer Sensor
elementares Ereignis
elementares Iterationsverfahren
elementares Systemunterprogramm
Elementarfunktion
Elementarglied
Elementarintervall Elementaroperation
Elementarreaktion
Elementarsensor
Elementarsensor
Elementarvorgang
Elementarvorgang
Elementvariable
Elementwirkungsgrad
elliptische Funktion
elliptische Gleichung
elliptisches System
Emissionsanalyse
Emissionshäufigkeit
Emissionsimpuls
Emissionskennlinie
Emissionsmesstechnik
Emissionsspektralanalyse
Emissionsstärkemessung
Emissionssteuerung
Emissionswahrscheinlichkeit
emittierter Impuls
Empfänger
Empfänger für kohärente Strahlen
Empfängerprogramm
Empfängertakt
Empfangsanlage
Empfangsbestätigung
Empfangsbestätigungsrelais
Empfangsdaten pl
Empfangseinrichtung
Empfangseinrichtung
Empfangseinrichtung
Empfangsgeschwindigkeit
Empfangskanal
Empfangsseite
Empfangsterminal
empfindlich
empfindlicher Berührungssensor
empfindlicher Kraftsensor
empfindlicher programmierbarer Roboter
empfindlicher Roboter
Empfindlichkeit
Empfindlichkeit gegenüber elektromagnetischen Feldern
Empfindlichkeitsanalyse
Empfindlichkeitsbereich
Empfindlichkeitsbereich
limiting nonlinearity
single‐valued nonlinearity
nonlinearity with hysteresis
backlash nonlinearity
multivalued nonlinearity
multi‐valued nonlinearity
saturating nonlinearity
backlash nonlinearity
element with time delay
element with distributed parameters
two‐valued nonlinearity
on‐off nonlinearity
element without inertia
elementary algorithm
primary algorithm
elementary analysis
elementary building block
elementary movement of gripper
elementary information
elementary logical connections
elementary automaton
elementary logical theorem
elementary sensor
simple sensor
simple event
elementary iteration procedure
elementary system subprogram
elementary function
elementary member
unit interval elementary operation
elementary reaction
elementary sensor
simple sensor
basic process
elementary process
element variable
element efficiency
elliptic function
elliptical equation
elliptical system
emission analysis
emission rate
emission pulse
emission characteristic
emission measurement technology
emission spectral analysis
emissivity measurement
emission control
emission probability
emission pulse
receiver
laser pick‐off unit
receiver program
receive clock
receiving plant
acknowledgement acknowledge, ACK, answerback
acknowledging relay
receive data
reception device
receiving device
receiving gear
receiving speed
receive channel
receiving end
receiving terminal
sensitive
sensitive contact sensor
sensitive force sensor
programmable sensitive robot
sensory robot
sensitivity
magnetic field sensitivity
sensitivity analysis
range of sensitivity
sensitivity region
stran 83 od 326
EN ‐DE: slovar avtomatizacije in robotike Empfindlichkeitsfunktion
Empfindlichkeitsgrad
Empfindlichkeitskehrwert
Empfindlichkeitskriterium
Empfindlichkeitskurve
Empfindlichkeitsverlust
Empfindung
empirischer Wert
empirisches Modell
empirisches Verfahren
Emulationssprache
Emulationssystem
Emulgiermaschine
emulierte Struktur
Endanschlaggeber
Enddruck
Ende des Zyklus
Endeffektor
Endeinstellung
Endgröße
Endkontrolle feines Industrieroboters
Endkontrollgerät
Endkörper eines Roboters
Endlage
Endlagengeber
Endlageninitiatoren
Endlagenüberwachung
endlich
endlich‐dimensional
endlich‐dimensionaler Vektorraum
endliche Breite des Impulses
endliche Differenzen
endliche Folge
endliche Impulsbreite
endlicher Automat
endlicher Stabilitätsgrad
endliches Zeitmoment
Endlosanlage
Endmontage
Endmontage mittels Industrieroboters
Endposition
Endposition
Endposition
Endprüfung
Endpunkt (einer Greiferbahn)
Endpunkt eines Manipulators
Endpunkt eines Verschiebevektors
Endpunktlage eines Manipulators
Endpunkt‐Monitorprogramm
Endpunktroboter
Endregelgröße
Endregelungsorgan
Endregelunsorgan
Endschalter
Endstelle
Endstellen‐Monitorprogramm
Endstufe
Endübertrag
Endvakuumdruck Endwert
Endwert der Verstärkung
Endwertregelung
Endwertsatz
Endwertsatz
Endzustand
energetische Methode
energetischer Wirkungsgrad
energetischer Zustand
energetisches Modell
Energie
Energie am absoluten Nullpunkt
Energie feiner Greifeinheit
Energieabnahme
Energieanalysator
Energieaufwand
Energiebalancemethode
sensitivity function
degree of sensitivity
sensibility reciprocal
sensitivity criterion
sensitivity curve
sensitivity loss
perception
empirical value
empirical model
empirical procedure
emulation language
emulation system
emulsifier
emulated structure
final dog indicator
ultimate pressure end of cycle
end effector, final effector
final adjustment
final quantity
final checking of industrial robot
transmission monitor
final body of robot
full home position
final dog indicator
final position initiators
final position monitoring
finite
finite‐dimensional
finite dimensional vector space
finite pulse width
finite differences
finite sequence
finite pulse width
finite automaton
finite degree of stability
finite time instant
endless installation
final assembly, end assembly
end assembly by means of the industrial robot
end position, final position
end position
final position
final inspection
end point
manipulator end point
end point of shift[ing] vector
manipulator end point position
terminal monitor program
end point robot
final controlled variable
final regulation element
final regulation element
limit switch
terminal
terminal monitor program
final stage
end‐around carry
ultimate pressure final value
final value of amplification
terminal control
final value theorem
final‐value theorem
end status
energetic method
energetic efficiency
energy state
energy model
energy
energy of absolute zero
energy of grip unit
energy decrement
energy analyzer
energy consumption
energetic balance method
stran 84 od 326
EN ‐DE: slovar avtomatizacije in robotike Energiebalancemethode
Energiebalancemethode
Energieband
Energiebedarf
Energiebedarf
Energiebetrag
Energiebilanz
Energiedekrement
Energiedichte
Energieeingang
Energieeingang
Energieeinspeisung
Energieeinspeisung
Energieempfindlichkeit
Energieerhaltungssatz
Energiefernleitung
Energiefortleitung
Energiefortleitung
Energiefortleitung
Energiegleichgewicht
Energieleitung
Energiemenge
Energiemodell
Energieniveau
Energieniveauabstand
Energieniveauänderungswert
energieökonomisches System
energieoptimale Steuerung
Energiepegeldiagramm
Energiequelle
Energiesatz
Energieschema
Energieschranke
Energieschwelle
energiesparende Technologie
Energiespeichereinheit
Energiespektrum
Energiestufenabstand
Energietransportleitung
Energieübertragung
Energieübertragung
Energieübertragung
Energieübertragungskoeffizient
Energieumformer
Energieumformung
Energieumsatz
energieunabhängiger Speicher
Energieverbrauch
Energieverbrauch (des Roboters)
Energieverlust
Energieversorgungssystem
Energieverteilung
Energiezufuhrabschaltung
Energiezustand
eng gekoppelte Prozessoren mpt
entartetes Energieband
Entartungsgrad
entblocken entblocken entblocken Entdämpfung
Enterprise‐Informationssystem
Enterprise‐Informationssystem
entfernt aufgestellte Datenendstation
entfernt aufgestellte Datenendstation
Entfernungsbestimmung feines Roboters
Entfernungserkennungssystem
Entfernungserkennungssystem (mittels Mikrowellen)
Entfernungsmarkierergenerator
Entfernungsmesser mit hoher Auflösung
Entfernungsmesskreis
Entfernungsrichtigstellung
Entfernungssensor
Entfeuchtungsanlage
Entfeuchtungsprozess m
Entgraten durch Roboter
method of energetic balance
power balance method
energy band
power consumption
power demand
amount of energy
energy balance
energy decrement
energy density
energy input
addition of energy
energy input
addition of energy
energy sensitiveness
energy theorem
power transmission line
energy transfer
energy transmission
power transmission
energy balance
energy line
amount of energy
energy model
energy level
energy‐level spacing
energy‐level change value
energy‐economical system
energy‐optimal control
energy‐level diagram
source of energy
energy theorem
energy‐level diagram
energy barrier
energy barrier
energy‐saving technology
energy storage unit
energy spectrum
energy‐level spacing
power transmission line
energy transfer
energy transmission
power transmission
energy transfer coefficient
energy converter
power conversion
energy transfer coefficient
energy‐independent store
energy consumption
power consumption (of robot)
energy decrement
power supply system
power distribution
tripping of power supply
energy state
tightly coupled processors
degenerate energy level
degree of degeneration
unlock v
unblock v
deblock v damping elimination
enterprise information system
EIS
remote terminal
remote station
robot distance identification
distance recognition system
distance recognition system (by means of microwaves)
range marker generator
high‐definition rangefinder
range circuit
range correction
distance sensor
dehumidifying plant
dehydration process
robot deburring, deburring by robot
stran 85 od 326
EN ‐DE: slovar avtomatizacije in robotike Entgraten plastischer Teile
Entgraten von Werkstücken
Entgratungsarbeitsplatz
Enthaltensein‐Relation
Entkellern
entketten
Entkopplung
Entkopplung von Mehrfachregelungen
Entkopplungsanteil
Entkopplungsglied
Entkopplungsschaltung
Entkopplungsschaltung
Entlastungsventile für den Armgliedmasseausgleich
Entmagnetisierautomat
Entmagnetisierungseffekt
Entmagnetisierungsfaktor
Entnahmebetrieb
Entnahmeeinrichtung
Entnahmemanipulator
Entpolarisierungsgrad
entregen
Entropie
Entropie des optischen Signals
Entropiestabilität
entscheiden
Entscheiderschwelle
Entscheidung
Entscheidungsbefehl
Entscheidungsbefehl für Robotereinsatz
Entscheidungselement
Entscheidungsfunktion
Entscheidungskriterien
Entscheidungsmodell
entscheidungsorientierte Information
Entscheidungsraum
Entscheidungsregeln
Entscheidungsschaltung
Entscheidungsschaltung
Entscheidungsstrategie für Robotereinsatz
Entscheidungstheorie
Entscheidungsverfahren
Entscheidungsverfahren für Robotereinsatz
Entscheidungswert
entschlüsseln
Entschlüsselung
Entschlüsselungsautomat
Entschlüsselungsautomat
Entschlüssler
Entschlüssler
Entschlüßler der Operationen
Entschlüsslerkreis
entspannter Greiferfinger
Entspannungssystem
entsperren
entsperren
entsperren
Entstaubungsanlage
Entstörer
Entstörungseinrichtungen
Entstörungsmessung
entwerfen
entwerfen
entwickelte Robotersprache
entwickelter Roboter
Entwickler für Rechner
Entwicklung der integrierten Elektronik
Entwicklung der Roboteranwendung
Entwicklung nach Eigenwerten
Entwicklung von Robotern
Entwicklungsarbeit
Entwicklungsarbeit
Entwicklungspotential
Entwicklungsprojekt
Entwicklungspunkt
Entwicklungsstand der Steuerungstechnik
Entwicklungstendenz
trimming of plastic pieces
deburring of wor pieces
trimming workplace
inclusion relation
pop
delink v
non‐interaction
decoupling of multiloop control
decoupling part
decoupling joint
isolating circuit
stopper circuit
safety valves for arm element mass compensation
automatic demagnetization device
demagnetizing effect
factor of demagnetization
draw‐off mode
taking device
charging manipulator, loading handler
degree of depolarization
deenergize
entropy
optical signal entropy
entropic stability
arbitrate v
decision threshold
decision
decision instruction
decision instruction for robot application
decision element
decision function
decision criteria
decision model
decision‐oriented information
policy space
decision rules
decision element
logical element
decision strategy for robot application
decision theory
decision procedure
decision procedure for robot application
decision value
decode v
decoding
automaton for decoding
decoding automaton
decoder
decoding machine
operation decoder
decoding circuit
relaxed gripper finger
blow‐down system
unlock v
unblock v
deblock v dust removal plant
noise suppressor
noise‐eliminating device
interference elimination measuring
design v
construct v
developed robot language
advanced robot
computer designer
development of integrated electronics
development of robots application
eigenfunction expansion
development of robots
development work
experimental work
development potential
development project
development point (theory of automata)
development stage of control technique
development trend
stran 86 od 326
EN ‐DE: slovar avtomatizacije in robotike Entwicklungsverfahren
Entwicklungszeit
Entwurf
Entwurf des Regelvorganges
Entwurf durch Iteration
Entwurf eines digitalen Systems mittels Rechners
Entwurf eines Montagesystems
Entwurf verfahrenstechnischer Systeme
Entwurf von Schaltkreisen
Entwurfalgorithmus
Entwurfsabkömmlinge
Entwurfsanalyse
Entwurfsarbeitsplatz
Entwurfsautomatisierung conception
Entwurfsautomatisierung conception
Entwurfsbaum
Entwurfsbedingungen
Entwurfsbelastung
Entwurfsgrundsatz
Entwurfskriterium eines Greifermechanismus
Entwurfsmethode
Entwurfsmodell
Entwurfsparameter
Entwurfsphase
Entwurfsprinzip
Entwurfsstrategie
Entwurfsziel
Entzerrer
Entzerrückkopplung
Entzerrung
Entzerrung
Entzerrung durch quantisierte Rückkopplung
Entzerrungselement
Entzerrungselement
Entzerrungselement
Entzerrvorkopplung
Erdbeschleunigung
Erdbeschleunigung
Erdfehlerschutz
Erdleitungsprüfer
Erdschluß
Erdschlußprüfer
Erdschlußstrom
Erdschlußstromschutzschalter
Erdschlußstromunterbrecher
erdsymmetrische Spannung
Erdungsanschluss
Erdungskontakt
Erdungskontakt
Erdungsmesser
Ereignis
Ereignis
Ereignis hoher Priorität
Ereignis niederer Priorität
Ereigniskennzeichnung
Ereignissteuerblock
Ereignissynchronisation
erfasste Roboterumwelt
erfasste Teilinformation
erfasstes Einzelobjekt
Erfassungvon Bauteilen in
Erfassung der charakteristischen Infrarotstrahlung
Erfassung der Sensorinformation
Erfassung eines Handhabungsvorgangs
Erfassung feines Handhabungsvorgangs
Erfassungssensor
Erfolgswahrscheinlichkeit
erforderliche Objektlage
erforderlicher Greifbereich
erforderlicher Raumpunkt (Roboter)
Erforschung mittels Roboters
Erfüllbarkeit
erfüllen
Erfüllung
Erfüllungsgrad einer Regel
Ergänzungsmachine
development technique
development time
design
control process design
iterative design
computer‐aided digital system design
design of assembly system, project of assembly system
design of chemical engineering system
design of switching circuits
design algorithm
design issues
design analysis
engineering working station, engineering workplace, construc
design automation
automation of project
design tree
design conditions
design load
design principle
design criterion of gripper mechanism
design procedure
design model
design parameter
design phase
design principle
design strategy
design goal
equalizer
correcting feedback
distortion elimination
compensation of distortion
quantized feedback equalization
correcting element
correction element
correction term
correcting feedforward
gravitational acceleration
gravity acceleration
earth‐fault protection
earth tester
earth‐fault
ground detector
earth leakage current
earth leakage current breaker
earth leakage current breaker
balanced voltage
earth terminal
earthing contact
earthing contact, ground contact
earth tester
event
occurrence
high‐priority event
low‐priority event
event identification
event control block
event synchronization
acquired environment of robot
acquired partial information
acquired individual object
acquisition of components in
characteristic infrared radiation detection
acquisition of sensor information
acquisition of handling process
acquisition of handling process
acquisition sensor
probability of success
required object position
required grip region
required space position
investigation by robot
satisfiability
satisfy v
satisfaction
degree of fulfillment
auxiliary machine
stran 87 od 326
EN ‐DE: slovar avtomatizacije in robotike Ergänzungsprogramm eines IR
Ergänzungsschaltung
Ergänzungsspeicher
Ergodenhypothese
ergodische Eigenschaft
ergodische Vermutung
Ergometer
erhöhen
erhöhte Temperatur
Erholungszeit
erkennbar
Erkennen
Erkennung
Erkennung (von Objekten)
Erkennung einer Parole
Erkennungsalgorithmus
Erkennungsalgorithmus
Erkennungsaufgabe
Erkennungsautomat
Erkennungsdaten pl
Erkennungseinrichtung
Erkennungsfunktion
Erkennungsinformation
Erkennungsinrichtung
Erkennungskode
Erkennungslogik
Erkennungsmethode
Erkennungsorgane
Erkennungssensor
Erkennungssensor
Erkennungssensor
Erkennungssensor für feste Objekte
Erkennungssoftware
Erkennungssoftware eines Industrieroboters
Erkennungssystem eines IR
Erkennungssystem mobiler Objekte
Erkennungssystem mobiler Objekte mobiles
Erkennungsteile
Erkennungsverfahren
Erkennungszeichen
Erkennungszeit
Erkundungssystem
Ermittlung der Grobposition
Ermüdung
Ermüdungstest
Ermüdungstest
Ermüdungsversuch
Ermüdungsversuch
Erneuerungstheorie
Eröffnung
erproben
erregende Größe
Erreger
Erregeranlage
Erregerkaskade
Erregerkraft
Erregerkraftvektor
Erregerkreis
Erregermaschine
Erregersatz
Erregung
Erregung und Hemmung
Erregungsdichte
Erregungsfluss
Erregungsfrequenz
Erregungsimpuls
Erregungsquerschnitt
Erregungsspannung
Erregungsspannung
Erregungsströmung
Erregungssystem
Erregungsübertragung
Erregungswicklung
Erregungszeit
erreichbar
erreichbare Genauigkeit
complementary program of IR
complementary circuit
backing store
ergodic hypothesis
ergodic property
ergodic hypothesis
ergometer
increment v
elevated temperature
recovery time
identifiable
identification (of objects)
recognition
identification (of objects)
recognition of parole
identification algorithm
recognition algorithm
recognition task
recognition automaton
recognition data
recognition equipment
recognition function
recognition information
recognition equipment
identifying code
recognition logic
recognition method
perception parts
perception sensor, identification sensor
perception sensor
identification sensor
sensor for identification of solid objects
identification software
robot identification software
robot identification system, IR identification system
recognition system of mobile objects
recognition system of mobile objects
perception parts
recognition procedure
acknowledge character, ACK
recognition time
pilot system
determination of coarse position
fatigue
fatigue test
fatigue trial
fatigue test
fatigue trial
renewal theory
opening
evaluate v
actuating quantity
exciter
exciter set
cascade exciter
exciter force
exciter force vector
excitation circuit
exciter
exciter set
activation
excitation and inhibition
excitation density
excitation flow
excitation frequency
excitation pulse
excitation cross‐section
excitation potential
excitation voltage
excitation flow
excitation system
excitation transfer
excitation winding
excitation time
accessible
obtainable accuracy
stran 88 od 326
EN ‐DE: slovar avtomatizacije in robotike erreichbare Zuverlässigkeit
Erreichbarkeit
Erreichbarkeit
Ersatz diskreter Logikbausteine discrets
Ersatzdämpfung
Ersatzfunktion
Ersatzgröße
Ersatzleitweg
Ersatzmarke
Ersatzmodell
Ersatzregelstrecken Ersatzregelstreckenkonstanten Ersatzregelung
Ersatzschaltung
Ersatzschaltung
Ersatzteil
Ersatztheorie
Ersatzzeitweg Wechselkontakt
Erscheinungsdarstellung
erste Annäherung
erste Generation erste Generation von Sichtsystemen
erste Harmonische
erste Harmonische
erste IR‐Generation
erste Manipulatorgeneration
erste Methode von Lyapunow
erste Robotergeneration
erste Sichtsystemgeneration
Ersteinsatz
erster Taktimpuls
erstes Entwicklungsprojekt (für Manipulatoren
erwärmungsbegrenztes Folgesystem
Erwärmungseffekt
Erwärmungsverlust
erwarteter Mittelwert
Erwartungswert
erweiterbar
erweiterbar
erweiterte Datenverwaltung
erweiterte Datenverwaltung erweiterter mnemonischer Kode
erweitertes Zeitteilungssystem Erweiterung
Erweiterung
Erweiterung feines Speicherbereichs
Erweiterungsbaustein
Erweiterungsfähigkeit
Erweiterungsfähigkeit
Erweiterungsfähigkeit
Erweiterungsfähigkeit
Erweiterungsmodul
Erweiterungsschaltkreis
erwünschtes System
Erzeugen eines Binärbildes
erzeugende Frequenz
erzeugende Funktion
erzeugende Gleichung
erzeugendes Programm
erzeugtes Assemblerprogramm
Erzeugung eines scharfen Wertes
Erzeugung feiner Greiferdrehung
Erzeugung geometrischer Strukturen
Erzeugungsfrequenz
Erzeugungsfunktion
erzwungene Linearisierung
erzwungene Reaktion forced state 280
erzwungene Roboterbewegung
erzwungene Schwingungen
erzwungener Anteil
erzwungener Zustand
erzwungener Zustand
ESAutomat
ESAutomat
ES‐Schweißautomat
ES‐Schweißautomat
achievable reliability
accessibility
availability
replacing discrete logic
equivalent damping
fallback
equivalent parameter
alternate route
alternate mark, AM
replacement model
supplementary controlled systems supplementary controlled system constans emergency control
equivalent network
equivalent circuit
maintenance part
replacement theory
alternate route, ARU alternating contact
event representation
first approximation
first visual system generation
first visual system generation
first harmonic
fundamental harmonic
first robot generation
first manipulator generation
first method of Lyapunov
first robot generation
first visual system generation
pilot run
first clock pulse
first development project (for manipulators, robots)
heat‐limited servomechanism
heating effect
Joulean effect
expected average value
anticipated value
expandable
extensible
advanced data management, ADAM
advanced data management extended mnemonic code
advanced time‐sharing system, ATS expansion
extension
store zone extension, memory zone extension, store area exten
expander
expandability
expansibility
extendibility
extensibility
expander
expander chip
wanted system
production of binary image
generating frequency
generating function
generating equation
generating routine
generated assembler program
defuzzification
generation of gripper rotation
generation of geometric structures
generating frequency
generating function
forced linearization
forced response
forced robot movement
forced oscillations
forced component
forced state
forced regime
automatic electroslag welder
automatic electroslag welding machine
automatic electroslag welder
automatic electroslag welding machine
stran 89 od 326
EN ‐DE: slovar avtomatizacije in robotike Eulersche Differentialgleichung
Euler‐Venn‐Diagramm
europäische Normen (Standards)
Europakarten (Leiterplattenformat)
Europakartensystem
Evans‐Methode
Evans‐Methode
exakte Kopie
exakter Regelalgorithmus
Exaktheit
Exaktheit
Exaktheit
Exaktheit
Exekutivprogramm
Exekutivsteuerung
exergetischer Elementwirkungsgrad
exergetischer Systemwirkungsgrad
Existenz‐ und Eindeutigkeitssatz von Cauchy‐Lipschitz
Existenzbedingungen
Existenzsatz
Exklusion
exklusive Steuerung
EXKLUSIV‐ODER‐Gatter
EXKLUSIV‐ODER‐Gatter
EXKLUSIV‐ODER‐Gatter
EXKLUSIV‐ODER‐Operation
EXKLUSIV‐ODER‐Operation
EXOR
EXOR
exothermer Prozess
Expansionsgrad
Experiment
Experimentalaufbau
Experimentalmodell
Experimentalmodell einer einfachen Fertigungsstraße
Experimentalroboter
Experimentalsysteme
experimentelle Arbeit
experimentelle Arbeit
experimentelle Bedingungen
experimentelle Daten pl
experimentelle Identifizierung von Regelstrecken
experimentelle Strömungsdynamik
experimenteller Montageroboter
experimenteller Wert
explizit
explizite Funktion
expliziter Sensorbefehl
Exponent
Exponent
Exponentialabklingen
Exponentialgleichung
Exponentialkurve
Exponentialverteilung
Exponentialverzerrung
Exponentialvorgang
exponentiell zunehmende Verstärkung
exponentielle Absorption
exponentielle Einheit
exponentielle Näherung
exponentielle Verzerrung
exponentielle Verzögerung
exponentieller Abfall
exponentieller Verstärker
externe Daten pl
externe Funktion
externe Geometriebeschreibung
externe Hilfslogikschaltung
externe Regelung
externe Robotereinrichtung
externe Roboterprüfeinrichtung
externe Taktfreigabe
externe Taktierung
externe Unterbrechung
externer Geber
externer Geber (Sensor)
Euler's differential equation
diagram of Euler and Venn
European standards
European cards
European card system
method of Evans
Evans method
exact copy
exact regulation algorithm
accuracy
exactness
exactitude
precision
executive program
executive control
exergetic element efficiency
exergetic system efficiency
Cauchy‐Lipschitz theorem
existence conditions
existence theorem
exclusion
exclusive control
EXCLUSIVE‐OR gate
non‐equivalence gate
modulo sum gate
EXCLUSIVE‐OR operation
XOR
EXCLUSIVE‐OR operation
XOR
exothermic process
coefficient of expansion
experiment
experimental assembly
experimental model
experimental model of simple production line
experimental robots
experimental systems
development work
experimental work
experimental conditions
experimental data
experimental identification of systems
experimental fluid dynamics
experimental assemblage robot
experimental value
explicit
explicit function
explicit sensor instruction
exponent
power exponent
exponential damping
exponential equation
exponential curve
exponential distribution
exponential distortion
exponential process
exponentially increasing amplification
exponential absorption
exponential unit
exponential approximation
exponential distortion
exponential lag
exponential decay
exponential amplifier
external data
external function
external geometry description
external support logic
external control
external robot device
external robot measuring device
external clock enable
external clocking
external interrupt
external sensor
external sensor
stran 90 od 326
EN ‐DE: slovar avtomatizacije in robotike externer IR‐Takt
externer Programmspeicher
externer Registersatz
externer Robotersensor
externer Robotertakt
externer Sensor
externes Ereignis
externes Programm
externes Roboterprogramm
Externgerät
Extraktionsapparat
Extraktionsprozess
Extraktionssystem
Extraktionsverfahren
Extrapolation
Extremalbedingungen
Extremalschrittschaltsystem
Extremalschrittsystem
Extremalsystem mit Extremwertspeicherung
Extremalwert
Extremalwertregler
Extremalwertregler
Extremalwertregler
Extremalwertregler
Extremwertregelung
Extremwertregelung
Extremwertregelung
Extremwertregelung
Extremwertregelung
Exzess‐Geräuschtechnik
f s. P 222
Fabrikationsdaten pl
Fachdialogsystem
Fachdialogsystem
Fachsoftware
Fachsprachensoftware
Fachwählertastatur
Fachwählertastenfeld
Fähigkeit Hur Robotermontage
Faktor Q
Faktor Q
Faktor Q
Faktoranalysensystem
Faktorenwert
Fallbügelregistrierung
Fallbügelregler
fallende Kennlinie
Fallklappenrelais
Fallstudie
Falschauslösung
Falschbetätigung
falsche Verteilung
Falscheinstellung
falscher Informationseingang
falsches Ausgangssignal
Falschschaltung
Falsch‐Steuereingangssignal
Faltarm
Faltung der Wahrscheinlichkeitsverteilung
Faltungssatz
Faltungssatz
Familie fvon System Programmiersprachen
FAMS
Fangbetrieb
Farbdosimetrie
Farbe des Roboters
farbenkodierte Verbindung
Farberkennung
Farberkennung eines Roboters
Farbgebung mittels Roboters
farbige Abbildung mittels Laser
Farbmesser
Farbpyrometer
Farbregelung
Farbsensor
Farbsensorm
external robot cycle, external IR cycle
external program memory
external register record
external robot sensor
external robot cycle, external IR cycle
external sensor
external event
external program
external robot program
external device
extraction apparatus
extraction process
extraction system
extraction process
extrapolation
extremum conditions
stepping extremal system
stepping extremal system
extremal system with storage of the extremum
optimum
extremal controller
extremum controller
optimizing controller
peakholding
peak‐holding optimizing control
extremum control
optimal control
peakholding control
optimum control;
excess noise technique
position perception
manufacturing data
technical dialogue system
special dialogue system;
software in a special field
nomenclature language software
classification keyboard
classification keyboard
capacity of robot assembly
Q‐factor
quality factor
figure of merit
factor analysis system
factor value
chopper‐bar recording
controller with locking device
falling characteristic
drop indicator relay
case study
false trip
false trip
maldistribution
maladjustment
false information input
false output signal
false trip
false control input signal
folding arm
convolution of probability distribution
convolution integral
convolution theorem
family of system programming languages
flexible automatic assembly (mounting) system, FAMS
hunt mode
colorimetric dosimetry
colour of robot
colour‐coded communication
colour identification
robot colour identification
colouring by robot
colour laser display
colorimeter
colour pyrometer
colour control
colour sensor
colour sensor
stran 91 od 326
EN ‐DE: slovar avtomatizacije in robotike Farbspritzen
Farbspritzmanipulator
Farbspritzroboter
Farbspritzroboterzyklus
Farbstabilität
Farbzeilenkamera
Faser eines Sensors
Faserbündel
Faseroptik
faseroptische Sensordaten pl
faseroptischer Analysator
faseroptischer Analysator
faseroptischer Drucksensor
faseroptischer Entfernungssensor
faseroptischer Magnetfeldsensor
faseroptischer Magnetfeldsensor
faseroptischer Rotationssensor
faseroptischer Sensor
faseroptischer Temperatursensor
faseroptisches Sensorsignal
Fasersensor
Fasersensortyp
Fasertechnik
Fassungsvermögen n
fastlineares System
fastperiodische Lösung
Feder‐Masse‐Dämpfer‐System
Fehlanpassung
Fehlanpassungsverlust
Fehlanzeige
Fehlbedienung
Fehlbedienung
Fehlbehandlung
Fehlbehandlung
Fehlbetätigung
Fehlbetätigung
Fehleinstellung
Fehler beim Annehmer
Fehler der Geräte
Fehler der Simulation
Fehler‐ und Symmetriedämpfung
Fehlerabschätzung
Fehlerabstand
Fehleranfälligkeit
Fehleranzeiger
Fehleraufspürgerät
Fehlerausgleich
Fehlerbedingung
Fehlerbehandlungsroutine
Fehlerbestimmung
Fehlerbestimmung
fehlerbetätigtes System
Fehlerdämpfung
Fehlerdetektor
Fehlerdiagnose
Fehlerdiagnose (von Robotern)
fehlererkennender Kode
fehlererkennender Kode
Fehlererkennung am Roboter
Fehlererkennungsschaltung
Fehlererkennungsschaltung
Fehlererkennungssignal
fehlerfrei machen
fehlerfreie Hardware
fehlerfreie Technik
fehlerfreie Übertragung
fehlerfreier Betrieb
fehlerfreier Fall
Fehlerfreiheit
Fehlerfreiheit
Fehlerfunktion
fehlergesteuerte Anlage
Fehlergrenze
Fehlergrenze
Fehlergrenze
Fehlergrenze (bei Objekterfassung)
paint spraying
paint spray manipulator, paint spray handler
paint spray robot
paint spray robot cycle
colour stability
colour line camera
sensor fibre
fibre bundle, fiber bundle (US)
fibre optics, fiber optics (US)
fibre‐optical sensor data, , fiber‐optical sensor data (US)
fibre‐optical analyzer
fiber‐optical analyzer (US)
fibre‐optical pressure sensor, fiber‐optical pressure sensor (U
fibre‐optical distance sensor, fiber‐optical distance sensor
fibre‐optical magnetic field sensor
fiber‐optical magnetic field sensor (US)
fibre‐optical rotation sensor, fiber‐optical rotation sensor (US)
sensor with optical fibre
fibre‐optical temperature sensor, fiber‐optical temperature se
fibre‐optical sensor signal, fiber‐optical sensor signal (US)
fibre sensor, fiber sensor (US)
type of fiber sensor
fibre technique, fiber technique (US)
capacity
almost linear system
almost periodic solution
spring‐mass‐dashpot system
mismatch
mismatch loss
nil report
operating error
faulty operator intervention
abuse
operation error
operating error
faulty operator intervention
misadjustment
acceptor error, AE
equipment failure
error in the simulation
error and balance attenuation
error estimation
error distance
susceptibility to defects
error indicator
error‐sensing device
compensation of errors
error condition
error handling routine
determination of errors
error diagnostic
error‐actuated system
balance attenuation
error detector
error diagnostic
error detection, fault diagnosis (of robots)
error‐detecting code
check code
robot error detection, fault detection of robot
error‐detection circuitry
fault‐detection circuitry
error diagnostic signal
debug v
fault‐free hardware
fault‐free hardware
error‐free transmission
error‐free operation
error‐free fall
freedom of defects
absence of failures
error function
error‐actuated system
error limit
tolerance
limit of error (by object registration)
limit of error (by object registration)
stran 92 od 326
EN ‐DE: slovar avtomatizacije in robotike fehlerhafte Handhabung
fehlerhafter Modul
fehlerhaftes Element
fehlerhaftes Signal
Fehlerhäufigkeit
Fehlerhäufung
Fehlerimpuls
Fehlerkompensation des Resolvers
Fehlerkompensation des Tachogenerators
Fehlerkontrolle
fehlerkontrollierender Kode
Fehlerkorrektur
Fehlerkorrektur
Fehlerkorrektureinrichtung
Fehlerkorrekturmittel
Fehlerkorrekturprogramm
Fehlerkriterium
Fehlerlokalisationsprogramm
Fehlerlokalisierung
Fehlerlokalisierung
Fehlerlokalisierung
Fehlerlokalisierung einer Testroutine
Fehlerlokalisierung einer Testroutine
Fehlermaßnahmeprogramm
Fehlermeldung
Fehlermeldung durch Robotersteuerung
Fehlermeldung eines IR‐Programms
Fehlermeldung eines Roboters
Fehlermessung
Fehlerortungsgerät
Fehlerprüffähigkeit
Fehlerprüfungstauglichkeit
Fehlerquelle
Fehlerquelle
Fehlerquelle
Fehlerrate
Fehlerrechnung
Fehlerschutz eines Roboters
Fehlerschutzverfahren
Fehlerstromschutzschaltung
Fehlersuche
Fehlersuche
Fehlersucher
Fehlersuchhilfen
Fehlersuchpaket
Fehlersuchprogramm
Fehlertheorie
Fehlertheorie
fehlertolerantes Rechnersystem
fehlertolerantes Rechnersystem
fehlertolerantes System
Fehlertoleranz
Fehlerübermittlung
Fehlerübertragungsfunktion
Fehlerüberwachung
Fehlerursache
Fehlerursachenlokalisierung
Fehlerzulässigkeit
Fehlfunktion
Fehlfunktion
Fehlfunktion
Fehlgreifanzeige
Fehlgreifkontrolle
Fehlimpuls
Fehlverteilung
Feinabtastung
Feinbewegung
Feineinstellung
Feineinstellung des Manipulatorsystems
Feineinstellung von Roboterelementen
feiner Sensorraster
Feinjustierung
Feinmontage
Feinmontageaufgaben fpi
Feinortung
Feinpositionierung
faulty manipulation
faulty module
faulty element
faulty signal
error rate
clustered errors
error pulse
error compensation of the resolver
error compensation of the tachogenerator
error control
error‐controlled code
error control
error correction
error‐correcting device
debug[ging] aids
error‐correcting program
error criterion
error localization program
error localization
defect localization
fault localization
error localization of test routine
error localization of test routine
error routine
alarm message
error message by robot control
error message of IR program
robot error message
error measurement
fault‐location instrument
error‐checking capability
error‐checking capability
source of defects
source of error
error source
error rate
computation of error
robot error protection
error protection procedure
fault‐current relay protection
failure detection
trouble shooting
fault finder
debug[ging] aids
debugging packet
error localization program
error theory
theory of error
error‐tolerant computer system
fault tolerant computer system
fail‐soft system
fault tolerance
fault communication
error transfer function
error control
cause of defects
localization of defect causes
fault tolerance
failure
breakdown
malfunction
nil grip report
faulty grip checking
spurious pulse
maldistribution
accurate scanning
fine motion (movement)
fine adjustment
fine adjustment of manipulator system
fine adjustment of robot elements
fine sensor raster
critical alignment
fine assembly
fine assembly tasks
accurate scanning
accurate positioning
stran 93 od 326
EN ‐DE: slovar avtomatizacije in robotike Feinpositionierung
Feinpositionierung eines Effektors
Feinpositionierung eines Manipulators
Feinpositionierung feines Industrieroboters
Feinregelung
Feinstellvorrichtung f
Feinwegvorgabe
Feldbegrenzung
Feldbestimmung
Feldmodellierung
Feldpol
Feldunterbrechungsschalter
Fermessverfahren mit geschlossenem Messkreis
Fernabfrage
Fernablesung
Fernablesung von Messinstrumenten
Fernanzeige
Fernanzeige
Fernanzeiger
Fernbedienung
Fernbedienung
Fernbedienung
Fernbefehl
Ferndiagnose
Ferndrucker
Ferndrucker
Ferndrucker
Ferndruckregler
Ferneingabe
Ferneingriff
Fernfehlersuche
Fernfeldanalysator
Ferngeber
ferngesteuert
ferngesteuerte Robotermontagestation
ferngesteuerter Unterwasserroboter
Fernkommunikation
Fernkontrolle fernladen
Fernlenkung f
Fernlenkung f
Fernlenkung f
Fernmeldeleitungsanschluss
Fernmeldung
Fernmessanzeigensummierung
Fernmesseinrichtung
Fernmessen
Fernmessen
Fernmessgeber Fernmessmethode Fernmessmethode Fernmessstromkreis Fernmesssystem Fernmesssystem mit Ausgleichsstrom
Fernmessumsetzer
Fernmessung
Fernmessung
Fernmessung
Fernmessung
Fernmesswandler
Fernregler
Fernschaltung
Fernschaltung
Fernschaltung
Fernschaltung Fernschreiber
Fernschreiber
Fernschreiber
Fernschreibgerät
Fernschreibgerät
Fernschreibgerät
Fernsehkamera für Fehlerdiagnose
Fernsehsensor
Fernsteuereinrichtung
Fernsteuersystem
Fernsteuerung
fine positioning
fine positioning of effector
manipulator fine position
fine positioning of robot, fine positioning of industrial robot
fine adjustment
microadjuster
fine presetting of displacements
field boundary
field definition
field simulation
field pole
field break switch
closed‐loop telemetry
remote inquiry
distant reading
measuring instruments remote reading
remote display
remote indication
remote indicator
distance control
distant control
remote control
instruction by remote control
remote diagnostic
teleprinter
teletype [writer]
teletype printer
remote pressure controller
remote input
distance intervention
remote diagnostic
far‐field analyzer
teletransmitter
remotely controlled
remotely robot assembly station
remotely controlled underwater robot
remote communications
supervisory control telecharge v
distance control
distant control
remote control
communication line adapter
remote signalling
indication summation in telemetering
telemetering device
telemetering
telemetry
telemetering transducer telemetering method
method of telemetering
telemetric circuit telemetering system balanced‐current telemetry system
remote measurement feedback converter
remote measurement
telemetering
distance measurement
telemetry
remote measurement feedback converter
remote controller
distance control
distant control
remote control
teleswitching teleprinter
teletype [writer]
teletype printer
teleprinter
teletype [writer]
teletype printer
Tele‐camera for error diagnostic
television sensor
remote control equipment
telecontrol system
distance control
stran 94 od 326
EN ‐DE: slovar avtomatizacije in robotike Fernsteuerung
Fernsteuerung
Fernsteuerungsanlage
Fernsteuerungskanal
Fernsteuerungsschutz
Ferntemperaturregelung
Fernterminal
Fernterminal
Fernübertragung
Fernübertragung
Fernübertragung
Fernübertragung mit Amplitudenmodulation
Fernübertragung mit quantisiertem Signal
Fernübertragungs‐Zugriffsmethode
Fernüberwachung
Fernüberwachung
Fernverarbeitungssystem
Fernverarbeitungssystem Fernvorschubsteuerung
Fernwartung
Fernwirksystem
Fernwirktechnik
Fernwirktechnik
Fernwirktechnikmodulation
Fernzugriff
Ferrit‐Hallgenerator
Ferrittransfluxor
ferrodynamisches Relais
Ferroresonanzbetrieb
Ferroresonanzrechenschaltung
Ferroresonanzwirkung
Fertigeinstellung
Fertigmeldeleitung
Fertigungsablauf mittels Industrieroboters
Fertigungsanlage
Fertigungsaufgabe
Fertigungsausrüstung
fertigungsgerechte Roboterkonstruktion
Fertigungskarte
Fertigungskette
Fertigungskette
Fertigungskette (Reihenschaltung von Maschinen)
Fertigungslinie
Fertigungslinienroboter
Fertigungsmassenspeicher
Fertigungsmöglichkeit
Fertigungsprogrammspeicher
Fertigungsprozess
Fertigungsprozessanalyse
Fertigungsprüfung
Fertigungsprüfung
Fertigungsquote
Fertigungssteuersystem
Fertigungssteuersystem
Fertigungssteuerung
Fertigungsstraße
Fertigungsstraße
Fertigungsstückzahl (eines Roboters)
Fertigungssystem
Fertigungsüberwachung
Fertigungszeitdaten pl
Fertigungszelle
Fest[wert]speicher
Fest[wert]speicher
Festanschlag
feste IR‐Kopplung
feste Roboterkopplung
feste Struktur
feste Verdrahtung
fester Armbewegungsablauf
fester Befehlssatz
fester Bereich
fester Endzustand
fester Knoten
fester Wert
festes Hindernis im Roboterarbeitsraum
distant control
remote control
remote control installation
remote control channel
protection in remote control system
remote temperature control
remote terminal
remote station
teletransmission
remote transfer
remote transmission
amplitude‐modulated remote transmission
discrete‐signal distance transmission
telecommunication access method
remote monitoring
remote supervision
teleprocessing system, TPS
teleprocessing system remote feed control
remote maintenance
remote action system
teleautomation
telecontrol engineering
remote control modulation
remote access
ferrite‐Hall‐generator
ferrite transfluxor
ferrodynamic relay
ferroresonant operation
ferroresonant computing circuit
ferroresonant operation
final adjustment
ready line
robot manufacturing sequence, manufacturing sequence by m
production equipment
manufacturing task
processing equipment
robot construction suitable to production
process card
production line
production chain
production chain
flow process
flow process robot
manufacturing mass memory
manufacturability
manufacturing program memory
manufacturing process
analysis of the manufacturing process
production test[ing]
production testing]
production rate
assembly control systems
assembly control systems, ACS
manufacturing control
production line
production chain
production rate (of robot)
manufacturing system
monitoring of manufacturing
manufacturing time data
manufacturing cell, production cell
fixed memory
permanent memory
fixed stop
fixed robot coupling
fixed robot coupling
fixed structure
fixed wiring
fixed arm movement running
fixed command set
fixed range
fixed terminal state
fixed vertex
fixed value
fixed obstacle in operating space of robot
stran 95 od 326
EN ‐DE: slovar avtomatizacije in robotike festes Manipulatorgestell
festes Objekt
festes Roboterablaufprogramm
festes Robotermagazin
festgesetzter Bereich
Festigkeitsziffer
Festkörperglied
Festkörperschaltkreise Festlegen von Anfangsbedingungen
Festlegung der Zugehörigkeitsfunktionen für die Fuzzifizierung
Festprogramm
Festprogramm Steuerung
festprogrammierbarer Industrieroboter
festprogrammierbarer Rechner
Festprogrammsteuerung
Festspannvorrichtung
feststehender Portalmanipulator
Festwertregelung
Festwertregelung
Festwertregelung
Festwertregelung maintien
Festwertspeichersteuerung
Festzeitverzögerung
Festzeitverzögerung
Festzeitverzögerung
Feuchtigkeitsabnehmer
Feuchtigkeitsanzeiger
Feuchtigkeitsbereich
Feuchtigkeitsgeber
Feuchtigkeitsmessgerät
Feuchtigkeitsmessung mit der Infrarotmethode
Feuchtigkeitsregelung
Feuchtigkeitsregler
Feuchtigkeitsregler
Feuchtigkeitswert
Ficksches Diffusionsgesetz
Ficksches Diffusionsgesetz
Ficksches Gesetz
Ficksches Gesetz
figurative Konstante
fiktive Belastung
fiktive Belastung
File
Filmdosimetrie
Filter mit Abtastung
Filter mit begrenztem Gedächtnis
Filter mit begrenztem Gedächtnis
Filter mit digitalen Elementen
Filter mit kammförmigem Frequenzspektrum
Filter mit unbegrenztem Gedächtnis
Filter mit unbegrenztem Gedächtnis
Filteranlage
Filterbereich
Filtercharakteristik
Filterdämpfung
Filterfotometer
Filterkreis
Filtersynthese
Filtersyntheseprogramm
Filterung durch Zusatzfilter
Finger einer Roboterhand
Finger eines Industrieroboters
Fingeraktion
Fingeranzahl (eines Greifsystems)
Fingergelenk
Fingergelenkanzahl
Fingergelenkigkeit
Fingergreifeinheit
Fingergreifer
Fingersensor
Fingersystem
Firmware
fixiertes Bauteil
Fixierung (durch Roboter)
Flächenabtastung
fixed manipulator frame
solid object
fixed development program of robot
fixed magazine of robot
fixed range
modulus of resistance
solid‐state element, solid element
solid‐state circuits presetting
partitioning
fixed program
fixed‐program control
fixed‐programmable industrial robot
fixed‐programmable computer
fixed program control
clamping device
fixed portal manipulator
constant value control
regulator system
control with fixed set point
fixed command control
fixed memory control
definite time lag
fixed time lag
permanent delay
humidity‐sensitive element
hygroscope
humidity range
humidity‐sensitive element
humidity measuring instrument
moisture measurement by infrared method
humidity control
humidity controller
moisture content controller
moisture value
Fick's diffusion law
Fick's law of diffusion
Fick's diffusion law
Fick's law of diffusion
figurative constant
fictitious load
phantom load
file
film dosimetry
sampled‐data filter
filter of finite memory
finite‐memory filter
digital filter
comb filter
filter of infinite memory
infinite‐memory filter
filtration plant
filter range
filter characteristic
filter attenuation
filter photometer
filter circuit
filter synthesis
filter synthesis program
additional filtration
finger of robot hand
robot finger
finger action
finger number (of grip system)
finger joint
finger joint number
articulation of finger
finger grip unit
finger gripper
finger sensor
finger system
firmware
fixed component
fixing (by robot)
surface scanning
stran 96 od 326
EN ‐DE: slovar avtomatizacije in robotike flächenbeschreibendes Element
area‐descriptive element
flächenbeweglicher Roboter
robocarrier, surface‐mobile robot
Flächengestaltung
surface modeling
Flächengleichrichter
junction rectifier
surface scanning
flächenhafte Abtastung
Flächenprogramm (Programm zur Greifersteuerung)
surface program
Flächenstapelprogramm
surface batch program
flacher Impuls
flat pulse
flacher Impuls
flat‐topped pulse
Flachgehäuse 1
flat pack
Flachkabel t
flat cable
Flachstruktur des Schaltstromkreises
flat switching circuit structure
Flachteil j
flat part
Flackereffekt
flicker effect
Flackerzeichen
flashing signal
Flammenfotometer
flame photometer
Flammenlichtstärkemesser
flame photometer
Flammenregelung
flamestat control
flutter effect
Flattereffekt
flexibel einsetzbarer freiprogrammierbarer Industrieroboter flexible to use free‐programmable industrial robot
Flexibilität eines Gesamtsystems
total system flexibility
flexible automatische Montagezelle
flexible automatic assembly cell
flexible Automatisierung
flexible automation
flexible autonome Montagezelle
flexible autonomous assembly cell
flexible Fertigungslinie
flexible flow process
flexible Fertigungslinie flexible free‐programmable handling dflexible flow process
flexible Fertigungszeile
flexible production cell. flexible manufacturing cell, flexible pr
flexible grip unit
flexible Greifeinheit
flexible Greifeinrichtung
flexible gripping equipment
flexible handling device
flexible Handhabeeinrichtung
flexible handling technique
flexible Handhabetechnik
flexible multilogic
flexible Multilogik
flexible order device
flexible Ordnungseinrichtung
flexible Produktionsstätte
flexible production place
flexible Rechnerstruktur
flexible computer structure
flexible Roboterprogrammierung
flexible robot programming
flexible Roboterstruktur
flexible robot structure
flexible Robotertechnik
flexible robotics, flexible industrial robot[s] technique
flexible Roboterzelle
flexible robot cell
flexible Robotik (Industrierobotertechnik)
flexible robotics, flexible industrial robot[s] technique
flexible Verkettung
flexible linkage
flexible feed technique
flexible Zuführungstechnik
flexibler Greifer
flexible gripper
flexibler Industrieroboter (Roboter)
flexible industrial robot
flexibler Informationsspeicher
flexible information memory (store)
flexibler Montageprozess
flexible assembly process
flexibler Produktionskomplex
flexible production complex
flexibler Produktionsmodul
flexible production module
flexibler Produktionsroboter
flexible production robot
flexibler Robotergreifer
flexible robot gripper
flexibles automatisches Montagesystem
flexible automatic assembly (mounting) system, FAMS
flexibles automatisches Montagesystem flexible
flexible automatic assembly system
flexibles Automatisierungsmittel
flexible automation medium
flexibles Backenprofil
flexible jaw profile
flexibles Befehlssystem
flexible instruction system
flexibles Fertigungssystem
flexible fabrication system
flexibles Fingersystem
flexible finger system
flexibles freiprogrammierbares Handhabungsgerät
flexible free‐programmable handling device
flexibles Greiferglied
flexible gripper element
flexibles Greifersystem
flexible gripper system
flexibles Handhabungssystem
flexible handling system
flexibles Montagesystem
flexible assembly system
flexibles Produktionselement
flexible production cell. flexible manufacturing cell, flexible pr
flexibles Programmieren
flexible programming
flexibles Speichersystem
flexible storage system
Fliehkraftregler
centrifugal governor
Fliehkraftregler
gravity regulator
Fliehkraftrelais
centrifugal relay
Fließband
flow line
Fließbandroboter
flow‐line robot
Fließbetrieb
continuous action
Fließbetrieb
continuous operation
Fließmontage
line assembly work
Fließschema
process diagram
Fließschema
flow sheet
Fließwiderstand
forward resistance
stran 97 od 326
EN ‐DE: slovar avtomatizacije in robotike Flimmereffekt
Flimmerfrequenz
Flimmerfrequenz
Floating‐Zustand
Floating‐Zustand
Floppy‐Datei
Floppy‐Dateispeicherung
Floppy‐Dateiverzeichnis
Floppy‐Disk
Floppy‐Disk‐Laufwerk
Floppy‐Disk‐Steuerung
Floppy‐Disk‐Unterstützung
Floppy‐Zuweisung
flüchtige Speicherung
Flugbahnbestimmung durch Laser
fluidischer Abstandssensor
fluidisches Verknüpfungssystem
Fluoreszenzmesser
Fluorometer
Flussdiagramm
Flüssig[keits]abschaltsystem
flüssige Dämpfung
flüssig‐homogener Reaktor
Flüssigkeitschromatografie
Flüssigkeitsdruckgeber
flüssigkeitsgekühlter Reaktor
Flüssigkeitsnetzwerkanalysator
Flüssigkeitsniveauanzeiger
Flüssigkeitsniveaumesswandler
Flüssigkeitsreibung
Flüssigkeitsstandanzeiger
Flüssigkeitsstandsregelung
Flüssigkeitsstromsteuerung
Flüssigkeitsströmung
Flüssigkeitsumlaufsystem
Flüssigmetallkühlkreis
Flüssigmetall‐Kühlkreislauf
Flussprozess
Flußzeit
FM‐Modulation
Fokussierungsschallsystem
Folge
Folge von Greiferraumpunkten
Folge[r]stufe
Folgeadresssteuerung
Folgealternator
Folgeautomatik
Folgeautomatik
Folgeautomatik
Folgebewegung
Folgefrequenz récurrence
Folgenbegrenzung
Folgeprogrammierung
Folgeregelung
Folgeregelung
Folgeregelung
Folgeregelung
Folgeregelung
Folgeregelungssystem
Folgeregelungssystem
Folgeregler
Folgeregler
Folgeregler
Folgeregler
Folgerung
Folgeschalter
Folgeschaltkreis
Folgeschaltung mit Speicherkreisen
Folgesteuerung
Folgesteuerung
Folgesteuerung
Folgesystem mit Erwärmungsbegrenzung
Folgewahlschalter
Folgezustand eines Industrieroboters
Folienspeicher einer IR‐Steuerung
Folienspeichersteuerung
flicker effect
flicker frequency
fusion frequency
floating state
high‐impedance state
floppy file
storage of floppy file
floppy file list
floppy disk
floppy‐disk drive
floppy‐disk control
floppy‐disk support
floppy assignment
volatile storage
laser determination of the trajectory
fluid distance sensor
fluid‐logic system
fluorometer
fluorometer
flow diagram
liquid shutdown system
viscous damping
liquid fuel homogeneous reactor
liquid chromatography
fluid pressure transducer
liquid cooled reactor
fluid network analyzer
fluid level indicator
float level gauge
fluid friction
fluid level indicator
liquid level control
fluid‐flow control
liquid flow
liquid recirculating system
liquid metal coolant circuit
liquid metal coolant circuit
flow process
on period
frequency modulation
focusing acoustic system
sequence
sequence of space points
follower
sequence address control, sequential address control
sequence alternator
follow‐on automatic mechanism
sequence automatics
sequential automation
sequence movement
repetition rate
limitation of the consequences
sequence programming
cascade action control
dependent control
follow‐up control
tracking control system
tracking system
follow‐up system
servosystem
follower controller
follow‐up controller
servofollower
servoregulator
conclusion
sequence controller
sequential switching circuit
sequential circuit with memories
run‐off control
series control
sequential control
heat‐limited servomechanism
sequence selector switch
robot sequence state
robot diskette
floppy‐disk control
stran 98 od 326
EN ‐DE: slovar avtomatizacije in robotike Förderbandzuführung
Fördereinrichtung
Förderkette
Formadaption
formale Logik
formales Roboterprogramm
formales System
Formalparameter
Formbacke
Formelübersetzer
Formerkennung
Formerkennung
Formerkennung formgebendes Filter
Formgebung feines Greiforgans
Formierkreis
Formierkreis
Formierungseinrichtung
Formierungsglied
Formierungsglied
Formkode
formschlüssige Robotersicherung
formschlüssiger Greifer
formschlüssiges Greifen
Formsteuerung
Formungselement
Forschung
Forschung für Industrieroboter
Forschungsarbeit
Forschungsergebnis
Forschungsmethode
forschungsorientierte Verarbeitung
Forschungszentrum
fortgeschrittene Robotertechnik (Robotik)
fortgeschrittener Roboter
fortlaufende Kontrolle
fortlaufende Kontrolle
fortlaufende Überwachung
fortlaufende Überwachung
Fortpflanzung
Fortpflanzungsgeschwindigkeit
Fortpflanzungsverhältnis
Fortschaltmotor
Fortschaltmotor
Fortschaltmotor
fortschrittliche (progressive) Robotersteuerung
fortschrittliche Konzeption
fortschrittliche Prüftechnik
fortschrittliche Schaltkreistechnik
fortschrittliche Testungstechnik
Fotodiodenmatrix
fotoelektrische Abtastung
fotoelektrische Konstante
fotoelektrische Messung mittels Nullmethode
fotoelektrische Qualitätskontrolle
fotoelektrische Steuerung
fotoelektrische Wechselwirkung
fotoelektrischer
fotoelektrischer
fotoelektrischer Analogteiler
fotoelektrischer Empfänger
fotoelektrischer Farbmesser
fotoelektrischer Funktionsgenerator
fotoelektrischer Komparator
fotoelektrischer Leser
fotoelektrischer Leser
fotoelektrischer Schwärzungsmesser
fotoelektrischer Stellungsregler
fotoelektrischer Stromkreis
fotoelektrischer Verschiebungsgeber
fotoelektrisches Bauelement
fotoelektrisches Spektralfotometer
fotoelektrisches Verfahren
Fotoelement
Fotoelement
Fotoelement
belt feed
conveyor device
conveyor chain
Form adaptation
formal logic
formal robot program
formal system
formal parameter
lot in formula translator
object identification
pattern recognition
object identification, pattern recognition
shaping filter
forming of gripper
shaping circuit
shaping network
shape‐forming device
shaping circuit
shaping network
graphic code
positive robot protection
positive gripper, solid gripper
positive grip, solid grip
shape control
forming unit
research
robot research, industrial robot research
research work
result of research
research method
research‐oriented processing
research centre
advanced robotics
advanced robot
continuous monitoring
continuous supervision
continuous monitoring
continuous supervision
propagation
velocity of propagation
propagation ratio
pecking motor
stepping motor
repeat motor
progressive robot control
advanced concept
advanced testing technique advanced circuit technique
advanced testing technique matrix of photodiode
photoelectric scanning
photoelectric constant
photoelectric measurement by null method
photoelectric inspection of quality
photoelectric control
photoelectric interaction
photocell pick‐up
photoelectric sensor
photoelectric analog divider
photoelectric receiver
photoelectric colorimeter
photoelectric function generator
photoelectric comparator
photoelectric reader
optical scanner
photoelectric densitometer
photoelectric position controller
photoelectric circuit
photoelectric displacement transmitter
photoelectric building block element
photoelectric spectrophotometer
photoelectric method
photoelectric cell
photocell
photoelement
stran 99 od 326
EN ‐DE: slovar avtomatizacije in robotike Fotoemission
photoelectric emission
Fotoemission
photoemission
Fotoemissionsdetektor
photoemissive detector
Fotoemissionswandler
photoemission pick‐off
fotogrammetrische Messmethode
photogrammetric measuring method
fotogrammetrische Technik
photogrammetric technology
fotoinduziert
photoinduced
Fotoleitfähigkeit
photoconductivity
Fotolekteur
electronic reader
Fotolekteur
electronic reading device
Fotolumineszenz
photoluminescence
fotomagnetischer Effekt
photomagnetic effect
Fotometer
photometer
Fotometerrechner
photometric computer
Fototransistorschaltung
phototransistor circuit
Fotowiderstand
photoconductive cell
Fotowiderstand
photoresistance
Fotowiderstandszelle
photoconductive cell
Fotowiderstandszelle
photoresistance
Fotozelle
photoelectric cell
Fotozelle
photocell
Fotozelle
photoelement
Fotozelle mit äußerem lichtelektrischem Effekt
vacuum photocell Fotozellenfühler
photocell pick‐up
Fotozellenfühler
photoelectric sensor
Fotozellenkreis
phototube circuit
Fotozellentonabnehmer
photocell pick‐up
Fotozellentonabnehmer
photoelectric sensor
Fotozellenverstärker
photocell amplifier
Fourier‐Rücktransformation
inverse Fourier transform
Fouriersche Reihenentwicklung
Fourier expansion
Fouriersche Transformation
Fourier transformation
random logic
frei gestaltete Logik
freie Bewegung (des Manipulatorarms)
free movement, independent movement (of manipulator arm)
freie Komponente
free component
freie Programmierung
free programming
freie Roboterprogrammierung
free robot programming
freie Schwingung
autooscillation
freie Schwingung
self‐oscillation
freie Schwingung
selfvibration
freie Schwingung
free oscillation
freie Schwingung
natural oscillation
freier Automat
free automaton
freier Parameter
arbitrary parameter
freier Schwingungszustand
free‐oscillation regime
Freigabesignal
enable signal
freigeben
unlock v
freigeben
unblock v
freigeben
deblock v Freiheitsgrad
degree of freedom
Freiheitsgrad eines Greifergelenks
gripper joint degree of freedom
Freiheitsgrad eines Industrieroboters
freedom degree of robot, freedom degree of industrial robot
Freiheitsgrad eines Manipulators
degree of freedom of manipulator
Freiheitsgradachse eines Roboters
axis of freedom of robot
Freiheitsgradezahl
number of freedom degree
freiprogrammierbare automatische Montage
free‐programmable automatic assemblage
freiprogrammierbare automatische Montage librement
free‐programmable automatic assemblage
freiprogrammierbare Mikroprozessorsteuerung für Industrierfree‐programmable microprocessor control for industrial robo
freiprogrammierbare Robotersteuerung (Industrieroboterste free‐programmable robot control, free‐programmable industr
freiprogrammierbare Steuerung eines Industrieroboters
free‐programmable robot control, free‐programmable industr
freiprogrammierbarer Bewegungsablauf
free‐programmable movement sequence
freiprogrammierbarer Kleinmanipulator
free‐programmable miniature manipulator
freiprogrammierbarer Kleinmanipulator librement
free‐programmable miniature manipulator
freiprogrammierbarer Punktschweißroboter
free‐programmable spot welding robot
freiprogrammierbarer Roboter (Industrieroboter)
free‐programmable robot, free programmable industrial robot
Freiraumdämpfung
free‐space attenuation
freischwingende Schaltung
free‐running circuit
freischwingende Schaltung
free‐swinging circuit
Freisetzung von Arbeitskräften (durch Robotereinsatz)
release of manpower (by application of robots)
freiwählbare Gelenkachse
free‐selectable joint axis
Fremderregung
external excitation
frequency
Frequenz
Frequenz der Ansprechschwelle
threshold frequency
Frequenz des angeregten Überganges
stimulated transition frequency
Frequenzabweichung
frequency deviation
frequenzanaloger Umsetzer
analogue‐to‐frequency converter, AFC
stran 100 od 326
EN ‐DE: slovar avtomatizacije in robotike Frequenzanalyse
Frequenzausgangsgeber
Frequenzausgleich
Frequenzband frequency bandwidth 282
Frequenzbandbreite
Frequenzbereich
Frequenzbereich
Frequenzbereich eines Übertragungssystems
Frequenzdetektor
Frequenzdiskriminator
Frequenzeinstellung
Frequenzfehlergrenzen
Frequenzfernmessgerät n
Frequenzfernmesssystem
Frequenzgang
Frequenzgang des geschlossenen Regelkreises
Frequenzgang des offenen Kreises
Frequenzgang des offenen Regelkreises
Frequenzganganalysator
Frequenzkode
frequenzkonstant
Frequenzkontrolleinrichtung
Frequenzkriterium der Stabilität
Frequenzkriterium von Nyquist
Frequenzmesser
Frequenzmesser
Frequenzmethode
Frequenzmitzieheffekt
Frequenzmodulation
Frequenzmodulator
frequenzmodulierter Generator des Fernwirksystems
frequenzmodulierter Kode
Frequenzmultiplex
Frequenznormal
Frequenz‐Phasen‐Kennlinie
Frequenzregler
Frequenzregler
Frequenzrelais
Frequenzschutz
Frequenzschwankungsrelais
frequenzselektives Element
Frequenzsieb
Frequenzspektrum
frequenzstabilisiert
Frequenzsteuerung von Motoren
Frequenzteilung von Kanälen
Frequenztelemeter
Frequenztoleranz
Frequenzumtastung
Frequenzverdoppler
Frequenzvervielfacher
Frequenzverzerrungen
Frequenzwandler
Friktionsregler
Frischdampfmaximaldruckregler
Frischdampfminimaldruckbegrenzer
Front des logischen Impulses
Frontbedienfeld
Frontplatte
Frühanzeigegerät
Frühausfall
Füge Vorgang eines Industrieroboters
Fügeabmessung
Fügebewegung
Fügeeinheit
Fügeflächengestaltung
Fügeflächengestaltung
Fügeflächenmatrix
Fügefunktion feiner IR‐Montage
Fügegeschwindigkeit
Fügehilfe
Fügehilfe
Fügekraft
Fügekraftbegrenzung
Fügeloch
Fügelochanfahren
frequency analysis
frequency output transducer
frequency compensation
frequency band
frequency bandwidth
frequency domain
frequency range
frequency range of a transmission system
frequency detector
frequency discriminator
frequency adjustment
frequency error limits
frequency telemeter
frequency‐telemetering system
frequency response
closed‐loop frequency response
open‐loop transfer function
open‐loop frequency response
frequency response analyzer
frequency code
frequency‐stabilized
frequency monitor
frequency stability criterion
Nyquist criterion
frequency meter
frequency counter
frequency method
entrainment of frequency
frequency modulation
frequency modulator
frequency‐modulated telecontrol system generator
frequency code
frequency division multiplex
frequency standard
frequency‐phase characteristic
frequency controller
frequency regulator
frequency relay
frequency protection
frequency variation relay
frequency‐selective element
frequency filter
frequency spectrum
frequency‐stabilized
frequency control of motors
frequency division of channels
frequency telemeter
frequency tolerance
frequency‐shift keying
frequency doubler
frequency multiplier
frequency distortions
frequency changer
friction adjuster
main steam maximum pressure controller
main steam minimum pressure limiter
front of logic pulse
front panel
front panel
warning device
initial failure
jointing process of [industrial] robot
jointing dimension
jointing movement
jointing unit
jointing surface modelling jointing surface modeling
jointing surface matrix
jointing function of IR‐assembly
jointing speed
joint[ing] aid
jointing aid, joint aid
jointing force
limitation of jointing force
jointing hole
jointing hole starting
stran 101 od 326
EN ‐DE: slovar avtomatizacije in robotike Fügelochkonstruktion
Fügelochlokalisation
Fügemechanismus
Fügen eines Stiftes (Montageoperation)
Fügen von asymmetrischen Werkstücken
Fügeoperation feines Industrieroboters
Fügerichtung einer IR‐Mon tage
Fügestelle (Wirkbereich eines Roboters)
Fügesystem
Fügetheorie
Fügevorgang
Fügezeit
Fühler
Fühler
Fühlerkontakt
Fühlglied
Führung
Führung
Führungseinheit
Führungsfläche eines Roboterarms
Führungsglied
Führungsgriff (eines Roboterarms)
Führungsgröße
Führungsgröße
Führungsgröße
Führungsgröße
Führungsgrößenerzeugung einer IR‐Bahn
Führungsregelung
Führungsrohr eines Greifers
Führungssäule
Führungsschiene
Führungsschiene eines Manipulators
Führungssignal
Führungssignal
Führungssystem eines Roboters
Führungstoleranz eines Greifers
Führungsübertragungsfunktion
Führungsverhalten
Führungsverhalten
Fülleinrichtung
Füllfaktor
Füllstandsmessgerät
Füllungsgrad
Functionsgenerator
Fundamentalabstand
Fundamentalfolge
Fundamentalfunktion
Fundamentalsystem
Fundamentaltheorem der Informationsübertragung
Fünffingerhand
Fünf‐Phasenmotor für Roboter
Funkeleffekt
Funkenoszillator für induktive Erwärmung
Funkfernlenkung
Funkfernmessung
Funkleitung
Funksteuerung
Funktion eines Greifers
Funktion feines Greifweges
Funktional
Funktionalanalysis
Funktionaldeterminante
funktionale Beziehung
funktionaler Fuzzy‐Regler nach Sugeno
funktionaler Fuzzy‐Regler nach Sugeno
funktionell vollständige Basis
funktionelle Abhängigkeit
funktionelle Auswahlmöglichkeit
funktionelle Dekomposition
funktionelle Klassifizierung
funktionelle Möglichkeiten
funktionelle Roboterklassifizierung
funktionelle Verschachtelung
funktionelles Roboterteilsystem
funktionelles Symbol
Funktionsablauf eines IR
jointing hole construction
jointing hole localization
jointing mechanism
jointing of pin (assembly operation)
jointing of asymmetric s
robot Jointing operation, IR jointing operation
jointing direction of IR‐assembly
jointing position (active region of robot)
jointing system
jointing theory
jointing process
jointing time
contact feeler
contouring tracer
tracer contact
sensing component member
guidance
guide
command module
guide surface of robot lever
set‐point mechanism
guide handle (of robot lever)
command variable
reference input
reference variable
control variable
reference input generating of IR path
variable command control
guide tube of gripper, gripper guide tube
guide column
guide rail
manipulator guide rail
command signal
control signal
guiding system of robot
guide tolerance of gripper
control transfer function
command input response
command response
charging device
bulk factor
wave level gauge
charge coefficient
function generator
fundamental interval
Cauchy sequence
basis function
fundamental system
fundamental theorem of information transmission
five‐finger hand
five‐phase‐motor for robots
flicker effect
spark‐type induction heating generator
radio remote control
radiotelemetering
radio control
radio control
gripper function
function of grip path
functional
functional analysis
functional determinant
functional relationship
Sugeno controller
SuGENO‐controller
functionally complete base
functional dependence
functional optionality
functional decomposition
functional classification
functional capabilities
functional robot classification
functional interleaving
functional partial system of robot
functional symbol
function flow of IR
stran 102 od 326
EN ‐DE: slovar avtomatizacije in robotike Funktionsausgang
Funktionsbefehl
Funktionsbeschreibung
Funktionsdefinition
Funktionsdefinition
Funktionsdezentralisierung
Funktionseingang
Funktionseinheit
Funktionsgeber
funktionsgerechte Roboterkonstruktion
Funktionsglied des Reglers
Funktionskennwerte
Funktionskontrolle von Relaiskreisen
Funktionskorrektur
Funktionsmodell
Funktionsmodul
Funktionsmuster eines Roboters
Funktionsnetz
Funktionsorganisation
funktionsorientierte Programmierung
funktionsorientierte Robotereinteilung
Funktionspotentiometer
Funktionsschema Funktionsschema Funktionsschwankung
Funktionsschwelle
Funktionssignal
Funktionsstörung
Funktionsstörung
Funktionsstörung
Funktionsstruktur
Funktionstabellenprogramm
Funktionstaste
Funktionstest
Funktionstest bei Wartung
Funktionstestgenerator
Funktionsübersicht
Funktionsüberwachung
Funktionsumformer
Funktionsumformer für mehrere Veränderliche
Funktionsunabhängigkeit eines Industrieroboters
Funktionsverteilungsanalysator
Funktionswahl feiner Arithmetik‐Logik‐Einheit
Fuzzifizierung
Fuzzy‐Logik
Fuzzy‐NICHT‐Operator
Fuzzy‐ODER‐Operator
Fuzzy‐PID‐Regler
Fuzzy‐Regelung
Fuzzy‐Regelungssystem
Fuzzy‐UND‐Operator
G reifstelle (Wirkbereich eines Roboters)
gältige Ziffer
gältige Ziffer
galvanische Kopplung
galvanischer Kontakt
Galvanometerkonstante
Gammaeinstellung
Gammafunktion
Gammaradiometer
Gammaspektrometrie
Gammastrahlungsabsorption
Gangschalter
Gangverlust
ganze Funktion
Ganzheit
ganzmagnetisches System
ganzzahliges Optimierungsprogramm
Gas[entladungs]relais
Gas[entladungs]relais
Gas[entladungs]relais
Gasanalysator
Gasanalyse
Gasanzeiger
gasbetätigt
Gaschromatografie
operational output
function instruction
functional description
function definition
functional definition
decentralization of function
operational input
function unit
function generator
robot construction suitable to function
function element of controller
functional characteristics
function checking of relay circuits
action correction
function simulator
functional module
function model of robot
nomogram
functional organization
function‐oriented programming
function‐oriented robot classification
function potentiometer
symbolic circuit
functional scheme function oscillation
threshold of operation
functional signal
failure
breakdown
malfunction
functional structure
function table program
function key
functional test
maintenance function test
arbitrary function generator
functional overview
functional monitoring
function generator
multivariable function generator
function independence of industrial robot
function distribution analyzer
ALU‐function selection, function selection of arithmetic‐logic u
fuzzification
fuzzy logic
fuzzy NOT
fuzzy OR
fuzzy‐PID‐controller
fuzzy control
fuzzy control system
fuzzy AND
grip position (active region of robot)
valid digit
relevant digit
galvanic coupling
ohmic contact
galvanometer constant
gamma control
gamma function
gamma radiometer
gamma[‐ray] spectrometry
gamma radiation absorption
gang switch
loss of cycle
entire function
integrity
all‐magnetic system
integer optimization program
gas‐discharge relay
gas‐filled relay
ionic relay
gas analyzer
gas analysis
gas detector
gas operated
gas chromatography
stran 103 od 326
EN ‐DE: slovar avtomatizacije in robotike gaschromatografische Analyse
Gasdruckregler
Gasdynamik
Gasentladungsanzeige
Gaserzeugungsanlage
Gasexpansionskühlsystem
Gasfeuchtemessung
Gasflussschreiber
gasgefüllte Fotozelle
gasgekühlter Reaktor
Gaskalorimeter
Gaskonstante
Gasmesser
Gasreinigungsanlage
Gasreinigungsprozess
Gasrückgewinnungsverfahren
Gasschmelzschweißautomat
Gasspaltanlage
Gasspurenschreiber
Gastrennanlage
Gasturbinenreaktor
Gasverflüssigungsanlage
Gatterimpuls
Gatterimpuls
Gatterimpuls
Gatterschaltungslogik
Gausskurve belt feed 88
Gausssche Kurve
Gausssche Verteilung
Gausssche Verteilung
Gaussscher Zufallsprozess
Gauss‐Tiefpass
Gay‐Lussac‐Gesetz
geaue Annäherung
Geber
Geber
Geber
Geber mit Frequenzausgang
Geber mit veränderlichem Widerstand
Geberabstand
Gebereinheit
Geberglied
Gebermatrix
Gebläsewirkungsgrad ventilateur
Gebrauchsanweisung
gebrauchsgerechte Roboterkonstruktion
gebrochene rationale Funktion
Gedächtnis
Gedächtnisfunktion
Gedächtnisfunktion
Gedächtnisgleichung
gedämpfte Eigenfrequenz
gedämpfte Eigenfrequenz
gedämpfte Schwingung
gedämpfte Schwingungen
gedämpfte Schwingungen
gedämpftes Messgerät
gedämpftes Strommessgerät
gedrängte Kodierung
geeichte Skale
geeichte Spannungsimpulse tension
Gefährdungsanalyse
Gefährdungsraum eines IR
Gefahrenmeldung
Gefahrensicherheit eines Industrieroboters
Gefahrensicherheit eines Manipulators
Gegendruckmontageplatte
gegengekoppelter elektronischer Regler
gegengekoppelter Kreis
gegengekoppelter Verstärker
Gegenkopplung
Gegenkopplung
Gegenkopplung
Gegenkopplungschleife
Gegenkopplungsschaltung
Gegenkopplungsverstärker
gaschromatographic analysis
gas pressure regulator
gas dynamics
gas discharge display
gas producting plant
gas expansion refrigerating system
gas moisture measurement
gas‐flow recorder
gas‐filled phototube
gas‐cooled reactor
gas calorimeter
gas constant
gas‐flow meter
gas cleaning unit
gas cleaning process
gas recovery process
automatic gas welding machine
gas reforming plant
gas traces recording device
gas fractionation plant
gas turbine reactor
gas liquefaction plant
indicator gate pulse
gate pulse
gating pulse
gate circuit logic
bell‐shaped curve
Gaussian curve
Gaussian distribution
normal distribution
Gaussian random process
Gaussian low pass filter
Gay‐Lussac's law
exact approximation
converter
transducer
transductor
frequency output transducer
variable resistance transducer
sensor distance
set unit
set unit
sensor matrix
blower efficiency
direction for use
robot construction suitable to use
fractional rational function
memory
memory function
store function
memory equation
damped frequency (US)
damped natural frequency
damped oscillation
convergent oscillations
damped oscillations
dead‐beat instrument
dead‐beat ammeter
compressed coding
calibrated dial
calibrated voltage‐level pulses
hazard analysis
danger room of IR
alarm message
danger safety of industrial robot
danger safety of manipulator
back‐pressure mounting plate
degenerative electronic controller
degenerative circuit
degenerative amplifier
feedback loop
degenerative feedback
negative feedback
negative feedback loop
degenerative circuit
feedback amplifier
stran 104 od 326
EN ‐DE: slovar avtomatizacije in robotike Gegenkopplungsverstärker
Gegenkopplungswiderstand
Gegenleistung
Gegenmodulation
Gegennebensprechdämpfung
Gegenphase
Gegenprobe
Gegenschaltung
Gegenschaltung
gegenseitig synchronisierte Systeme
gegenseitig unabhängige Größen
gegenseitige Modulation
gegenseitige Modulationsverzerrung
Gegensinnschaltung
Gegenstromapparat
Gegenstrombremsung
Gegenstrombremsung von Elektroantrieben
Gegenstromprinzip
Gegenstromprinzip
Gegenstromprozess
Gegenstromprozess
Gegenstromverfahren
Gegenstromverfahren
Gegenstromwärmeübertragungsprinzip
Gegentaktstufe
Gegenverbunderregung
Gegenverbundkaskadenregelung
Gegenverfahren
gegenwärtiger Wert
Gehäuse für Robotersteuerung
Geiferausgleichseinheit
Geigerzähler
gekoppelte Selbstregelung
gekoppelte Selbstregelung
gekoppelte Stromkreise
gekoppelter Analog‐ und Digitalrechner
gekoppeltes Verhalten
gekürzt
gelagerter Roboterschlitten
Gelenk
Gelenkachse
Gelenkanzahl
gelenkartiger Robotermodul
Gelenkbelastung
Gelenkbewegungen
Gelenkdimensionierung
Gelenkeinheit eines Greifers
Gelenkeinheit feines Industrieroboters
Gelenkelement
Gelenkfreiheitsgrad
Gelenkimpulsgeber
Gelenkkinematik
Gelenkkonfiguration
Gelenkkraft
Gelenkkraftvektor
Gelenkmanipulator
Gelenkmoment
Gelenkmomentvektor
Gelenkprinzip
Gelenkreaktion
Gelenkrechner
Gelenkregelung
Gelenkroboter
Gelenksensor
Gelenksteuerrechner
Gelenkvariable
Gelenkwinkel
Gelenkwinkel einer Robotertrajektorie
Gelenkwinkeldaten pl
Gelenkwinkelgröße
Gelenkwinkelistwert
Gelenkwinkelsolldaten pl
Gelenkwinkelsollwerte gemeinsam benutzbar
gemeinsame Datenleitung
gemeinsame Kommunikationsschnittstelle
degenerative amplifier
negative feedback coupling resistor
negative sequence power
push‐pull modulation
far‐end cross‐talk attenuation
reverse phase
check test
counter connection
connection in oposition
mutually synchronized systems
mutually independent variables
intermodulation
cross distortion
countercurrent system
counterflow apparatus
back‐current bracking
electrodrive dynamic braking
back‐current principle
countercurrent principle
counterflow operation
counterflow process
counterflow operation
counterflow process
heat transmission counter flow principle
push‐pull stage
differential excitation
differential concatenation control
back‐to‐back method
current value
robot control case
balancing unit of gripper
Geiger counter
interacting control
multivariable control
coupled circuits
hybrid computer
compound action
short
pivoted robot carriage
joint, hinge
joint axis
joint number
articulated robot module
joint load
movement of joints
dimensioning of joint
unit of gripper joint, gripper joint unit
robot joint unit, IR joint unit
joint element
freedom degree of joint, joint freedom degree
joint impulse generator
joint kinematics
joint configuration
joint force
vector of joint force
joint manipulator
joint moment
vector of joint moment
joint principle
joint reaction
joint computer
joint regulation
joint robot
wrist sensor
joint control computer
joint variable
joint angle
joint angle of robot
joint angle data
joint angle actual value
joint angle actual value
joint angle nominal value, joint angle nominal data
joint angle nominal value, joint angle nominal data
shareable
common data line
common communication interface
stran 105 od 326
EN ‐DE: slovar avtomatizacije in robotike gemeinsame Peripherie
common peripherals
gemeinsame Sprache
common language
gemeinsame Verteilung
join distribution
gemeinsames Regelungssystem
common control system
Gemeinschafts‐Spektrometeranlage installation spectrométriqmultiuser spectrometer facility
gemessene Reaktion
measured response
gemessener Betriebswert
measured operating value
gemessener Robotergelenkwinkel
measured joint angle of robot
gemischte Digital‐Analog‐Schaltung
hybrid digital‐analog circuit
gemischte Steuerung
mixed control
gemischte Technologie
merged technology
genaue Fügeoperation
precise insert operation
genaue Roboterachsregelung
accurate robot axis regulation
Genauigkeit
accuracy
Genauigkeit
exactness
Genauigkeit
exactitude
Genauigkeit
precision
Genauigkeit bei der Handhabung mechanischer Bauteile
handling accuracy of mechanical components
Genauigkeit der Entfernungsmessung
range accuracy
Genauigkeit der Informationsübertragung
fidelity of information transmission
Genauigkeit der Regelung
accuracy of control
Genauigkeit der Regelung
accuracy of regulation
Genauigkeit der Regelung
regulation precision
Genauigkeit der Roboteroperation
operation accuracy of robot
Genauigkeit des Manipulationssystems
accuracy of manipulation system
Genauigkeit des Steuerungssystems
accuracy of control system
Genauigkeit eines Roboters
accuracy of robot, robot precision
Genauigkeitsbestimmung digitaler Voltmeter
definition of the accuracy of digital voltmeters
Genauigkeitsgrad
accuracy grade
Genauigkeitsgrad
degree of accuracy
Genauigkeitsgrenze
accuracy limit
Genauigkeitsklasse
accuracy class
Genauigkeitsklasse
class of accuracy
Genauigkeitskontrollzeichen
accuracy check character, ACC
accuracy check
Genauigkeitsprüfung
Genauigkeitstoleranzen (eines Roboters)
accuracy tolerances (of a robot)
Genauigkeitsüberwachungssystem
accuracy control system
accuracy study
Genauigkeitsuntersuchung
Genauigkeitsverlust
loss of accuracy
electrical heat generator
Generator für Dielektrikheizung
Generator für sägezahnförmige Schwingungen
saw‐tooth wave form generator
Generator mit gesteuerter Drehzahl
controlled‐speed generator
Generator mit selbsttätiger Steuerung
automatic generator
Generator mit veränderlicher Frequenz
variable frequency generator
Generator sinusförmiger Signale
sinusoidal signal generator
Generator von Zufallssignalen
generator of random signals
Generatorimpulsbetrieb
generator pulse regime
Generatorspannungsregler
generator voltage controller
Generieren eines Montagesystems
assembly system generation
generierte Effektorbahn
generated effector path
generierte Montagedaten pl
generated assembly data
generierte Prüfdaten pl
generated checking data
generierte Roboterkoordinaten
generated robot coordinates
genietete Baugruppe
riveted assembly
genügende Näherung
adequate approximation
Geometrie einer Roboterbahn
geometry of robot path, robot path geometry
Geometrie mit schmalem Streifen
narrow‐stripe geometry
Geometriebeschreibung
geometry description
geometrieorientierte Objektbeschreibung
geometry‐oriented object description
Geometriesprache
geometry language
Geometrieverarbeitung
geometry treatment
geometrische Analogdaten pl
geometric analog data
geometrische Armelementekonfiguration
geometric arm element configuration
geometrische Armkonfiguration (Roboterarmkonfiguration) geometric arm configuration (robot)
geometrische Information
geometric information
geometrische Programmiersprache
geometric programming language
geometrische Roboterkonfiguration
geometric robot configuration
geometrische Struktur
geometric structure
geometrische Strukturanalyse
geometric structure analysis
geometrische Strukturausgabe
geometric structure output
geometrische Struktureingabe
geometric structure input
geometrischer Greiferparameter
geometric gripper parameter
geometrisches Modell
geometric model
geometrisches Objekt
geometric object
geordnete Struktur
ordered structure
Geothermometer
geothermometer
stran 106 od 326
EN ‐DE: slovar avtomatizacije in robotike gepackte Schaltung
geprüfte Große
gerade Funktion
gerade Funktion
gerades Programmstück
geradlinige Greiferbewegung
geradliniger Bewegungsablauf
Geradschiebung eines Greiforgans
Geradsichtspektroskop
geradzahlige Harmonische
Gerät mit byteweiser Übertragung
Gerät mit netzunabhängiger Stromversorgung
Gerät mit veränderbarer Geschwindigkeit
Gerät zur automatischen Ziffernerkennung
Geräte der Pneumatik
Geräte der Pneumatik
Geräteangaben
Geräteauswahl
Gerätebau
Gerätedaten pl
Gerätedatenbank
Gerätefehler
Gerätefehler eines Roboters
Gerätefertigung
Geräteinnovation
Gerätekompatibilität
Gerätekomplex
Gerätepriorität
Geräteprüfungsbit
Gerätestatus
Gerätestatus
Gerätestatus
Gerätestatusregister
Gerätesteuerblock Gerätesteuerprogramm
Gerätesteuerprogramm
Gerätesteuerung
Gerätestörung
Gerätetechnikausfall
Gerätetechnikfehler
Gerätetechnikschnittstelle
gerätetechnisch ausgelöste Unterbrechung
gerätetechnisch realisiert
Gerätetest
Gerätetest
Gerätetyp
Geräteunabhängigkeit
Gerätezuordnung
Gerätezuordnung
Geräusch
geräuscharmer Funktionsablauf
geräuscharmer Lauf
Geräuschbegrenzer
Geräuschmesser
Geräuschmesser
Geräuschmesser
Geräuschpegel
Geräuschpegel
Geräuschsensor
Geräuschsimulation
Geräuschunterdrücker
geregelte Stromversorgung
geregelte Stromversorgung
geregelte Temperatur
geregelter Effektorzustand
geregelter Gleichrichter
geregelter Mikrorechner
geregelter Roboterantrieb
geregelter rotatorischer Positionierantrieb
geregeltes Medium
geregeltes Netzwerk
Gergentaktmodulator
gerichtet
gerichtete Kette
gerichtete Übertragung
gerichteter Graph
packaged circuit
checked quantity
even function
parity function
linear program part
rectilinear gripper movement
rectilinear sequence of motions
straight displacement of grip organ
direct vision spectroscope
even harmonics
byte device
self‐powered device
variable speed device
automatic digit recognizer
automatic pneumatic devices
pneumatic automation installations
device specifications
device selection
instrument manufacture
device specifications
device data file, device data bank
device error
robot device error
equipment production
equipment innovation
equipment compatibility
device complex
device priority
equipment check bit
device status, assembly status
device status
unit status
assembly status register, ASR, device status register
unit control block device driver program
device driver program, device control program
device control
equipment trouble
hardware failure
hardware fault
hardware interface
hardware‐interrupt
hardware‐implemented
device test
unit test
device type
device independence
device allocation
device assignment
noise
quiet operation
quiet operation
noise limiter
noise measuring instrument
noise meter
noise test set
noise level
noise ratio
sound sensor
noise simulation
noise suppressor
regulated supply
stabilized power supply
controlled temperature
controlled effector state
regulated rectifier
controlled microcomputer
controlled robot drive
controlled rotation positioning drive
controlled medium
controlled network
balanced modulator
oriented
unidirectional circuit directional transmission
directed graph
stran 107 od 326
EN ‐DE: slovar avtomatizacije in robotike gerichteter Leistungsschutz
gerichteter Szintillationszähler
geringe Leistungsaufnahme
geringe Stromabgabe
geringe Stromaufnahme
geringster Personalaufwand
Geruchssensor
Gesamtabmessung
Gesamtamplitude
Gesamtanlage
Gesamtanlage
Gesamtbeiwert der stationären Strömung
gesamte Entwurfsprobleme
gesamte Maschinencharakteristik
Gesamteinschaltzeit
Gesamtelektroleitfähigkeit
Gesamtfehler
Gesamtfehler
Gesamtflexibilität
Gesamtgenauigkeit
Gesamtoperation
Gesamtplan
Gesamtplan
Gesamtstruktur
Gesamtstruktur eines Hybridsystems
Gesamtsystem
Gesamtsystem
Gesamtsystem
Gesamtsystem
Gesamtsystemleistung
Gesamtübertragungsfunktion
Gesamtverhalten
Gesamtverlust
Gesamtwirkungsgrad
Gesamtwirkungsgrad
gesättigt
gesättigt
geschlossene Kurve
geschlossene Kurve
geschlossene Robotertrajektorie
geschlossene Schleife
geschlossene Schleife
geschlossener Kreislauf
geschlossener Lageregelkreis
geschlossener Stromkreis
geschlossener Stromkreis
geschlossener Zyklus
geschlossener Zyklus
geschlossenes Impulssystem
geschlossenes System
geschlossenes Unterprogramm
Geschwindigkeit
Geschwindigkeit Geschwindigkeit der Armkomponenten
Geschwindigkeit der Schaltung
Geschwindigkeit der Schaltung
Geschwindigkeit der Schaltung
Geschwindigkeit des Selbstausgleiches
Geschwindigkeit des Selbstausgleiches
Geschwindigkeit feiner Roboterbewegung
Geschwindigkeitsabnahme
Geschwindigkeitsbereich
Geschwindigkeitsbetrag
Geschwindigkeitsdaten pl
Geschwindigkeitsdifferenzmessgerät
Geschwindigkeitsfehler
Geschwindigkeitsgeber
Geschwindigkeitsinformation
Geschwindigkeitskoordinate
Geschwindigkeitsmesser
Geschwindigkeitsmodulation
Geschwindigkeitsregelung
Geschwindigkeitsregelung
Geschwindigkeitsregelung
Geschwindigkeitsrückführung
Geschwindigkeitsrückführung
directional power protection
directional scintillation counter
low‐power consumption
low‐power source
low‐power drain
minimum of staff
deodorizing sensor
overall dimension
net amplitude
overall plant
complete plant
overall steady‐flow coefficient
overall design problems (of a computer)
overall machine characteristic
total closing time
addition electrical conductivity
gross error
total error
total system flexibility
overall accuracy
total operation
layout plan
general plan
total structure
total structure of hybrid system
total system
compound system
interconnected system
overall system
overall system performance
overall transfer function
summation action
overall loss
net efficiency
overall efficiency
saturated
saturating
closed curve
closed graph
closed robot trajectory
closed loop
closed path
closed cycle
closed loop position control
closed circuit
complete circuit
closed loop
closed path
closed‐loop pulse system
closed system
closed subroutine
velocity
performing operation speed
speed of arm components
circuit speed
operation speed
switching speed
rate of inherent regulation
rate of selfregulation
speed of robot movement
deceleration
speed range
speed value
speed data, data of assembly speed
speed difference measuring device
velocity (ramp) error
speed sensor
speed information
velocity
speedometer
speed modulation
speed control
velocity control system
velocity servomechanism
rate feedback
velocity feedback
stran 108 od 326
EN ‐DE: slovar avtomatizacije in robotike Geschwindigkeitssensor
Geschwindigkeitssensorsystem
Geschwindigkeitssollwert
Geschwindigkeitssteuerung
Geschwindigkeitssystem
Geschwindigkeitswert
Gesenkschmiedekomplex mit Roboter
Gesenkschmieden
gespannter Greiferfinger
gespeicherte Logik
gespeicherte Montageerfahrung
gespeicherte Roboterwertetabelle
gespeichertes Einzelteil
gespeichertes Referenzbild
gesperrte Auslösung
gesperrte Auslösung
gesperrter Wert
Gesprächszeitmesser
gesstörtes System
Gestalterkennung
Gestalterkennung
Gestalterkennung
Gestaltungsmethode
gestattete Unterbrechung
Gestellelement eines Industrieroboters
Gestellsystematik von Industrierobotern
gesteuerte Beimischung von Unreinheiten
gesteuerte Dämpfung
gesteuerte Größe
gesteuerter Fügemechanismus
gesteuerter Funktionsgenerator
gesteuerter Leistungsgleichrichter
gesteuerter Speicher
gesteuerter Synchronmanipulator
gesteuerter Übertrag
gesteuertes Netzwerk
gesteuertes System
gesteuertes Zeitintervall
gesteuertes Zugriffssystem
gesteuertes Zugriffssystem
gestörte Bewegung
gestörte Greiferbewegung
gestörte Leitung
gestörter Wert
gestörter Zustand
gestörtes Element
gestörtes Nullausgangssignal
gesuchtes System
getaktete Logik
getaktetes System
getastete automatische Verstärkungsregelung
getrennt
getrennt
getrennte Arbeitsweise
getrennte Daten
getrennte Einheit
getrennte Verarbeitung
getrennter Handhabezyklus
getrennter Steuerteil
getrenntes konvexes Gebiet
Getriebe eines Zangengreifers
Getriebe für Servomechanismen
Getriebefreiheitsgrad
Getriebeglied
Getriebeglieder eines Greifers
Getriebegliedergewicht
getriebeloser Robotermotor
Getriebesteuerkommando (Roboter)
Getriebesteuerung
Getriebeübersetzungsverhältnis
Getriebeübersetzungsverhältnis
Getriebeübersetzungsverhältnis
Gewährungsebene
Gewicht der Getriebeglieder
Gewichtete‐Mittelwerte‐Methode
Gewichtsfaktor
speed sensor
speed system of sensor
speed nominal value
speed control
speed system
speed value
drop forging complex with robot
die forging, drip forging
tensioned gripper finger
stored logic
stored assembly experience
stored value table of robot
stored one‐off part
stored reference image
fixed trip
locked trip
inaccessible value
chargeable‐time indicator
perturbated system
object identification, pattern recognition
object identification
pattern recognition
design method
enabled interruption
robot frame element, frame element of industrial robot
robot frame systematics
controlled addition of impurities
controlled damping
controlled variable
controlled joint mechanism
controlled function generator
controlled power rectifier
controlled store
weight arm manipulator
instructed carry
controlled network
controlled system
controlled time interval
controlled access system
controlled access system, CAS
disturbed motion
disturbed gripper movement
faulted line
disturbed value
disturbed state
faulty element
disturbed‐zero output
wanted system
synchronous logic
clocked system
gated automatic gain control
offline
autonomous
offline mode
separated data
separated unit
offline processing
separated manipulation cycle
split control section
disjoint convex region
gear of pincer gripper
gear for servomechanisms
gear degree of freedom
gear element
gripper gear elements
weight of gear elements
gearless robot motor
gear control command
gear control
gear ratio
transfer ratio
transfer number
compliance level
weight of gear elements
weighted average defuzzification
weight factor
stran 109 od 326
EN ‐DE: slovar avtomatizacije in robotike Gewichtsfunktion
Gewichtskompensation
Gewinn
Gewinn des Lasers
Gewinn im aktiven Lasermedium
Gewinn nach der Demodulation
gewinngeführt
gewinngeführter Laser
Gewinnpegel
gewöhnliche Differentialgleichung
gewöhnlicher Punkt
gewollte Betätigung
GH
gießen (durch Roboter)
Gießereiroboter
Gießroboter
Gitterableitwiderstand
Gitterbasisschaltung
Gitterkreis
Gitterspektroskop
Gittersteuerleistung
Gittersteuerung
Gitterstromkennlinie
Gitterverlustwiderstand
Gittervorspannungsmodulation grille
glatte Nichtlinearität
glätten
glättendes Filter
Glättung
Glättungsdrossel
Glättungsfilter
Glättungskoeffizient
Glättungskreis
Glättungsschaltung
Gleichaufwinkelübertragung gleichberechtigt
gleichbleibende Daten pl
Gleichdruckprozess
gleichförmig
Gleichgangsteuerung
Gleichgangstromkreis
gleichgerichteter Wechselstrom
gleichgerichtetes Signal
Gleichgewicht
Gleichgewicht
Gleichgewichtsbedingungen
Gleichgewichtsbedingungen
Gleichgewichtsdaten pl
Gleichgewichtsenergie
Gleichgewichtsgewinn
Gleichgewichtslage
Gleichgewichtspunkt
Gleichgewichtswert
Gleichgewichtszustand
Gleichgewichtszustand
Gleichgewichtszustand
Gleichheitsrelation
Gleichlaufprüfung Gleichlaufsteuerung
gleichmächtig
gleichmäßig beschränkt gleichmäßig verteilte Energieniveaus uniforme
gleichmäßige Beschickung
gleichmäßige Konvergenz gleichmäßige Luftdruckregulation
gleichmäßige Roboterarmbewegung
gleichmäßige Skale
gleichmäßige Skale
gleichmäßige Temperaturregeking
gleichmäßige Temperaturregelung
Gleichmäßigkeit Gleichmäßigkeitsfaktor Gleichphasendetektor
gleichphasiges Signal
Gleichrichter für hohe Sperrspannungen
Gleichrichter‐Fotodiode
weighting function
compensation of weight
gain
laser gain
active medium gain
post‐detection gain
gain‐guided
gain‐guided laser
gain level
ordinary differential equation
ordinary point
deliberate actuation
graphical interactive interface
cast to (by robot)
foundry robot
casting robot
grid leak
grounded‐grid circuit
grid circuit
grating spectroscope
grid driving power
grid control
grid current characteristic
grid leak
grid bias modulation
smoothed non‐linearity
smooth v
smoothing filter
smoothing
smoothing reactor
smoothing filter
smoothing coefficient
smoothing circuit
smoothing circuit
synchro‐angle transmission peer adj
permanent data
constant‐pressure cycle
uniform gang control
gang circuit
rectified alternating current
rectified signal
balance
equilibrium
equilibrium conditions
balance conditions
equilibrium data
equilibrium energy
equilibrium gain
uniform steady state equilibrium point
conservative value
equilibrium position
uniform steady state equilibrium state
equality relation
synchronism check synchronization equipotent
uniformly bounded evenly spaced energy levels
regular loading, regular feeding
uniform convergence continuous pneumatic pressure regulation
regular robot lever motion
evenly divided scale
uniform scale
continuous temperature regulation
continuous temperature regulation
uniformity uniformity factor inphase detector
in‐phase signal
high‐inverse‐voltage rectifier
rectifier photodiode
stran 110 od 326
EN ‐DE: slovar avtomatizacije in robotike Gleichrichterfotozelle
Gleichrichtermessgerät
Gleichrichterparallelschaltung
Gleichrichterwandler
Gleichrichtung
Gleichrichtungswirkungsgrad
gleichsinnige Ableitung
Gleichspannungspegel
Gleichspannungswandler
Gleichstrommikromotor
Gleichstromübertragung
Gleichstromversorgung
Gleichstromversorgungsausfall
Gleichstromverstärker
Gleichstromvorspannung
Gleichtaktbetrieb
Gleichtaktunterdrückung
Gleichung der Regelstrecke
Gleichung des statischen Regelkreises
Gleichung freier Schwingungen
Gleichung in relativen Variablen
Gleichungsfehler
Gleichungslöser
Gleichungssystem
gleichzeitig existent
gleichzeitiger Betrieb
Gleichzeitigkeitswähler
Gleichzeitigkeitszähler
Gleitelement eines Greifers
gleitende Mittelwertbildung
gleitende Robotermontage
gleitendes Verhalten mit konstanter Geschwindigkeit
Gleitführung
Gleitgelenk
Gleitkommabefehl
Gleitkommadarstellung
Gleitkommamethode
Gleitkommaverfahren
Gleitmontageprinzip
Gleitzustand
Glied
Glied des Roboters
Glied mit konzentrierten Parametern
Glied ohne Ausgleich
Gliederzahl eines Manipulatorantriebes
Gliederzahl eines Manipulatorantriebes
Gliederzahl feines Manipulatorantriebes
global geregelter Effektorzustand
globale Programmierung globale Reaktivität globale Reaktivität globale Roboterbewegung
globale Stabilität
globale Stabilität
globaler Effektorzustand
globales Automatisierungssystem
Globaloptimisator
Glockenkurve
Gradient
Gradient elektrischer Feldstärke
Gradiometer
Grafentheorie
Grafikhardware
Grafikplotter
Grafikprozessor
Grafikschreiber
grafisch‐analytische Methode
grafische Addition
grafische Analyse
grafische Angaben
grafische Bestimmung
grafische Darstellung
grafische Darstellung
grafische Darstellungstheorie
grafische Dateneingabetechnik
grafische Dateneingabetechnik rectifier photoelectric cell
rectifier instrument
parallel rectifier circuit
rectifier converter
rectification
rectification efficiency
equidirectional derivative
direct current level
direct current converter
DC ‐micro motor
direct current signalling
direct current [power] supply
direct current dump
direct current amplifier
direct current bias [voltage]
common mode
common mode rejection
equation of controlled system
equation of static control circuit
equation of free oscillations
equation in relative variables
equation error
equation solver
equation system
concurrent
simultaneous operation
coincidence selector
coincidence counter
sliding element of gripper, gripper sliding element
moving‐average
floating robot assembly
single‐speed floating action
sliding guide
sliding joint
floating‐point instruction
floating‐point representation
floating‐point method
floating‐point method
line assembly work
sliding regime
block
robot element
element with lumped parameters
element without selfregulation
drive element number
element number of manipulator drive
drive element number, element number of manipulator drive
global‐controlled effector state
global programming
static reactivity
global reactivity global robot movement
stability in the large
global stability
global effector state
global automation system
absolute extremum optimizer
bell‐shaped curve
gradient
electric field gradient
gradiometer
graph theory
graphics hardware
graphic plotter
graphic processor
graphic plotter
semigraphical method
graphic addition
graphical analysis
graph data
graphical determination
graph chart
graphic representation
graph theory
graphical data input technique
graphical data input technique
stran 111 od 326
EN ‐DE: slovar avtomatizacije in robotike grafische Datenstruktur
grafische Datenverarbeitung
grafische Erfassungseinheit
grafische Größe
grafische Information
grafische Interpretation
grafische Komponente
grafische Mensch‐Maschine‐Kommunikation
grafische Methode
grafische Roboterprogrammierung
grafische Struktur
grafische Unterprogrammbibliothek
grafische Vorlage
grafische Zugriffsmethode
grafischer Achtungssteuerblock
grafischer Entwurf
grafischer Informationsaustausch
grafischer Plotter
grafischer und taktiler Bildschirm
grafisches Bildschirmprogramm
grafisches Display
grafisches Endgerät
grafisches Grundelement
grafisches interaktives Interface
grafisches interaktives Programmsystem
grafisches interaktives Programmsystem graphique
grafisches Paneel
grafisches Programmsystem
grafisches Rauschen
grafisches Sichtanzeigegerät
grafisches Zeichen
Gramsche Determinante
Graphenproblem
Graphentheorie
Graphenverarbeitung
Gratstanzen
Grauwert
Grauwertbildverarbeitung
Gravitationskraft
Greensche Funktion
Greffersteuergröße
Greif art
Greif köpf
Greif kraft feines Industrieroboters
Greif organschließen
Greif seil
Greif zeit
Greifanzeige
Greifbacken
Greifbackenmitte
Greifbedingung eines Werkstücks
Greifbereich
Greifcharakteristik
Greifeinheit
Greifeinheit mit drei Fingern
Greifeinheitenenergie/
Greifeinrichtung (für Beschickungsroboter)
Greifen
Greifen eines Stiftes (Montageoperation)
Greifen von Handhabungsobjekten
Greifer
Greifer mit beweglichem Backen
Greifer mit Gummifedern
Greifer mit symmetrischer Klauenbewegung
Greifer mit taktilem Sensor
Greifer‐ und Fügewerkzeuge
Greiferablaufsteuerung
Greiferabmessung
Greiferachse
Greiferanalyse
Greiferanfangspunkt
Greiferanpassung
Greiferantrieb
Greiferantriebsart
Greiferantriebsfunktion
Greiferantriebsgeschwindigkeit
graphic data structure
graphic data processing
graphic acquisition unit
graphic quantity
graphic information
graphic interpretation
graphic component
graphic man‐machine communication
graphic method
graphical robot programming
graphic structure
graphic subprogram library
graphical sheet
graphic access method
graphic attention control block
graphic design
graphic communication
graphic plotter
graphic and tactile screen
graphic display program
graphic display
graphic terminal
graphic basic element
graphical interactive interface
graphical interactive program system
graphical interactive program system
graphic panel
graphical program system
graphic noise
graphic display
graphic character
Gram determinant
problem of graphs
graph theory
treatment of graph
burr punching
grey value
processing of grey value images
gravitational force
Green's function
gripper control size
grip mode
grip head
robot grip power, grip power of industrial robot
closing of grip organ
grip rope, grip cable
grip time
grip report
grip jaw
centre of grip jaw
grip condition of grip region
grip characteristic
grip unit
three‐finger grip unit
energy of grip unit
gripping equipment (for feeding robot)
grip
grip of pin {assembly operation)
grip of handling objects
gripper, grab, gripping device
gripper with movable jaw
gripper with rubber springs
gripper with symmetrical movement of claw
gripper with tactile tensor
gripper and jointing tools
gripper trace control
gripper dimension
gripper axis
analysis of gripper
initial point of gripper
gripper adaptation
gripper drive
kind of gripper drive
gripper drive function
gripper drive speed
stran 112 od 326
EN ‐DE: slovar avtomatizacije in robotike Greiferarbeitsbahn
Greiferarbeitspunkte mpf
Greiferarbeitsraum
Greiferarm
Greiferaufbau
Greiferaufwand
Greiferausführung
Greiferausgleichseinheit
Greiferausleger
Greiferauswahl
Greiferauswahlkriterium
Greiferbacken
Greiferbackenbewegung
Greiferbahn
Greiferbauelement
Greiferbauform
Greiferbaugruppe
Greiferbedingung
Greiferbetätigung
Greiferbewegung von Punkt zu Punkt
Greiferbewegungsbereich
Greiferbewegungseinheit
Greiferbewegungsparameter
Greiferbreite
Greiferdreheinheit
Greiferdreherzeugung
Greiferdrehgelenk
Greiferdrehgeschwindigkeit
Greiferdrehung
Greiferdrehwinkel
Greiferdurchmesser
Greifereffektor
Greifereigenschaft
Greifereinflussgrösse
Greifereinrichtung
Greifereinsatzbedingung
Greifereinstellung
Greiferelementarbewegung
Greiferendpunkt
Greiferenergiekopplung
Greiferenergieleitung
Greiferentwurf
Greiferfinger
Greiferflexibilität
Greiferfolgebewegung
Greiferform
Greiferformadaptation
Greiferformgebung
Greiferfühlelement
Greiferführung
Greiferführungsgetriebe
Greiferführungsgetriebe mit Drehgelenken
Greiferführungsgetriebe mit Schubgelenk
Greiferführungsprofil
Greiferführungsrohr
Greiferführungssystem
Greiferfunktion
Greifergelenk
Greifergelenkabstand
Greifergelenkeinheit
Greifergelenkelement
Greifergelenkfreiheitsgrad
Greifergestalt
Greifergestaltadaptati on
Greifergetriebe
Greifergetriebeglieder
Greifergleitelement
Greiferglied
Greifergliedlänge
Greifergrobbewegung
Greifergrobeinstellung
Greifergrundbauelement
Greifergrundbaugruppe
Greiferhand
Greiferhand mit berührenden Sensoren
Greiferhandbaugruppe
gripper working path [of robot]
gripper working points
gripper working space
gripper arm
gripper structure
gripper expense
gripper construction
balancing unit of gripper
gripper boom, boom of robot gripper
selection of gripper, gripper selection
choice criterion of gripper
gripper jaws
gripper jaw movement, movement of gripper jaw
gripper path
gripper component
gripper type of construction
assembly of gripper
gripper condition
actuating of gripper
gripper movement from point to point
region of gripper motion (movement)
movement unit of gripper, motion unit of gripper
gripper movement parameter
gripper width
gripper rotation unit
generation of gripper rotation
rotation joint of gripper
gripper rotation speed
gripper rotation (arm)
gripper rotation angle
gripper diameter
gripper effector
gripper property
gripper influence size
gripper equipment
application condition of grip‐per
adjustment of gripper, gripper adjustment
elementary movement of gripper
end point of gripper
energy coupling of gripper
gripper energy line
design of gripper
gripper finger
flexibility of gripper
gripper movement sequence
form of gripper
form adaptation of gripper
forming of gripper
gripper sensing element
gripper guide
gripper guide gear, gripper guide transmission
gripper guide gear with rotation joints
gripper guide gear with shear joint
gripper guide profile
guide tube of gripper, gripper guide tube
gripper guide system
gripper function
gripper joint
distance of gripper joint
unit of gripper joint, gripper joint unit
gripper joint element
gripper joint degree of freedom
form of gripper
form adaptation of gripper
gripper gear
gripper gear elements
sliding element of gripper, gripper sliding element
gripper element
length of gripper element
gross motion of gripper
coarse adjustment of gripper
basic element of gripper
gripper basic assembly
gripper hand
gripper hand with touching sensors
gripper hand sub‐assembly
stran 113 od 326
EN ‐DE: slovar avtomatizacije in robotike Greiferhandbewegung
Greiferhanddrehung
Greiferhandform
Greiferhandsteuerung
Greiferhöhe
Greiferhub
Greiferkatalog
Greiferklaue
Greiferkonstruktion
Greiferkoordinatensystem
Greiferkopf
Greiferkopplung
Greiferkraftmessung
Greiferkraftrichtung
Greiferlagerung
Greiferlänge
Greiferlineareinheit
Greifermasse
Greifermasse
Greifermechanismus
Greifermechanismusvarianten
Greifermoment
Greifermontage
Greifernullpunktlage
Greiferobjekt
Greiferöffnen
Greiferoperation
Greiferordnung
Greiferorgan
Greiferorientierung
Greiferparameter
Greifer‐Peripherie
Greiferplatte
Greiferposition
Greiferpositionierung
Greiferprinzip
Greiferprofil
Greiferprofilform
Greiferprogramm
Greiferraumpunkt
Greiferrichtung
Greiferrolle
Greiferrollenführung
Greiferrotation
Greiferrotationsachse
Greiferrotationsangaben
Greiferrotationsdaten pi
Greiferrückführung
Greiferschließen
Greiferschubbewegung
Greiferschubweg
Greiferschwenkbewegung
Greiferschwenkwinkel
Greiferschwerpunkt
Greiferschwingung
Greiferselektion
Greifersicherheit
Greiferspiel
Greiferspieleinstellung
Greiferstandardbahn
Greiferständer
Greifersteilung
Greifersteuerleitung
Greifersteuerung
Greiferstillsetzzeit
Greiferstruktur
Greiferstrukturauswahl
Greiferstrukturbezeichnung
Greiferstrukturvariante
Greifersuchbewegung
Greifersystem
Greifersystem mit starren Fingern
Greifersystematik
Greifersystematik
Greifertastorgan
Greifertechnik
hand motion (movement) of gripper
gripper hand rotation
gripper hand form
hand control of gripper
gripper height
gripper stroke
gripper catalogue
gripper claw
gripper construction
gripper coordinate system
gripper head
coupling of gripper
measurement of gripper force
direction of gripper force
gripper support
gripper length
gripper linear unit
gripper weight
mass of gripper, gripper mass
gripper mechanism
variants of gripper mechanism
gripper moment
gripper assembly
gripper zero point position
gripper object, object of gripper
gripper opening (robot command)
gripper operation
order of gripper
gripper claw
orientation of gripper
parameter of gripper
periphery of gripper
gripper plate
gripper position, position of gripper
gripper positioning
principle of gripper
profile of gripper
gripper profile form
gripper program
sequence point of gripper
gripper direction
roll of gripper, gripper roll
roll guide of gripper, gripper roll guide
gripper rotation
gripper rotation axis
data of gripper rotation
data of gripper rotation
recycling of gripper
gripper termination, gripper closing (robot command)
gripper sliding movement, robot gripper sliding movement
gripper sliding route
swivel motion (movement) of gripper
swivel angle of gripper
centre of gravity of gripper
gripper vibration
selection of gripper, gripper selection
gripper safety
play of gripper, gripper play
adjusting of gripper play, gripper play adjusting
gripper standard path
gripper support
gripper position, position of gripper
gripper control line
gripper control
gripper stopping time
gripper structure
gripper structure selection
gripper structure designation (of robot)
gripper structure variant
search movement of gripper
gripper system
gripper system with rigid fingers
systematic of gripper
systematics of gripper
gripper touching organ
gripper technique
stran 114 od 326
EN ‐DE: slovar avtomatizacije in robotike Greifertranslationseinheit
Greifertyp
Greiferüberblick
Greiferumgebung
Greiferunterdruck
Greiferuntersuchung
Greifervariation
Greiferverfahrensgeschwindigkeit
Greiferverfahrgeschwindigkeit
Greiferverlagerung
Greiferverschluss
Greifervolumen
Greiferwechsel
Greiferwechseleinrichtung
Greiferwechselminimierung
Greiferwechselsystem
Greiferwechselzeit
Greiferwelle
Greiferwerkzeug
Greifer‐Y‐Achse
Greifer‐Z‐Achse
Greiferzange
Greiferzuverlässigkeit
Greiffinger
Greiffläche
Greifflächenabstand
Greifflächenanalyse
Greifflächenform
Greifflächengestalt
Greifflächenkontur
Greifflächenpaar
Greifgenauigkeit
Greifhilfen
Greifkraft
Greifkraftalgorithmus
Greifkraftbegrenzung
Greifkraftberechnung
Greifkraftbestimmung
Greifkraftermittlung
Greifkraftkennlinie
Greifkraftkontrolle
Greifkraftregelung
Greifkraftsensor
Greifkraftüberwachung
Greifkraftvektor
Greifkraftverlust
Greifkraftverstärkung
Greifkraftwirkung
Greiflänge
Greifmasse
Greifmoment
Greiforgan
Greiforganantrieb
Greiforganbewegung f( Bewegung eines Greiforgans
Greiforgandimensionierung
Greiforgandrehung
Greiforganlagerung
Greiforganlamelle
Greiforganöffnen
Greiforganspitze
Greifposition
Greifpunkt (eines Greifers)
Greifseilanordnung
Greifsensor
Greifsicherheit/'
Greifstelle
Greifsystem
Greiftechnik
Greiftheorie
Greifvorgang
Greifvorrichtung
Greifvorrichtung für kleine Teile
Greifvorrichtung grappin
Greifvorrichtung grappin
Greifweg
Greifwegfunktion
translation unit of gripper
gripper type
gripper review
environment of gripper
gripper under pressure
gripper study
variation of gripper
gripper process speed
gripper process speed
gripper displacement
gripper closure
gripper volume
gripper change
gripper change device
gripper change minimizing
gripper change system
gripper change time
gripper shaft
gripper tool
gripper Y‐axis
gripper Z‐axis
gripper pliers, gripper pincer, gripper nippers
gripper reliability
grip finger
grip surface, gripping, (grab) area
distance of grip surface, distance of gripping surface
grip surface analysis
grip surface form
form of grip surface
contour of grip surface
pair of grip surfaces
grip accuracy
grip aids
grip force, grip power
algorithm of grip force
limitation of grip power
calculation of grip force
determination of grip force
investigation of grip force
characteristic line of grip power
checking of grip force
regulation of grip force
sensor of grip force
grip force survey
grip force vector
expense of grip force
intensification of grip power
action of grip force
grip length
grip mass
grip moment
grip organ
grip organ drive
grip organ movement
dimensioning of grip organ
grip organ rotation ‐
support of grip organ, grip organ bearing
lamina of grip organ
opening of grip organ
grip organ point
grip position
grip point (of gripper)
arrangement of grip cable
gripping sensor
grip safety
grip place
grip system
grip technique
grip theory
grip process
grip device
gripping device for small parts
grip device
gripper equipment
grip path
function of grip path
stran 115 od 326
EN ‐DE: slovar avtomatizacije in robotike Greifzentrum
Greifzyklus
Grenzbedingung
Grenzbedingungen
Grenzdämpfung
Grenzdaten pl
Grenzeffekt
Grenzenpaar
Grenzfall
Grenzfrequenz
Grenzfrequenz
Grenzfrequenz
Grenzfrequenz
Grenzkontakt
Grenzkontakt
Grenzkraft
grenzkraftgesteuerte Fügebewegung
Grenzmoment
Grenzmomentcharakteristik
Grenznutzentheorie
Grenznutzentheorie
Grenznutzungsdauer
Grenzschichtspannungsmesser interfaciale
Grenzstabilität
Grenzstörung
Grenzstrom
Grenztemperatur
Grenztoleranz
Grenzwert
Grenzwert
Grenzwert
Grenzwertbetrachtung
Grenzwertprozess
Grenzwertprüfung
Grenzwertregler
Grenzwertsatz
Grenzwertsatz
Grenzwertschalter
Grenzwertsignal
Grenzwertvergleicher
Grenzwiderstand
Grenzzyklus
Grerferentwicklung
Grerfertiefe
Gretferbackenbearbeitung
Grifffestigkeit
Grifffläche
Griffflächenabstand
Griffflächendistanz
Griffflächenform
Griffflächenkennzahl
Griffflächenlage
Grob weg vorgäbe
Grobabstimmung
Grobbewegung eines Industrieroboters
grobe Annäherung
grobe Regelung
Grobeinstellung
Grobfilterung
Grobfilterung
Grobposition eines IR
Grobposition eines Manipulators
Grobpositionierung
Grobpositionsermittlung
Grobregler
Grobstruktur
Grobstruktur
Grobstruktur
Grobwegvorgabe
Großbereichsintegration
Größe
große Bestrahlungsanlage
Größe des Faktors
große EDV‐Anlage
große Informationsmenge
große Transiente
grip centre
grip cycle
limiting condidion
boundary conditions
cut‐off attenuation
maximum rating
threshold effect bound pair
limit case
cut‐off frequency
edge‐frequency
limiting frequency
critical frequency
alarm contact
limit contact
limit force
limit force‐controlled jointing movement
limit moment
characteristic of limit moment
boundary utility theory
marginal utility theory
marginal service life
interfacial tensiometer
limit stability
boundary perturbation
limiting current
limit temperature
limit tolerance
boundary
limit value
limit
limiting process
limiting process
marginal checking
limiting controller
boundary value theorem
threshold theorem
limiting value switch
limit [value] signal
limit comparator
critical resistance
limit cycle
gripper development
gripper depth
gripper jaw working
ability to withstand handling
gripping surface
distance of grip surface, distance of gripping surface
distance of grip surface, distance of gripping surface
form of gripping surface
index of gripping surface
position of gripping surface
coarse presetting of displacements
coarse tuning
coarse movement of industrial robot
rough approximation
coarse control
coarse adjustment
prefiltration
preliminary filtration
coarse position of robot, coarse position of industrial robot
coarse position of manipulator
coarse positioning
determination of coarse position
preregulator
coarse structure, MAC restructure
coarse structure
macrostructure
coarse presetting of displacements
large‐scale integration
variable
large‐irradiation plant
factor value
large‐scale computing system
bulk information
large transient
stran 116 od 326
EN ‐DE: slovar avtomatizacije in robotike Größenordnung
Größensteuerung
großer Ausfall
großer Schaden
großes Monitorprogramm
Großflächenproportionalzähler
Großpegel‐Logik
Großraumspeicher
Großraumspeicher
Großrechnersystem
Großserienfertigung
Großsignalanalyse
Großsignalbereich
Grundauftrag (Grundierung f) mittels Spritzroboters
Grundausführung
Grundausrüstung
Grundausrüstung
Grundausstattung
Grundbandsignalgabe
Grundbauart eines IR
Grundbauelement
Grundbauelement eines Greifers
Grundbaugruppe
Grundbaustein eines Greifers
Grundbefehl
Grundbewegung
Grundbeziehung
Grundbeziehung
Grunddatei
Grunddatendarstellung
Grundecho
Grundformat
Grundfrequenz
Grundfunktion
Grundgeschwindigkeit
Grundgesetz
Grundgleichung
Grundgleichung
Grundkode
Grundkomponente der Stomänderungen
Grundkonfigurationeines Manipulators
Grundkonfiguration eines Manipulators
Grundkonstante
Grundkreis
Grundmaschine
Grundmodell
Grundoperation
Grundoperation Grundplatte
Grundplatte eines Manipulators
Grundprogrammierung
Grundrahmen
Grundrauschen
Grundrechenelement
Grundsatz der Robotertechnikanwendung
Grundsatzentscheidung
Grundschaltung
Grundschaltung
Grundschwingung
Grundschwingungstyp
Grundstellung
Grundsymbol
Grundsymbol einer Programmiersprache
Grundtaktfrequenz
Grundtyp
Grundverfahren Grundzeit
Grundzustand
Gruppe von Montagerobotern
Gruppenlaufzeit
Gruppenlaufzeitcharakteristik mit konstanter Steilheit
Gruppenlaufzeitmesser
Gruppentheorie
Gruppenumformer für Millivoltsignale
Gruppenunterbrechung
Gruppierung (durch Roboter)
order of magnitude
size control
major failure
major failure
large monitor program
large‐area proportional counter
high‐level logic
bulk store
bulk memory
large‐scale computing system
large‐scale production
large‐signal analysis
large‐signal region
ground coat application by spray robot
basic execution
basic equipment
basic hardware
basic hardware
baseband signalling
basic construction of IR
basic element
basic element of gripper
basic unit
basic module of gripper
basic instruction
base movement
base equation
fundamental equation
basic file
basic data representation
background return
basic format
base frequency
basic function
basic speed
fundamental law
base equation
fundamental equation
basic code
fundamental component of the current variations
basic configuration of manipulator
basic configuration of manipulator
basic constant
basic circuit
basic machine
basic model
basic operation
unit operation base plate
manipulator base plate
basic programming
base frame
background noise
basic computing element
principle of robot technique application
leading decision
schematic circuit
schematic diagram
basic oscillation
fundamental vibration mode
normal position
basic symbol
basic symbol of programming language
basic clock pulse frequency
basic model
unit process basic time
ground state
assembly robot group
envelope delay [time]
linear‐slope group delay characteristic
envelope delay [time] meter
group theory
millivolt‐signal group converter
control break
grouping (by robot)
stran 117 od 326
EN ‐DE: slovar avtomatizacije in robotike gültige Daten pl
Gültigkeit
Gültigkeitsbestätigung
Gültigkeitskontrolle
Güteabschätzung
Gütebedingungen
Gütefaktor
Gütefaktor
Gütefaktor
Gütefunktion
Gütefunktional
Gütegrad
Gütegrad
Gütegrad
Güteklasse
Gütekriterium
Gütekriterium
Gütekriterium
Gütekriterium für die Regelung
Güteparameter indirect control checking
Güteparameter indirect control checking
Gyrofrequenz
Haftfestigkeit
Haftfestigkeitsprüfung
Haftmagnet (Wirkorgan)
Haftprinzip
Haftspannung
halbautomatisch
halbautomatische Bahnverfolgung halbautomatische Einstellung
halbautomatische Einstellung
halbautomatische Einstellung
halbautomatische Maschine
halbautomatischer Betrieb
halbautomatischer Regler
halbautomatisches Datenerfassungssystem
halbautomatisches Prüfgerät
halbautomatisches Verfahren
Halbbetriebautomatisierung
Halbbildübertragung eines IR Halbfertigfabrikat
Halbfertigprodukt
halbkreisartige Abweichung
Halbleiter
Halbleiter‐ Dünnschichtlaser
Halbleiterbauelement
Halbleiterbildwandler
Halbleitergeräteparameter
Halbleitermikroprozessor
Halbleitersensor
Halbleitertechnologie
Halbleitertriode
Halbleiterverstärker
halblogarithmisch
halblogarithmische Zahlendarstellung
halbparallele Verarbeitungseinheit
Halbperiode
Halbperiode
Halbperiodengleichung
halbstabiler Grenzzyklus
halbstetige Funktion
Halbstofferzeugung
Halbweggleichrichter
Halbwelle
Halbwelle
Halbwertszeit
Hall‐Effekt
Hall‐Effektsensor
Hall‐Sensor
Haltbedingung
Haltebedingung
Haltebefehl
Haltegenauigkeit {eines Greifers)
Halteglied
Halteglied nullter Ordnung
Haltekraft
valid data
validity
validation
validity check[ing]
estimation of quality
performance conditions
Q‐factor
quality factor
figure of merit
criterion function
cost function
Q‐factor
quality factor
figure of merit
grade
performance criterion
performance index
estimation of quality
performance index
index of quality
quality index
gyro‐frequency
adherence
adherence test
magnetic pick‐up
adhesive principle
sticking voltage
semi‐automatic
aided tracking semi‐automatic adjusting
semi‐automatic regulation, semi‐automatic adjusting
semi‐automatic regulation
semi‐automatic machine
semi‐automatic operation
semi‐automatic controller
semi‐automatic data acquisition system
semi‐automatic tester
semi‐automatic procedure
half‐process automation
half‐image transmission of IR
semi‐finished product
semi‐finished product
semicircular deviation
semiconductor
semiconductor film laser
semiconductor building block element
optical image chip
semiconductor instruments parameters
semiconductor microprocessor
semiconductor sensor
semiconductor technology
transistor
semiconductor amplifier
semi‐logarithmic
floating‐point representation
semi‐partial processing unit
half period
semicycle
equation of halfperiods
half‐stable limit cycle
semicontinuous function
half‐material generation
half‐wave rectifier
half period
semicycle
half life
Hall effect
Hall [effect] sensor
Hall [effect] sensor
hold condition
hold condition
breakpoint halt (instruction)
stopping accuracy (of gripper)
holding element
zero‐order hold element (ZOH)
tractive force (power) (manipulator)
stran 118 od 326
EN ‐DE: slovar avtomatizacije in robotike Haltekreis
Halten eines Objekts
Haltepunkt
Haltepunkt
Halterelais
Halterelais
Halterelais
Halterung für Schweißwerk‐
Halteschalter
Halteschaltung
Halteschlüssel
Haltesicherheitsfaktor
Haltestromkreis
Haltestromschaltung
Haltevorrichtung eines Industrieroboters
Haltevorrichtung eines Industrieroboters
Haltevorrichtung für Montage
Haltewirkung
Haltezange
Haltezeit
Hamacher Produkt
Hamacher Produkt
Hamacher Summe
Hamacher Summe
Hamilton‐Jacobische Gleichung
Hamiltonsches Prinzip
Hand feines Industrieroboters
Hand mit drei Fingern
Handbediengerät einer IR‐Steuerung
Handbetätigung
Handbetätigung
Handbetätigung
Handbetätigungseinheit
Handbetrieb eines Manipulators
Handeingabeprogrammierung
Handelemente
Handgelenk eines Industrieroboters
Handgelenkbewegung
Handgelenkkraftsensor
Handhabeaufgabe
Handhabebaukasten
Handhabebaukasten
Handhabebaukasten
Handhabeeinrichtung
Handhabeeinrichtung
Handhabeeinrichtung
Handhabeeinrichtungssignal
Handhabefehler
Handhabefehler
Handhabefehler
Handhabefehler
Handhabefehler
Handhabefunktion
Handhabegerät
Handhabegerät
Handhabegerät
Handhabegerät
Handhabegerät
Handhabegerät mit Rechnerkopplung
Handhabegerät mit Rechnerkopplung calculatrice
Handhabegerät mit Rechnerkopplung calculatrice
Handhabemasse
Handhaben
handhaben
handhaben
Handhabeobjekt
Handhabeoperation
Handhabeprogramm
Handhaberoboter
Handhabesteuergerät
Handhabetechnik
Handhabetechnik manipulation
Handhabetechnik manipulation
Handhabevorgang
Handhabevorgang
Handhabevorgang
hold[ing] circuit
holding of object
holding point
breakpoint
blocking relay
guard relay
interlocking relay
support for welding tool with
holding key
hold[ing] circuit
holding key
safety factor for holding
hold[ing] circuit
lock[ing] circuit
robot support, support of industrial robot
robot support, support of industrial robot
assembly support
holding action
gripping pliers
hold time
Hamacher intersection operator
Hamacher product
Hamacher sum
Hamacher union operator
Hamilton‐Jacobi equation
Hamilton's principe
robot hand
hand with three fingers
hand‐operated device of IR‐control
hand operation
manual control
manual setting
manual control unit
manual operation of manipulator
manual input programming
manual elements, hand elements
hand Joint of [industrial] robot
hand joint movement
force sensor of hand joint
handling task
handling assembly unit, manipulation assembly unit
handling assembly unit
manipulation assembly unit
handling equipment, manipulation equipment
handling equipment
manipulation equipment
handling device signal
handling error, handling defect, manipulation error (defect)
handling error
handling defect
manipulation error
manipulation defect
handling function
handling device, manipulation device
handling device
manipulation device
manipulator
handler
handling device with computer coupling, manipulation device handling device with computer coupling
manipulation device with computer
mass of manipulation
handling
handle v
manipulate v
handling object
handling operation
handling program
handling robot
handling control device
handling technique, manipulation technique
handling technique
manipulation technique
handling process
handling process, manipulation process
manipulation process
stran 119 od 326
EN ‐DE: slovar avtomatizacije in robotike Handhabezyklus
Handhabezyklus
Handhabezyklus
Handhabung
Handhabung (von Werkstücken)
Handhabung mechanischer Teile
Handhabung mittels Roboter
Handhabung von Montageteilen
Handhabung von Montageteilen
Handhabung von Montageteilen
Handhabung von Objekten
Handhabung von Prismateilen
Handhabung von Rotationsteilen
Handhabung von vormontierten Baugruppen
Handhabungsanforderung
Handhabungsarm
Handhabungsautomat
Handhabungsautomatisierung
Handhabungshilfen
Handhabungshilfen
Handhabungsobjekt
Handhabungsoperation
Handhabungsprozess
Handhabungsprozessdaten pi
Handhabungsroboter
Handhabungssequenz
Handhabungssequenz
Handhabungssystem
Handhabungstechnik
Handhabungstechnik
Handhabungstechnik
Handhabungstechnikbaukasten
Handhabungstechnologie
Handhabungsvorgang
Handhabungsvorgang
Handhabungsvorgang
Handlerpaket
Handmontage
Handmontageanteil
Handoperation
Handregelsystem asservissement
Handregelsystem asservissement
Handregelung
Handregelung
Handregelung
Handrückstellung
Handsteuerung
Handsteuerung
Handsteuerung
Handsteuerung der Nachfolgearbeit
hängender Greiferständer
Hardware
Hardware feines Industrieroboters
Hardware für Montageroboter
Hardware Unterbrechung
Hardware‐Assembler
Hardware‐Ausfall
Hardwarebereich
Hardwarefehler
Hardware‐Fehler
Hardware‐Identifikation
Hardware‐Kompatibilität
Hardware‐Konfiguration
Hardwarerobotersteuerung
Hardware‐Schnittstelle
Hardwaresignal
Hardwaresignalspiel
Hardwaresignalspiel
Hardwarespiel
Hardwarestandardisierung
Hardware‐Steuerung
Hardwaresystemrücksetzen
Hardwaresystemrücksetzen
Hardwaresystemrücksetzen
Harmonic Drive
Harmonic‐Drive‐System
handling cycle, manipulation cycle
handling cycle
manipulation cycle
handling
handling
handling of mechanical components
handling by means of robots, manipulation by means of robots
handling of assembly parts
handling of assembly parts, manipulation of assembly parts
manipulation of assembly parts
handling of objects
handling of prism parts
handling of rotation parts
handling of pre‐assembled assemblies
handling requisition
manipulation arm
handling automaton
handling automation
handling aides
handling aids
handling object
handling operation
handling process, manipulation process
handling process data
handling robot
handling sequence
sequential handling
handling system
handling technique, manipulation technique
handling technique
manipulation technique
handling technique building block
handling technology
handling process
handling process, manipulation process
manipulation process
handler packet
hand assembly
hand assembly part
hand operation
manual closed‐loop control system
manual‐monitored control system
hand operation
manual control
manual setting
manual reset adjustment
hand operation
manual control
manual setting
hand control of following work
pendant gripper support
hardware
robot hardware, IR hardware
assembly robot hardware
hardware‐interrupt
hardware assembler
hardware failure
hardware area
hardware error
hardware fault
hardware identification
hardware compatibility
hardware configuration
hardware robot control
hardware interface
hardware signal
backlash of hardware signal
backlash of hradware signal
hardware backlash
hardware standardization
hardware control
backspace of hardware system, reset of hardware system
backspace of hardware system
reset of hardware system
harmonic drive
harmonic drive system
stran 120 od 326
EN ‐DE: slovar avtomatizacije in robotike Harmonie Drive
Harmonie‐Drive‐System
Harmonische
harmonische Analyse
harmonische Balance
harmonische Bewegung
Harmonische des Lasers
harmonische Komponenten
harmonische Linearisierung
harmonische Teilschwingungen
harmonische Zeitfunktion
harmonischer Analysator
harmonischer Analysator
harmonischer Eingriff
harmonischer Frequenzteiler
harmonischer Frequenzwandler
harmonischer Oszillator
harmonischer Synthetisator
harmonisches Filter
harmonisches Signalspektrum
Härtegrad
Härteprüfautomat
Härteprüfer
Härteprüfgerät
hartlöten (durch Roboter)
Häufigkeit von Roboterfehlern
Häufigkeitsfunktion
Häufigkeitsverhältnis
Häufigkeitswert
Haupt[fertigungs]prozess
Hauptachse
Hauptalgorithmus
Hauptanlage
Hauptantrieb
Hauptarbeitsraum eines IR
Hauptbaugruppe feines Industrieroboters
Hauptbewegungsachse
Haupteinheit
Hauptfertigungsprozess
Hauptgerät
Hauptgerät
Hauptgruppe
Hauptgruppensteuerung
Hauptkomponente
Hauptkontakt
Hauptkopplung
Hauptlaser
Hauptleitstand
Hauptleitstand
Hauptleitstand
Hauptleitstand
Hauptleitung
Hauptoption
Hauptperiode
Hauptprogramm für Montage
Hauptprozess
Hauptprozessor
Hauptrechner
Hauptregler
Hauptresonanz[stelle]
Hauptrückführung
Hauptrückkopplung
Hauptrücksetzsignal
Hauptschalter
Hauptschalter
Hauptschalttafel
Hauptschalttafel
Hauptschalttafel
Hauptschalttafel
Hauptschleife
Hauptspeicher
Hauptstufe
Hauptträgheitsachse
Haupttrennfuge
Hauptvergleicher
Hauptvergleichereinheit
harmonic drive
harmonic drive system
harmonics
harmonic analysis
harmonic balance
harmonic motion
laser harmonic
harmonic components
harmonic linearization
harmonic components
harmonic function of time
Fourier analyzer
harmonic analyzer
harmonic action
harmonic frequency converter
harmonic frequency converter
harmonic oscillator
harmonic synthesizer
harmonic filter
harmonic spectrum of signal
degree of hardness
hardness‐testing automaton
hardness tester
hardness tester
braze to, to hard‐solder (by robot)
robot error rate, fault rate of robot
frequency function
abundance ratio
frequency value
main [fabrication] process
principal axis
master algorithm
main plant
main gear
main working room of IR
robot main group of parts, industrial robot main group of part
main movement axis
master unit
main fabrication process, main process
master device
master
main group
intermediate control
main component
main contact
main coupling
main laser
central control board
central control desk
master control panel
main control board
main line
main option
major cycle
assembly main program, assembly master routine
main fabrication process, main process
main processor
master computer (of robot drive)
master controller
main resonance
major feedback
major feedback
master reset signal
main line switch
master controller
central control board
central control desk
master control panel
main control board
major loop
general store
main stage
principal axis of inertia
main expansion joint
main comparison unit
main comparison unit
stran 121 od 326
EN ‐DE: slovar avtomatizacije in robotike Hauptzyklus
Havarieschutz eines Roboters
heb‐ und senkbarer Arm
Hebeeinrichtung
Hebemagnet
heben (Werkstück)
Hebeverfahren
Hebezeug
Heimroboter
Heißleiter
Heizanlage
Heizdrahtmanometer
Heizenergiekreis
Heizsystem
Heizungsregler
Heizungsregler
Heizungsregler
Heizungstechnik
Heizwert
Heizwert
Helbleiterlaser mit schmalem Streifen
Helium‐Neon‐Laser
Helligkeitseinstellung
Helligkeitseinstellung
Helligkeitsregler
Helligkeitssteuerung
Herangehen
herkömmliches lineares System
hermetischer Verschluß elektronischer Apparaturen
Herstellbarkeit
Herstellen von Anfangsbedingungen
Herstellen von Anfangsbedingungen
Herstellungsgenauigkeit
Herstellungstechnik
Herstellungstechnologie
Herstellungstechnologie
Herstellungsverfahren
hervorheben
hervorheben
hervorholen
Herztaktgeber
Heterodynsignal
heterogenes Reaktormodell
heteropolare Bindung
heterostatische Schaltung
heterostatisches Messgerät
heuristische Eingabedaten pl
heuristische Entwurfsmethode
heuristische Lösungsmethode
heuristische Methoden
HF‐Generator
HF‐Generator
HF‐Generator
HHO
HHO‐Flachpalette
HHO‐Strom
Hierarchie
Hierarchiesystem
hierarchisch aufgebautes System
hierarchisch strukturierter Entwurf
hierarchische Struktur für Datenmanagements
hierarchisches Mehrrechnersystem
hierarchisches Mehrrechnersystem multiples
hierarchisches Unterbrechungssystem
high‐aktives Signal
High‐Logikpegel
Hilbert‐Transformation
Hilfsalgorithmus
Hilfsanlagenraum
Hilfsarbeitsmittelsystem
Hilfsausrüstung
Hilfsbrücke
Hilfsdampf[versorgungs]system
Hilfseinrichtung
Hilfsenergieregler
Hilfsfertigungsprozess
major cycle
average protection of robot
elevate and depress arm
lift [ing] device
lifting magnet
lift to (work piece)
lifting method
hoist
household robot
thermistor
heating plant
Pirani gauge
heater power circuit
heating system
heat controller
heating controller
thermoregulator
heat engineering
calorific value
heating value
narrow‐stripe semiconductor laser
helium‐neon laser
brightness control
luminance control
brightness controller
brightness control
approach
conventional linear system
hermetic sealing of electronic devices
manufacturability
initialization
initializing
accuracy of manufacture
manufacturing technique
production technology
manufacturing technique
fabricating technique
accentuate v
emphasize v
pop up v
pacemaker
heterodyne signal
heterogeneous reactor model
heteropolar bond
heterostatic circuit
heterostatic instrument
heuristic input data
heuristic design method
heuristic solution method
heuristic methods
high‐frequency generator
HF‐generator
radio‐frequency alternator
handling object
handling object flat pallet, HO‐flat pallet
stream of handling objects
hierarchy
hierarchical system
hierarchical system
hierarchically structured design
hierarchical structure for data managements
hierarchical multi‐computer system
hierarchical multicomputer system
priority interrupt system
high‐active signal
logic high level
Hilbert transform
auxiliary algorithm
auxiliary equipment compartment
auxiliary fluid system
auxiliary equipment
auxiliary bridge
auxiliary steam supply system
auxiliary device
indirect action controller
auxiliary [fabrication] process
stran 122 od 326
EN ‐DE: slovar avtomatizacije in robotike Hilfsfertigungsprozess
Hilfsgenerator
hilfsgesteuerter Regler
Hilfsgröße
Hilfskontakt für fotoelektrischen Sensor
Hilfskorrektor
Hilfskreislauf
Hilfsluftregler
Hilfsmittel
hilfsmittelorientierte Daten pl Hilfsoperation
Hilfsprozess
Hilfsprozess
Hilfsprozess
Hilfsprozessor
Hilfspumpe
Hilfsregelgröße auxiliaire
Hilfsregler
Hilfsroboter
Hilfsrückführung
Hilfsselektor
Hilfsspeicher
Hilfsspeicherplatz eines IR
Hilfssteuerfunktion
Hilfssteuersystem
Hilfssteuersystem
Hilfsstromkreis eines Roboters
Hilfsträgerfrequenz
Hilfsverabeitungssystem
hintere Impulsflanke
Hintereinanderschaltung
Hintereinanderschaltung
Hintergrunddaten pl
Hintergrundecho
Hintergrundprozessor
Hintergrundrauschpegel
Hintergrundsignal
Hintergrundstrahlungsmesser
Hintergrundverarbeitung
Hinweis
Hinweisregister
Hitzdrahtinstrument
hitzebeständiges Greifwerkzeug
Hitzmessstreifengerät
Hl Temperatursensor
hoch sensorisiertes Greifen Hochauflösungslidar
hochdichte Schaltungstechnik
Hochdruckanlage
Hochdruckförderung
Hochdruckprozess
Hochdruckstoß
Hochdrucktechnologie
Hochdruckverfahren
hochempfindlich
hochempfindliches Laserdetektionssystem
hochempfindliches Nachrichtensystem Hochfrequenz
Hochfrequenz
Hochfrequenzfernmeldeapparat
Hochfrequenzfernmesssystem
Hochfrequenzfilter
Hochfrequenzgenerator
Hochfrequenzgenerator
Hochfrequenzgenerator
Hochfrequenzinduktionsheizung
Hochfrequenzintervall
Hochfrequenzmesstechnik
Hochfrequenznachrichtenkanal
Hochfrequenzspektroskopie
Hochfrequenzverstärker
Hochfrequenzverzerrung
Hochgeschwindigkeitslogik
Hochgeschwindigkeitsroboter
Hochgeschwindigkeitsschaltkreis
Hochgeschwindigkeitsschaltung
auxiliary fabrication process
auxiliary generator
pilot‐operated controller
auxiliary quantity
auxiliary contact for photoelectric sensor
auxiliary corrector
auxiliary circuit
auxiliary air regulator
tool aids‐oriented data auxiliary operation
auxiliary [fabrication] process
auxiliary fabrication process
auxiliary process
companion processor, coprocessor, auxiliary processor
auxiliary pump
objective variable
auxiliary corrector
auxiliary robot
subsidiary feedback
auxiliary selector
auxiliary store
auxiliary storage location of IR
auxiliary control function
auxiliary control system
auxiliary control system, ACS
auxiliary circuit of robot
subcarrier frequency
auxiliary processing system
back pulse front
cascade connection
series connection
background data
background return
background computer
background‐noise level
background signal
background measurement radiometer
background processing
indication
pointer register
hot‐wire instrument
heat‐resistant gripper tool
hot‐strip instrument
temperature sensor
high‐sensorized grip
high‐definition lidar
high‐density circuit technique
high‐pressure facility
high‐pressure transport
high‐pressure process
high‐pressure pulse
high‐pressure technology
high‐pressure process
high‐sensitivity
high‐sensitive laser detection system
supersensitive communication system radio frequency
high frequency
high‐frequency remote signalling apparatus
high‐frequency telemetering system
high‐frequency filter
high‐frequency generator
HF‐generator
radio‐frequency alternator
high‐frequency induction heating
interval of high frequencies
high‐frequency measuring technique
high‐frequency communication channel
high‐frequency spectroscopy
high‐frequency amplifier
high‐frequency distortion
high‐speed logic
high‐speed robot
high‐speed circuit
high‐speed circuit
stran 123 od 326
EN ‐DE: slovar avtomatizacije in robotike Hochgewinnübergang
Hochleistungslaser
Hochleistungslaserstrahlung
Hochleistungssystem
hochohmiger Ausgang
Hochpass
Hochregal r
Hochregallager
hochselektiver Empfänger
Hochspannungsbeschleuniger
Höchstausschalter maximum
höchste Intensität
höchste Modulationsfrequenz
Höchstlastanzeiger m
Höchstleistung
höchstmögliche Belastung
Höchstwert
Höchstwert
Höchstwertoptimalregelung
Hochvoltbeschleuniger
hochwertiges Bauteil
hohe Arbeitsgeschwindigkeit
Höhe einer Zugehörigkeitsfunktion
hohe Integration
hohe Operationsgeschwindigkeit
hohe Operationsgeschwindigkeit
hohe Schaltgeschwindigkeit
Höheneinstellung
Höhenflossenverstellung Höhenmesser
Höhenparallaxe parallel access 466
Höhenpegel
Höhenregelung
hoher Automatisierungsgrad
hoher Flexibilitätsgrad
höhere geometrische Programmiersprache
höhere Harmonische
höhere Harmonische
höhere mathematische Routine
höhere Programmiersprache
höhere Roboteranforderung <
höhere Roboterprogrammiersprache
hohlkugelförmiger Arbeitsraum
Hohlraummagnetron
Hohlraumresonator
Hohlraumwellenmesser
homogene Differentialgleichung
homogene Differentialgleichung I. Ordnung
homogene Differentialgleichung II. Ordnung
homogener Automat
homogener Reaktor mit flüssigem Brennstoff
homogenes Gleichungssystem
homogenes System
homomorphes Modell
homomorphes System
homöopolare Leistung
Homostruktur
Homostrukturlaser
Hopkinsonscher Streufaktor
Horizontalablenkverstärker
horizontale Ablenkschaltung
horizontale Ablenkschaltung
horizontale Achse
horizontale Polarisation
horizontaler Greiferantrieb
horizontaler Roboterknickarm
Horizontalpolarisation
Hörsignal
Hörsignal
Hubkraft
Hubmagnet
Hubverfahren
Hubvermögen
Huffman‐Caldwell‐Verfahren
HURWITZ‐Kriterium
hybride Arbeitsweise
high‐gain transition
high‐energy laser
high‐power laser radiation
high‐performance system
high‐impedance output
high‐pass filter
high rack, high shelf
store of high rack, store of high shelf
single‐signal receiver
high‐voltage accelerator
maximum cut‐out
peak intensity
maximum modulation frequency
maximum demand indicator
maximum output
ultimate load
crest value
peak value
peak‐holding optimizing control
high‐voltage accelerator
high‐grade component
high‐speed operating speed
height of membership function
large‐scale integration
fast operation speed
high‐speed of operation
fast switching speed
height adjustment
tail plane adjustment height gauge
parallax in altitude
amplitude level
height control
high‐degree of automation
high flexibility degree
higher geometric programming language
overtone
higher harmonic
higher mathematical routine
high‐level programming language
higher robot demand
higher robot programming language
working zone in form of not‐low sphere, hollow spherical wor
cavity magnetron
cavity resonator
cavity wavemeter
homogeneous differential equation
first order homogeneous differential equation
second order homogeneous differential equation
homogeneous automaton
liquid fuel homogeneous reactor
homogeneous equation system
homogeneous system
homomorphic[al] model
homomorphic system
homopolar sequence power
homostructure
homostructure laser
Hopkinson's leakage coefficient
horizontal‐deflection amplifier
horizontal‐deflection circuit
horizontalscanning circuit
horizontal axis
horizontal polarization
horizontal gripper drive
horizontal buckling arm of robot
horizontal polarization
audio signal
sound signal
lifting force
lifting magnet
lifting method
lifting force
method of Huffman‐Caldwell (theory of automata)
Hurwitz's stability criterion
hybrid operation
stran 124 od 326
EN ‐DE: slovar avtomatizacije in robotike hybride Modelle
hybride Optimierung
hybride Rechnerstruktur
hybrider Umsetzer
hybrides Mehrkörpersystem (eines IR)
hybrides Programm
hybrides Radar‐ und Infrarotdetektionssystem
hybrides Rechnersystem
Hybridrechner
Hybridrechner mit Sensorsystem
Hybridrechnerkonsole
Hybridrechnerperipherie
Hybridschaltkreis
Hybridschaltkreis
Hybridschaltung
Hybridsystem (eines Industrieroboters)
Hybridtechnik
Hydratationsanlage
Hydratationsvorgang
Hydraulikzylinder
hydraulisch angetrieben
hydraulisch angetriebene Lineareinheit
hydraulische Analogie
hydraulische Digitalsteuerungen
hydraulische Fernübertragung
hydraulische Fühlersteuerung
hydraulische Greiferzange
hydraulische Integrieranlage
hydraulische Logik
hydraulische Regelsysteme
hydraulische Regelung
hydraulische Regelvorrichtung
hydraulische Regelvorrichtung
hydraulische Robotersteuerung (IR‐Steuerung)
hydraulische Roboterversion (Roboterausführung)
hydraulische Strahlrohrregelung
hydraulischer Antrieb
hydraulischer Antrieb
hydraulischer Differentialanalysator
hydraulischer Drehwinkelantrieb
hydraulischer Drehwinkelantrieb rotation
hydraulischer Industrieroboterantrieb (Roboterantrieb)
hydraulischer Integrator
hydraulischer Kreis
hydraulischer Positionierungsservomechanismus m
hydraulischer Regelkreis
hydraulischer Regler
hydraulischer Regler
hydraulischer Regler
hydraulischer Servomotor
hydraulischer Stellantrieb
hydraulischer Strahlstromregler
hydraulischer Verstärker
hydraulischer Wirkungsgrad
hydraulischer Zahnstangenantrieb
hydraulisches Antriebssystem
hydraulisch‐pneumatische Greifereinrichtung
hydraulisch‐pneumatischer Greifer
Hydrierprozess
hydrodynamischer Drehmomentwandler
hydroelektronische Programmsteuerung
hydropneumatisch
Hydroraffinationsanlage
hydrostatischer Antrieb
hyperbolische Funktion hyperbolic navigation 312
hyperbolische Geschwindigkeit
hyperbolische Navigation
hypergeometrische Wahrscheinlichkeit
Hypothese
Hysterese
Hysterese[schleifen]schreiber
Hysteresecharakteristik
Hystereseerscheinung
Hysteresefehler
Hysteresekonstante
Hysteresemesser
hybrid models
hybrid optimization
hybrid computer structure
hybrid converter
hybrid multi‐body system
hybrid program
hybrid radar‐infrared system
hybrid computer
hybrid computer
hybrid computer with sensor system
console of hybrid computer
periphery of hybrid computer
hybrid integrated circuit
hybrid IC
hybrid circuit
hybrid system (of industrial robot)
hybrid technique
hydration plant
hydration process
hydraulic cylinder
hydraulic‐driven
hydraulic‐operated linear unit
hydraulic analogy
hydraulic digital controls
hydraulic remote transmission
hydraulic tracer control
hydraulic gripper pincer
hydraulic differential analyzer
hydraulic logic
fluid systems
oil‐operated control
hydraulic controller
hydraulic regulator;
hydraulic robot control, hydraulic IR control
hydraulic robot version
jet‐pipe oil‐operated control
oil‐operated drive
hydraulic drive
hydraulic differential analyzer
hydraulic drive of rotation angle
hydraulic drive of rotation angle
hydraulic industrial robot drive
hydraulic integrator
hydraulic circuit
hydraulic positional servomechanism
hydraulic servosystem
hydraulic regulator
hydraulic controller
hydraulic regulator;
oil‐operated power cylinder
hydraulic actuator
jet‐pipe oil‐operated controller
hydraulic amplifier
hydraulic efficiency
hydraulic gear rack drive
hydraulic drive system
hydraulic‐pneumatic gripper (gripping device)
hydraulic‐pneumatic gripper (gripping device)
hydrogenation process
hydrodynamic torque transformer
hydroelectronic program control
hydropneumatic
hydrorefining plant
hydrostatic drive
hyperbolic function
hyperbolic velocity
hyperbolic navigation
hypergeometric[al] probability
hypothesis
hysteresis
hysteresigraph
hysteresis characteristic
hysteresis phenomenon
hysteresis error
hysteresis constant
hysteresis meter
stran 125 od 326
EN ‐DE: slovar avtomatizacije in robotike Hysteresemotor
Hysteresemotor mit Selbstanlauf
Hysteresenichtlinearität
Hystereseverluste
Hysteresismesser
Hysteresisschleife
ideal durchmischter Reaktor
ideale Theorie
Idealimpuls
idealisiertes System
Idealwert
Identifikation
Identifikation
Identifikation
Identifikation der Gerätetechnik
Identifikationsblock
Identifikationsprozedur
identifizierbar
identifizieren
Identifizieren von Objekten durch Sensoren
Identifizierer
Identifizierer
identifizierte Variable
identifiziertes Bauelement
identifiziertes Werkstück
identifiziertes Werkstück
Identifizierung von Regelstrecken
Identifizierungskennzeichen
Identifizierungskennzeichen
Identifizierungsmaschine
Identifizierungsmethode
Identifizierungsprüfung
Identifizierungsverfahren
identische Gleichung
identischer Geber
identischer Sensor (Geber)
Identität
Identitätsblock
idiostatische Schaltung
idiostatischer Stromkreis
I‐Element
I‐Element
I‐Glied
Ignitronregelung
imaginäre Polstellen
imaginärer Frequenzgang
Imaginärteil
Immersionsgewinn
Impedanz
Impedanzanpassung
Impedanzausgleichsglied
Impedanzausgleichsglied
Impedanzkomparator
Impedanzkorrektor
Impedanzmessung
Impedanzschutz
Impedanzsteuerung
Impedanzübertragung
Impedanzwandler
Impedanzwandler
imperativorientierte Sprache
implementierte Robotersprache
implementiertes Programmiersystem
Implementierung einer IR‐Steuerung
Implikation
Implikation nach Mamdani
Implikation nach Sugeno
Implikationsoperator
impliziert
impliziert
implizit
implizit
implizite Funktion
implizites Differenzenverfahren
Impuls
Impuls
hysteresis motor
self‐starting hysteresis motor
hysteresis non‐linearity
hysteresis losses
hysteresis meter
hysteresis cycle
perfectly mixed reactor
ideal theory
ideal pulse
idealized system
ideal value
identification (of objects)
estimation
identification
hardware identification
identification block
identification procedure
identifiable
identify v
sensor object identification
identifier
identification label
identified variable
identified component
identified identified work piece
controlled plant identification
identifier
identification label
recognizing machine
identification method
identification check
identification process
identical equation
identical sensor
identical sensor
identity
identity unit
idiostatic circuit
idiostatic circuit
integral element
integral‐element, I‐element
integrating element
ignitron control
imaginary poles
imaginary frequency response
imaginary part
immersion gain
impedance
impedance matching
impedance balancing block
impedance balancing unit
impedance comparator
impedance corrector
impedance measurement
impedance protection
impedance control
impedance transfer
impedance converter
impedance matching transformer
imperative‐oriented language
implemented robot language
implemented programming system
implementation of IR control
implication
Mamdani implication
Sugeno implication
implication operator
implicit
implied
implicit
implied
implicit function
implicit finite difference method
impulse
pulse
stran 126 od 326
EN ‐DE: slovar avtomatizacije in robotike Impulsabschwächer
Impulsabstand
Impulsabtastung
Impulsamplitudenanalyse
Impulsamplitudenanalyse
impulsamplitudenmodulierter Träger
Impulsamplitudenprüfer
Impulsannäherung
Impulsanstiegszeit
Impulsanstiegszeit
Impulsantwort
Impulsantwort
Impulsaufbereitung
Impulsauflösung
Impulsausgangsverstärker
Impulsbandbreite
Impulsbasis
Impulsbegrenzung
Impulsbelastung
Impulsbetrieb impulsion
impulsbetriebener Lidar
Impulsbreitenregelung
Impulsbündel
Impulsdach
Impulsdämpfungsglied
Impulsdauer
Impulsdauer
Impulsdiagramm
Impulsdifferentialanalysator
Impulsdifferenzzähler
Impulsdiskriminatorkreis
Impulselement
Impulsemission
Impulsentzerrer
Impulserneuerung
Impulsfernmesser
Impulsfernmessgerät
Impulsflanke
Impulsfolge
Impulsfolge mit positiven und negativen Impulsen
Impulsfolgefrequenz
Impulsfolgefrequenz
Impulsfolgefrequenz
Impulsform der Erregungsspannung
Impulsformung
Impulsfreigabe
Impulsfrequenzfernmessung
Impulsfunktion
Impulsfunktion
Impulsgabe
Impulsgabe
Impulsgabe
Impulsgenerator
Impulsgenerator mit gesteuerter Impulsverzögerung
impulsgesteuert
Impulsglied
Impulshöhenanalyse
Impulshöhenanalyse
Impulskode
Impulskode‐Fernmesssystem pulse‐controlled 518
Impulskorrektion
Impulskorrektor
Impulskorrektur
Impulskurve
Impulslaserschweißung
Impulsleitung
Impulslidar
Impulsmessverfahren
Impulsmodulator
impulsmoduliertes Infrarotsystem
Impulsmultiplikationsgerät
Impulsperiode
Impulsreflexionsprinzip
Impulsregenerationsschaltung
Impulsregler periodic duty 474
Impulsregler periodic duty 474
pulse attenuator
pulse interval
pulse sampling
amplitude analysis
pulse amplitude analyzing
pulse‐amplitude‐modulated carrier
pulse‐amplitude analyzer
impulse approximation
pulse rise time
pulse build‐up time
impulse response
pulse response
pulse refining
linear momentum resolution
impulse‐type output amplifier
pulse bandwidth
pulse base
pulse clipping
pulse loading
pulsed operation
pulsed lidar
pulse‐width control
pulse burst
horizontal part of pulse
pulse attenuator
duration of the impulse
impulse period
pulse diagram
pulse system differential analyzer
impulse differential counter
pulse discrimination circuit
impulse element
pulse emission
pulse equalizer
pulse restoration
impulse telemeter
pulse‐type telemeter
impulse front
impulse train
bidirectional pulses
impulse frequency
pulse recurrence rate
pulse‐recurrence frequence
exciting voltage pulse shape
pulse shaping
pulse enable
impulse‐frequency telemetering
impulse function
pulse function
beat[ing]
pulsing
pulsation
pulse generator
controlled delay pulse generator
pulse‐controlled
impulse element
amplitude analysis
pulse amplitude analyzing
impulse code
pulse‐code telemetering system
pulse correction
impulse corrector
pulse correction
pulse curve
pulsed laser welding
pulse line
pulsed lidar
pulse telemetering method
impulse‐type modulator
infrared pulse modulation system
impulse‐type multiplier (for analog systems)
impulse period
principle of impulse reflection
pulse regeneration circuit
periodic controller
sampled‐data controller
stran 127 od 326
EN ‐DE: slovar avtomatizacije in robotike Impulsschreiber
impulse recorder
Impulsschwellenenergie
pulse threshold energy
Impulssignal
impulse signal
Impulssignal
pulse signal
Impulssignalisieren
impulse signalling
Impulsspeicher
impulse accumulator
Impulsspeicher
impulse store
Impulsspektrograf
pulse spectrograph
Impulsspektrometrie
pulse spectrometry
peak pulse power
Impulsspitzenleistung
Impulsstabilisation
pulse stabilization
Impulsstabilisierung
pulse stabilization
Impulsstörung
pulse disturbance
Impulsstromkreis
impulse circuit
Impulssystem mit Extrapolatoren
pulse system with extrapolators
Impulssystem mit intermittierendem Signal der Regelabweicherror‐sampled control system
Impulssystem mit Verzögerung
pulse system with delay
Impulssystem mit Verzögerung
pulse system with lag time
Impulssystem mit Verzögerung
pulse system with retardation
Impulsträger
pulse carrier
Impulsübergangsfunktion
pulse step function
pulse dividing circuit
Impulsuntersetzerschaltung
Impulsverschachtelung
pulse interleaving
Impulsverstärker
pulse amplifier
Impulsverzerrung
pulse distortion
Impulsvorwahl
impulse preselection
Impulswiederholer
pulse repeater
Impulswiederholer
transponder
Impulszeitmodulation
pulse‐time modulation
in Betrieb
active, activated, ACT
in Betrieb
active
in Betrieb
activated
in der richtigen Reihenfolge
in sequence
in flexibles Programm für Roboter
flexible program for robot
in Robotern)
sensor
inaktiver Zustand
floating state
inaktiver Zustand
high‐impedance state
Inäquivalenzgatter n
EXCLUSIVE‐OR gate
Inäquivalenzgatter n
non‐equivalence gate
Inäquivalenzgatter n
modulo sum gate
inbegriffen
implicit
inbegriffen
implied
Inbetriebnahme
putting into operation
Inbetriebnahme
setting in operation
Inbetriebnahmegerät
starting device
Indeterminiertheit
indeterminacy
Indexgrenzenpaar
bound pair
Indexregister
base register
Indexregister
index accumulator
Indikatordiagramm
indicator diagram
Indikatorstromkreis
indicating circuit
indirect control supervision
index of quality
indirect control supervision
quality index
indirekt arbeitendes Registriergerät
indirect‐acting recording instrument
indirekt wirkender Regler
pilot‐operated controller
indirekt wirkendes System
indirect control system
indirekt wirkendes System
system with power amplification
indirekte Bearbeitung
offline operation
indirekte Kraftbestimmung
indirect force destination
indirekte Steuerung
indirect control
indirekte Steuerung
offline control
indirekte Steuerungsüberwachung
indirect control checking (supervision)
indirekte Steuerungsüberwachung
indirect control checking
indirekte Steuerungsüberwachung
indirect control supervision
indirect visual supervision
indirekte visuelle Überwachung
indirekter Antrieb
indirect drive
indirekter Regler
relay‐operated controller
individuelle Robotik
individual robotics
inductosyn (Wegmesssystem)
inductosyn
Induktanzmessbrücke mit Servoregelung
servo‐operated inductance bridge circuit
Induktionsdehnungsmessstreifen induction
inductance strain gauge
Induktionsdrehzahlgeber
induction tacho‐generator
Induktionsdurchflussmesser
induction flowmeter
Induktionsheizungswechselstromfrequenz induction
induction‐heating current frequency
Induktionsmotor
induction motor
Induktionsspannungsregler
induction voltage regulator
stran 128 od 326
EN ‐DE: slovar avtomatizacije in robotike Induktionsspule
Induktionswaage
Induktionswächter des Flüssigkeitsdurchflusses
induktive Implikation
induktive Kopplung
induktive Kopplung
induktive Kopplung
induktiver Abgriff
induktiver Potentialteiler
induktiver Sensor (eines Roboters)
induktives Heizgerät
Induktivität
Induktivität
induktivkapazitive Verzögerungslinie
Induktosynmaßstab
industriebereichsbezogene Robotereinrichtung
Industrieforschung
industriell nutzbare Stromquelle
industriell nutzbarer Geber
industriell nutzbarer Sensor
industrielle Automatisierung
industrielle Elektronik
industrielle Fernsignalisierung
industrielle Großserienrobotermontage
industrielle Handhabetechnik
industrielle Handhabung
industrielle Interfacekarte
industrielle Kleinserienrobotermontage
industrielle Manipulatoranwendung
industrielle Roboteranwendung
industrielle Robotermontage
industrielles Erfassungsterminal
industrielles Fernmesssystem
industrielles modulares Kontrollsystem
industrielles Steuerungssystem
Industriemanipulatorinstallierung
Industriemesszentrale
Industrienorm
Industrienorm
Industrieökologie
Industrieproduktion
Industrieprozesssteuerung
Industrieroboter
Industrieroboter
Industrieroboter für Einlegeoperationen
Industrieroboter für Lötarbeiten
Industrieroboter für Montageoperationen
Industrieroboter‐ Hardwarelösung
Industrieroboter zum Nieten
Industrieroboterantriebsart
Industrieroboteranwender
Industrieroboterbahnelemente
Industrieroboterbaukasten
Industrieroboterbaukasten zur Montagerealisierung
Industrieroboterbefehl
Industrierobotereinsatz
Industrieroboterelement
industrierobotergebundene Einrichtung
industrierobotergebundenes Werkzeug
Industrierobotergreifer
Industrieroboterinstallation
Industrieroboterinstallierung
Industrieroboterkonstruktion
Industrieroboterkoordinaten
Industrierobotermarkt
Industrierobotermontagekopf
Industrieroboterregler
Industrieroboterregler
Industrierobotersteuerung r"
Industrieroboterstudie
Industrierobotertechnik
Industrierobotertechnik
Industrierobotertechnik
Industrierobotertrajektorie
Industrieroboterzentrum
Industriestandard
variable inductor
induction balance
induction guard of liquid flow
inductive implication
induction coupling
inductive coupling
magnetic coupling
inductive pick‐off
inductance potential divider
inductive sensor (of robot)
induction heater
inductance
inductor
inductance‐capacitance delay line
inductosyn scale
robots installation related to industrial sector
industrial research
industrially usable power source
industrially usable indicator
industrially usable sensor
industrial automation
industrial electronics
industrial remote signalling
industrial large series robot assembly
industrial handling technique
industrial handling
industrial interface card
industrial small series robot assembly
industrial application of manipulators
industrial application of robots, industrial robot application
industrial robot assembly
industrial acquisition terminal
industrial telemetering system
industrial modular check system
industrial control system
installation of industrial manipulator
industrial control centre
industry specifications
industry standard
industrial ecology
industrial production
industrial process control
[industrial] robot
robot, industrial robot, IR
loading robot, inserting robot
soldering robot
mounting robot, assemblage robot, industrial robot for mount
[industrial] robot hardware solution
rivet robot
robot kind of drive, IR kind of drive
robot user, industrial robot user
path elements of industrial robot
robot building‐block, industrial robot assembly unit
robot assembly unit for assembly realization, industrial robot robot command, industrial robot command
robots application, industrial robots application
element of industrial robot
robot‐attached device, industrial robot‐attached device
robot‐attached tool, industrial robot attached tool
robot gripper, industrial robot gripper
robot installation, industrial robot installation
installation of industrial robots
robot construction, industrial robot construction
robot coordinates, industrial robot coordinates
robot market, industrial robot market, IR market
assembly head of industrial robot
[industrial] robot regulator
robot regulator, industrial robot regulator
robot control, industrial robot control
robot study, industrial robot study
robotics, industrial robot[s] technique
robotics
industrial robot[s] technique
robot movement path, robot trajectory, industrial robot trajec
robot centre, industrial robot centre
industry specifications
stran 129 od 326
EN ‐DE: slovar avtomatizacije in robotike Industriestandard
induzierte Arbeit
Inegraldarstellung
Inertgasanlage
Inertgaskreislauf
Inertisierung
infinit
Information
Information eines Roboterbildes
Informations‐ und Steuerungssystem
Informationsaufbau
Informationsaufnahme
Informationsaufzeichnung feines Industrieroboters
Informationsaustausch
Informationsauswahl
Informationsbit
Informationsbit
Informationsdarstellung
Informationsdarstellungslasersystem
Informationsdichte
Informationsdichte
Informationselektronik Informationselektronik feines Roboters
Informationserfassungsfläche
Informationserfassungssensor
Informationserschließung
Informationsextraktion
Informationsfangregister
Informationsfluss
Informationsfluss eines Industrieroboters
Informationsformat
Informationsgewinnung
Informationsinhalt
Informationskanal
Informationskodierungsniveaus
Informationskontrolle
Informationskreis
Informationsmanagementsystem
Informationsmenge
Informationsparameter
Informationsquelle
Informationssender
Informationssignal
Informationsspektrum
Informationsstrom
Informationssystem
Informationssystemplanung
Informationstechnik
informationstechnische Kopplung eines Maschinensystems
Informationstechnologie
Informationsterminal
Informationsträger
Informationsträgerdiskette
Informationsträgerkassette
Informationsübertragung
Informationsübertragung
Informationsübertragung
Informationsübertragungsgeschwindigkeit
Informationsübertragungsroboter
Informationsverarbeitung
Informationsverarbeitung Informationsverarbeitung feines Industrieroboters
Informationsverarbeitungssystem
Informationsverarbeitungstheorie
Informationsverlust
Informationsverlust
Informationswahrnehmungssystem
Informationswahrnehmungssystem informations
Informationszyklus
informatisiertes Steuersystem
Infrarotanlage
infrarotempfindliches Element
infraroter dispersionsloser Gasprüfer dispersion
infrarotes Abbildungssystem
infrarotes Abstandsmesssystem
infrarotes Analysiergerät für Gase
industry standard
indicated work
integral representation
inert gas plant
inert gas circuit
rendering inert
infinite
information
robot image information
information and control system
information build‐up
information reception
robot information recording
information exchange
information selection
information unit
information bit
information representation
laser information display system
information density
packing density
robot information electronics
robot information electronics
information acquisition surface
information acquisition sensor
information retrieval
information extraction
latch register
flow of information
robot information flux, industrial robot information flux
information format
information winning
information content
information channel
information coding levels
information checking
information circuit
information management system
information quantity
information parameter
message source
information transmitter
information signal
information pattern
information flow
information system
information system planning
information engineering
information‐technical coupling of machine system
information technology
information terminal
information carrier
information carrier disk, data carrier disk
information carrier cartridge (casket), magnetic tape casket
data transfering
information transmission
information transfer
information transmission rate
information transmission robot
information processing
robot information processing
robot information processing, IR information processing
information processing system
information processing theory
data dump
information loss
information perceptive system
information perceptive system
information cycle
informatized control system
infrared equipment
infrared sensing element
non‐dispersion infrared gas analyzer
image‐forming infrared system
range‐measurement infrared system
infrared analyzer of gases
stran 130 od 326
EN ‐DE: slovar avtomatizacije in robotike infrarotes Entfernungsmesssystem
Infrarotgasanalysator
Infrarotmodulation
Infrarotsensor
Infrarotsignalentropie
Infrarotspektrometerdetektor
infrarotspektroskopische Probenuntersuchung
Infrarotstrahlenabtastgerät
Infrarotstrahlendetektortechnik
Infrarotstrahlennachlaufregistriergerät
Infrarotstrahlennachlaufsystem
Infrarotstrahlenüberwachungssystem
Infrarotstrahlenverbindung
Infrarotstrahlungsabsorption
Infrarotstrahlungsauffindung
Infrarotstrahlungserfassung
Infrarotstrahlungsvermögen
Infrarotsystem
Infrarotziellenkung
Infrarotzielsuchsystem
Infraschallfrequenz
ingenieurtechnische Arbeitsmethode
inhaltsadressierbarer Datenspeicher
inhaltsadressierbarer Speicher/n
inhomogene Gleichung
inhomogene Gleichung
inhomogenes Magnetfeld
inhomogenes Magnetfeld
Initialisieren
Initialisieren
Initialisierung
Initialisierung
Initialprogrammierung
Injektionsimpulslaser
Injektionskontakt
Inklusion
Inklusion
inkohärent
Inkohärenz
Inkompatibilität
inkrementale digitale Steuerung
inkrementaler Winkelsensor
Inkrementalgeber
Inkrementalgeber
Inkrementalregelung
inkrementelle digitale Steuerung
inkrementeller Geber
inkrementeller Winkelsensor
Inkrementrechner
Inkrementvektor
Innenschleife
Innenzustand
innere Ausbeute
innere Energie
innere Kinetik
innere Leerlaufzeit
innere Regelung
innere Roboterinformation
innere Rückkopplung
innerer Fotoeffekt
innerer Fotoeffekt
innerer lichtelektrischer Effekt
innerer Manipulatorzustand
innerer Stromkreis
inneres Element des Systems
inneres Modell
Inphasedetektion
Inphasedetektor
Insruktionsfeld
instabiler Gleichgewichtspunkt instabiler Knotenpunkt instabiler Zustand
instabiler Zustand
instabiles System
instabiles System Instabilität
range‐measurement infrared system
infrared gas analyzer
infrared modulation
infrared sensor
infrared signal entropy
infrared spectrometer detector
infrared spectroscopic examination of samples
infrared scanning device
optical detector technology
recording infrared tracking instrument
tracking infrared system
infrared surveillance system
infrared communication equipment
absorption of infrared radiation
infrared radiation detecting system
infrared radiation detecting system
infrared emissing ability
infrared equipment
infrared homing action
infrared search system
infrasonic frequency
engineering working method
contents addressable data store
contents addressable memory, CAM
heterogeneous equation
inhomogeneous equation
inhomogeneous magnetic field
nonhomogeneous magnetic field
initialization
initializing
initialization
initializing
initial programming
pulsed injection laser
injection contact
inclusion
inclusion relation
incoherent
incoherence
incompatibility
incremental digital control
incremental angle sensor
incremental indicator
incremental sensor
incremental control
incremental digital control
incremental indicator (sensor)
incremental angle sensor
incremental computer
incremental vector
inner loop
internal state
internal operating ratio
internal energy
intrinsic kinetics
internal idle time
internal control
inner robot information
inherent feedback
internal photoelectric effect
photoconductive effect
photoconductive effect
internal manipulator state
internal circuit
internal element of the system
internal model
inphase amplitude detection
inphase detector
instruction array
unstable equilibrium point unstable nodal point instable state
unstable state
unstable system
unstable system inconstancy
stran 131 od 326
EN ‐DE: slovar avtomatizacije in robotike Instabilitätsbereich
installation installieren
installieren
installierter Roboter
Installierung
instand halten
Instandhaltungseinrichtungen
Instandhaltungseinrichtungen
Instandhaltungsfehler
Instandhaltungsperiode
Instandhaltungsprozess
Instandhaltungszeit
Instruktion
Instruktion
Instruktionsformierung
Instrument Instrument mit gegenwirkendem Gewicht
Instrument mit Nulleinstellung
Instrument mit unmittelbarer Ablesung
Instrumentenfehler
Instrumententisch
Instrumententisch
Instrumententisch
Instrumententisch
Intaktheit
Integralbeziehung
integrale Bewertung
integrales Qualitätskriterium
Integralformel
Integralgröße
Integralkennlinie
Integralkennwert der Güte
Integralkomponente
Integralmethode
Integralnebenbedingung
Integralregler
Integralregler
Integralregler
Integralregler
Integralrelais
Integralrelais
Integraltransformation
Integralverfahren
integralwirkende Regelung
Integralwirkung
Integralwirkung
Integralwirkung
Integralwirkungskoeffizient
Integralwirkungsmaß
Integration
Integration von Bauelementen
Integrationsbereich
Integrations‐Differentiations‐Netzwerk
Integrations‐Differentiations‐Netzwerk
Integrationseingang
Integrationsglied
Integrationsgrad
Integrationsgrenzen
Integrationskonstante
Integrationskonstante
Integrationsregelung
Integrationssatz
Integrationsschritt
Integrationsweg
Integrator
Integrator mit parametrischer Fehlerkompensation
Integrierbeiwert
integrieren
integrierender Bestandteil
integrierender Frequenzmesser
integrierender Frequenzmesser
integrierender Zählkreis
integrierendes Verhalten
Integrierer
Integriergliedeinführung
instability region
auxiliary [electrical] system
install v
setup v
installed robot
installation
maintain v
maintenance equipment
servicing equipment
maintenance error
maintenance period
maintenance process
maintenance time
instruction
command
instruction forming
tool gravity‐controlled instrument
null instrument
direct reading instrument
instrumental error
instrument table
test stand
test board
test table
sanity
integral dependence
integral estimation
integral performance criterion
integral formula
reset component
integral characteristic
integral performance index
floating component
integral method
integral constraint
astatic controller
integral controller
floating‐action controller
reset controller
averaging relay
integrating relay
integral transformation
integral method
integral control
floating action
integral action
I‐action
integral action coefficient
integral action rate
integration
component integration
limits of integration
integro‐differentiating network
lead‐lag network
integrating input
integrating element
degree of integration
limits of integration
integration constant
constant of integration
single‐speed floating control
integration theorem
integration step
integration path
integrator
bootstrap integrator
integration constant
integrate v
integrating part (of a system)
integrating frequency meter
master frequency meter
integrating counter circuit
integral action
integrator
integrating circuit introduction
stran 132 od 326
EN ‐DE: slovar avtomatizacije in robotike Integriernetzwerk
integrating network
Integriernetzwerk
integral circuit
integrierte Automatisierung
integrated automation
integrierte Automatisierung
complex automati[zati]on
integrierte Datenverarbeitung
integrated data processing
integrierte Elektronik
integrated electronics
integrierte Mikrowellenschaltung
microwave integrated circuit
integrierte optische Schaltung
integrated optical circuit
integrierte optische Schaltung auf der Basis von Laserverstärklaser amplifier based integrated optical circuit
integrierte Schaltung
integrated circuit
integrierte Schaltung
IC
integrierte Schaltung mit mehrfachen Funktionen
multifunction integrated circuit
integrierte Steuerung
integrated control
integrierter Baustein
integrated component
integrierter Berührungssensor
integrated contact sensor
integrierter Einchiprechner
integrated single‐chip computer
integrierter Ein‐Chip‐Rechner
integrated single‐chip computer
integrierter Industrieroboter
integrated industrial robot
integrierter Kraftsensor
integrated force sensor
integrierter Lagesensor
integrated position sensor
integrierter Manipulator
integrated manipulator
integrierter Näherungssensor
integrated approximation sensor
integrierter optischer Richtkoppler
integrated optical directional coupler
integrierter optischer Spektrumanalysator
integrated optical spectrum analyzer
integrierter Strom
current‐time integral
integrierter Teil
integrating part (of a system)
integriertes Abbildungssystem
integrated image system
integriertes Abbildunssystem
integrated image system
integriertes Bauteil
integrated component
integriertes Datenverarbeitungszentrum
integrated data processing
integriertes grafisches Mikrosystem
integrated graphic micro system
integriertes grafisches Mikrosystem
integrated graphic microsystem
integriertes Handhabungssystem
integrated manipulation system
integriertes Informationssystem
integrated information system
integriertes Programmiersystem
integrated programming system
integriertes Robotersystem
integrated robot system
integral time constant
Integrierzeitkonstante
integral time constant, constant of integrator
Integrierzeitkonstante
time constant of integrator
Integrierzeitkonstante
intelligente Kamera
intelligent camera
intelligente Robotersteuerung intelligent robot control
intelligente Robotik (Robotertechnik)
intelligent robotics
intelligent sensorics
intelligente Sensorik
intelligente Sensorik (Sensortechnik)
intelligent sensorics
intelligent sensorics
intelligente Sensortechnik
intelligente Tastatur
intelligent keyboard
intelligenter Greifer
intelligent gripper
intelligenter Roboter
intelligent robot
intelligenter Sensor
intelligent sensor
intelligent device
intelligentes Gerät
intelligentes Laufzeitsystem eines Roboters
intelligent transit time system of robot
intelligentes Messsystem
intelligent measuring system
intelligentes Robotersystem
intelligent robot system
intelligentes Schweißen
intelligent welding
intelligentes Sensorsichtsystem
intelligent sensor visual system
Intelligenz feines Roboters
robot intelligence
Intensitätsfernmesssystem
intensity telemetering system
Intensitätsmaximum
intensity maximum
Intensitätsmodulation
intensity modulation
Intensitätsmodulator
intensity modulator
Intensitätsrückgang
decrease of intensity
interaktive grafische Technik
interactive graphical technique
interaktive Komponente
interactive component
interaktives Programm
interactive program
interaktives System
interactive system
interaktives Terminal
interactive terminal
Interface
interface
Interface eines Roboters
robot interface
Interfaceadapter für asynchrone Kommunikation
asynchronous communications interface adapter, AC1A
Interfaceadapter für asynchrone Kommunikation
asynchronous communications interface adapter
Interfaceadapter für asynchrone Kommunikation
ACIA
Interfacebedingung
interface condition
Interface‐Elektronik
interface electronics
Interfacekarte
interface card
Interface‐Signalfolge
interface signal sequence
Interface‐Standard
interface standard
stran 133 od 326
EN ‐DE: slovar avtomatizacije in robotike Interface‐Zeitteilung
interferentielle Wellenlänge
Interferenz
Interferenzeffekt
Interferenzkomparator
Interferenzlinien zur Materialspannungsmessung
Interferenzmikroskop
Interferenzmuster im Fernfeld
Interferenzrauschen
Interferenzrefraktometer
Interferenzwellenmesser
Interferometrie
interferometrische Kontrolle
interferometrische Messung
interferometrischer Modulator
interferometrischer Sensor
interferometrisches System
intermittierend auftretende Störung
interne Bildsteuerung
interne Logik
interne‐externe Charakteristik
interner Bus
interner Geber (Sensor)
interner Programmspeicher
interner Robotersensor
interner Roboterzustand
interner Steuerspeicher
internes Umweltmodell
Interpolation
Interpolation der Roboterbahnsegmente
Interpolationsparameter eines IR‐Programms
Interpolationsverfahren
Interpolationsverfahren für Raumbahn
Interpolatiosfunktion
Interpolator
interpolieren
interpolierte Robotertrajektorie
interpoliertes geradliniges Bahnsegment
Interpretationsmethode
Interpreter
Interpreter einer Robotersoftware
Interpreter eines Roboterprogramms
interpretieren
interpretierende Simulation
interpretierendes Organ
interpretierendes Programm
Interpretierungsniveau
Interrupt
Interrupt
Interrupt
Interruptanforderungs‐ Synchronisierungsregister
Interruptanforderungs‐Rücksetzsignal
Interruptauslösung
Interruptbestätigengssignal
interruptbetriebene Systemumgebung
interruptgesteuerter Mikroprozessor
interruptgesteuerter Mikroprozessor interruption
interruptgesteuertes System
Interruptkanal
Interruptkennung
Interruptprioritätsstaffelung durch Hardware
Interruptquelle
Interruptquellenblockierung
Interruptserviceroutine Unterbrechungsserviceroutine
Interruptsignal
Interruptsignal
Interruptsteuereinheit
Interruptsteuerungsgerät
Interruptvektor
Interruptvektormodifikation
Interruptvorrangsystem
Intervall
Intrittfallen
invariabel
invariant
Invariantenbildung
interface timing
interference wavelength
interference effect
interference effect
interference comparator
interference lines for measuring material strain
interference microscope
far‐field interference pattern
interference noise
interference refractometer
heterodyne wavemeter
interferometry
interferometric control
interferometric measurement
interferometric modulator
interferometric sensor
interferometric system
intermittent fault
internal picture control
internal logic
intern‐extern characteristic
internal bus
internal sensor
internal program memory
internal robot sensor
internal robot state
intern control memory (store)
internal environmental model
interpolation
interpolation of robot path segments
interpolation parameter of IR‐program
interpolation procedure
interpolation procedure for space path
interpolating function
interpolator
interpolate v
interpolated robot trajectory
interpolated rectilinear path segment
interpretation method
interpreter
interpreter of robot software
program interpreter. interpreter of robot program
interpret v
interpretative simulation
interpreter
interpreting routine
level of interpretation
interruption
break[ing]
abort
interrupt request synchronization register
interrupt request reset signal
interrupt tripping
interrupt acknowledge signal
interrupt‐driven environment
interrupt‐controlled microprocessor
interrupt‐controlled microprocessor
interrupt‐driven system
interrupt channel
interrupt identification
hardware priority interrupts
interrupt source
interrupt disarm
interrupt service routine
interrupt[ing] signal
break signal
interrupt control unit
interrupt controller
interrupt vector
interrupt vector modification
interrupt priority system
interval
coming into step
invariable
invariant
concept formation
stran 134 od 326
EN ‐DE: slovar avtomatizacije in robotike invariantes Regelsystem
Invarianz
Invarianzprinzip
Inverse einer Matrix
inverse Fourier‐Transformation
inverse Funktion
inverse LAPLACE‐Transformation
inverse Roboterfunktion
inverse Roboterproblemtechnik
inverse Übertragungsfunktion
inverse Übertragungsfunktion
inverses Element
inverses Element der Addition
inverses Manipulatormodell
inverses Robotermodell
Inversion
Inversionsmethode
Inversionspegel
Inversionsstruktur
Invertentfernungsmesser
Invertentfernungsmesser
Inverterstufe
invertibler Automat
invertieren
invertierende Schaltung
Invertierung
Ionenrelais
Ionenrelais
Ionenrelais
IR
IR‐Anschluss
IR‐Ausgabekanal
IR‐Basis
IR‐Bussteuerung
I‐Regelung
I‐Regler
IR‐Elektronik
IR‐Fehlersignal
IR‐Folgesteuerung
IR‐Generation
IR‐Greiferführung
IR‐Greifertyp
IR‐Hardware
IR‐Hardwarelösung
IR‐Kennzeichnung
IR‐Komplexibilität
IR‐Koordinaten
IR‐Layout
IR‐Objektmasse
IR‐Operationskette
IR‐Peripherie
IR‐Positioniereinrichtung
IR‐Programm
IR‐Programmsystem
IR‐Prozessinformation
IR‐Rechnersteuerung
irreduzibles System
irregulär
irreparabel
irreparabel
IR‐Schrittmotor
IR‐Sensorsystem
IR‐Software
IR‐Speicher
IR‐Speichereinrichtung
IR‐Struktur
IR‐Tragfähigkeit
IR‐Typ
IR‐Wartung
IR‐Zyklus
Isochromate
Isochronbereich
Isodromglied
isoelektronische Reihe
Isolationsmesser
Isolationsprüfer
invariant control system
invariance
invariance principe
inverse matrix
inverse Fourier transform
inverse function
inverse LAPLACE transform
inverse robot function
inverse problem technique of robot
inverse transfer function
return transfer function
inverse element
additive inverse
inverse manipulator model
inverse robot model
inversion
reversal method
inversion level
inverse structure
inverse relation telemeter
inversion telemeter
inverter stage
invertible automaton
invert v
inverting circuit
inversion
gas‐discharge relay
gas‐filled relay
ionic relay
robot, industrial robot, IR
robot connection, IR connection
robot output channel, IR output channel
robot base, IR base
robot bus control, IR bus control
integral control
integral controller
robot electronics, industrial robot electronics
robot error signal, industrial robot error signal
robot sequential control
robot generation, industrial robot generation
robot gripper guide, industrial robot gripper guide
robot gripper type, industrial robot gripper type
robot hardware, IR hardware
robot hardware solution, industrial robot hardware solution
robot marking, industrial robot marking
robot complexibility, IR complexibiiity
robot coordinates, industrial robot coordinates
layout of an industrial robot
robot object mass, industrial robot object mass
robot operation chain, IR‐operation chain
robot periphery, IR periphery
robot positioning device, industrial robot positioning device
robot program, industrial robot program
robot program system, industrial robot program system
robot process information, IR process information
robot computer control
irreducible system
irregular
irrecoverable
unrecoverable
robot stepping motor
robot sensor system
robot software, IR software
robot memory, robot store, IR memory, IR store
robot storage device, industrial robot storage device
robot structure, industrial robot structure
robot load‐carrying capacity, industrial robot load‐carrying ca
robot type, industrial robot type
robot servicing, robot maintenance, IR servicing, robots servic
robot cycle, IR cycle
isochromate
isochrone region
PI‐element
isoelectronic row
insulation meter
insulation testing unit
stran 135 od 326
EN ‐DE: slovar avtomatizacije in robotike isolieren
isolieren
Isoliermaterial
Isomorphismus
isoperimetrisches Problem
Ist‐Bahn feines IR
Ist‐Bewegungsbahn
Ist‐Leistung
Ist‐Menge
Ist‐Muster [einer Objekterkennung]
Ist‐Muster einer Objekterkennung
Ist‐Position
Istwert
Istwert
Istwert
Istwert der Regelgröße
Ist‐Wertgeber
Ist‐Wertvergleich
Istwert‐Vergleich
IT‐Element
Iteration
Iterationsvariable
Iterationsverfahren
Iterationsverfahren
Iterationsverfahren
Iterationszyklus
iterativ
iterativ arbeitender Analogrechner
iterativ arbeitender Analogrechner
iterative Berechnung
iterative Dekomposition
iterative Entwurf
iterative Greiferanalyse (Analyse eines Greifers)
iterative Lösung
iterative Simulation
iterative Technik
iteratives Addieren
Iterator
I‐Verhalten
I‐Wirkung
I‐Wirkung
I‐Zustandsregelung
I‐Zustandsregelung
J japanischer Roboter
japanische Standardelemente
joborientiertes Terminal
Job‐Scheduler
Jobschritt
Jobschrittaufgabe
Jobstrom
Jobverwaltung
Jobverwaltung
Joule‐Effekt
Justageoperation
Justageroboter
Justiereinrichtung
justieren
justieren
justieren
justieren
Justierschiene
Justierung
Justierung
Justierungsanforderungen
Kabelverteilsystem
Käfigrelais
kalibrieren
kalibrieren
kalorimetrischer Gasspurenanalysator
Kälteextraktionsverfahren
Kältefraktionierungsverfahren
Kältekaskade
Kaltverformung
insulate v
isolate v
insulator material
isomorphism (of automata)
isoperimetric problem
actual path of IR
actual movement path
actual output
actual quantity
actual design [of object identification]
actual design of object identification
actual position
actual value
real value
desired value
actual value of controlled variable
actual value transmitter
actual value comparison
actual value comparison
I‐element with first order lag, integral‐element with first order lag
iteration
iteration variable
iteration method
method of successive approximation
iteration procedure
iteration cycle
iterative
iterative analog computer
iterative analogue computer
iterative computation
iterative decomposition
iterative design
iterative analysis of gripper
iterative solution
iterative simulation
iterative technique
iterative addition
iterator
integral action
integral action
I‐action
I‐control with state feedback, integral‐control with state feedback
I‐integral‐control with state feedback, integral‐control with state feedback
Japanese robot
Japanese standard elements
job‐oriented terminal
job scheduler
job step
job‐step task
job stream
job management
job control
Joulean effect
adjusting operation
adjustment robot
adjuster
adjust v
align v
tune v
trim v
aligner bar
adjustment
adjusting
alignment requirements
cable distribution system
cage relay
gauge v
calibrate v
calorimetric gas‐traces analyzer
cryogenic extraction process
cryogenic fractionation process
cascade refrigeration system
cold deformation
stran 136 od 326
EN ‐DE: slovar avtomatizacije in robotike Kamerabild
Kamerainformation
Kamerainstallation
Kammfilter
Kanal
Kanal für analoge Signale
Kanalabstand
Kanalabstand
Kanaladapter
Kanaladresse
Kanaladress‐Register
Kanaladresswort
Kanalaktivität
Kanalbefehlswort
Kanalbildung
Kanalbreite
Kanalbyte
Kanaldatenprüfung
Kanal‐Eingabe‐Ausgabegerät
Kanalfehlerroutine
Kanalfehlerroutine
Kanalfilter
kanalgeführte Struktur
Kanalkapazität
Kanalkapazität
Kanalkodierung
Kanalkommandoeingabe
Kanalkommandoregister
Kanalkonstruktion
Kanalsteuereinheit
Kanalsteuereinheit
Kanalsteuerroutine
Kanalsteuerung
Kanalübertragungskapazität
Kanalwähler
Kanalzuverlässigkeit
kann nicht (Bewegung
kanonische Form
kanonische Gleichung
kanonische Transformation
kanonische Verteilung
Kapazität
Kapazität der Fernwirksysteme
Kapazität eines Schwingkreises
Kapazitätsänderung
Kapazitätsasymmetrie
Kapazitätsbelastungsfeinplanung
Kapazitätsfaktor
Kapazitätsfühler
kapazitätsgesteuert
Kapazitätsgrenze
Kapazitätskopplung
Kapazitätskopplung
Kapazitätsmanometer capacity of an oscillating circuit 106
Kapazitätsmessbrücke
Kapazitätsmesser
Kapazitätsmikromanometer
Kapazitätsrelais
Kapazitätsübertrager
Kapazitätsübertrager
Kapazitätsumformer
Kapazitätsumformer
Kapazitätswert
kapazitive Belastung
kapazitive Dehnungsmessstreifen
kapazitive Kopplung
kapazitive Kopplung
kapazitive Last
kapazitive Messzelle
kapazitiver Analog‐Digital‐Wandler
kapazitiver Höhenmesser
kapazitiver Niveaumesser
kapazitiver Robotersensor
kapazitiver Sensor
kapazitives Altimeter
Kapillardruck
camera image
camera information
camera installation
comb filter
channel
analog channel
channel separation
channel spacing
channel adapter
channel address
channel address register
channel address word, CAW
channel activity
channel command word
channelling
channel width
channel byte
channel data check[ing]
channel input‐output device
channel check handler
channel error routine
channel filter
channel‐guide structure
channel [transmission] capacity
channel capacity
channel coding
channel command entry, CCE
channel command register, CCR
channel design
channel control unit
channel control unit, CCU
channel control routine, CC R
channel control
channel [transmission] capacity
pluggable telephone channel selector
channel reliability
unable to learn (ro move, to change, … etc.) canonical form
canonical equation
canonical transformation
canonical distribution
capacity
capacity of remote‐control systems
capacity of an oscillating circuit
capacity change
capacity unbalance
capacity‐loading fine planning
capacity factor
capacity‐type sensing element
capacitance‐operated
capacity limit
capacitive coupling
capacity coupling
capacity manometer
capacity bridge
capacitance meter
capacity‐type micromanometer
capacity relay
capacitive transducer
capacity pick‐up
capacitive transducer
capacity pick‐up
capacity value
capacitance load
capacitance strain gauge
capacitive coupling
capacity coupling
capacitance load
capacitive measuring cell
capacity‐type analog‐to‐digital converter
capacity altimeter
capacitive level gauge
capacitive robot sensor
capacitive sensor
capacity altimeter
capillary pressure
stran 137 od 326
EN ‐DE: slovar avtomatizacije in robotike Kapillardurchflussmesser
Kapillarelektrometer
Kapillarsystem
Kapillarviskosimeter
Karnaugh‐Karte
Karnaugh‐Plan
Karte für Robotersteuerung
Karte mit vokaler Ein‐ und Ausgabe
Kartenfehler
Kartenkode
kartesische Roboter
kartesischer Arbeitsraum
kartesisches Standardkoordinatensystem
Kaskaden
kaskadenartig geschaltete Stufen
Kaskadenbetrieb
kaskadengeschaltete
kaskadengeschaltete
Kaskadenprozess
Kaskadenregelsystem
Kaskadenregelung
Kaskadenregler
Kaskadenrelais
Kaskadenschaltung
Kaskadensteuerung
Kaskadensteuerung
Kaskadenstruktur
Kaskadensystem
Kaskadenübertrag
Kaskadenverstärker
Kaskadenwäscher
Kassettenbeschickung
Kassetteneinrichtung
katalytische Aktivität
katalytischer Prozess
Katodenfolger
Katodengleichrichter
Katodeninhibitor
Katodenreaktion
Katodenrückkopplung cathode
Katodenrückkopplungskreis
Katodenschirm
Katodenstrahl
Katodenstrahlfunktionsgenerator
Katodenstrahlkodierer
Katodenstrahloszillograf
Katodenstrahloszilloskop
Katodenstrahlröhre
Katodenstrahlschalter
Katodenverzögerer
Katodenzerstäubung
katodische Polarisation
katodischer Schutz
Kausalität
Kausalitätsprinzip
Kavitationserosion
KB
KB
Kegeldreheinrichtung
Kelvin‐Temperatur
Kenndaten pl
Kenndatenblatt elektrischer Parameter
Kenndatenblatt mechanischer Parameter
Kennkreisfrequenz
Kennlinie
Kennlinie
Kennlinie eines taktilen Sensors
Kennlinie eines Zangengreifers
Kennlinienschar
Kennliniensteilheit des Frequenzwandlers
Kennlinienverfahren
Kennsignal
Kenntnis
Kennungsimpuls
Kennungskode
Kennwert
capillary flowmeter
capillary electrometer
capillary system
capillary viscometer
Karnaugh map
diagram of Karnaugh
card for robot control
card with vocal input‐output
card error, CE
card code, CC
Cartesian robots
Cartesian working room
Cartesian standard coordinate system
cascade
cascaded stages
cascade operation
cascade control
concatenated control
cascade process
cascade control system
cascade control
cascade [action] controller
cascade relay
cascade coupling
cascade control
concatenated control
cascade structure
cascade system
cascaded carry
cascade amplifier
cascade scrubber
charging of cassettes
device of cassette
catalytic activity
catalytic process
cathode follower
cathode detector
cathodic inhibitor
cathodic reaction
cathode feedback
cathode feedback circuit
cathode screen
cathode ray
cathode‐ray function generator
cathode‐ray coder
cathode‐ray oscillograph
cathode‐ray oscilloscope
cathode‐ray tube
cathode‐ray switch
cathodic inhibitor
cathode dispersion
cathodic polarization
cathodic protection
causality
principle of causality
cavitational erosion
kilobyte
KB
taper turning attachment
absolute temperature
characteristics
electrical specifications
mechanical specifications
undamped natural angular frequency
characteristic
characteristic curve
characteristic line of tactile sensor
characteristic line of pincer gripper
family of characteristics
frequency converter characteristic slope
characteristic method
identifying signal
knowledge
identification pulse
identification code
characteristic value
stran 138 od 326
EN ‐DE: slovar avtomatizacije in robotike Kennwertermittlung
Kennwertermittlung
kennzeichnen
Keramikpressen
Keramikpressmanipulator
keramischer Sensor
Kern
Kernenergie
Kernenergie
Kernenergieanlage
Kernkraftwerk
Kernprozess
Kernreaktor
Kernreaktor
Kernreaktorregler
Kernreaktorsimulator
Kernresonanz‐Magnetfeldmesser
Kesselkontrolle
Kesseluntersuchung
Kesselwirkungsgrad
Kette
Kette Kettenantrieb
Kettenantrieb
Kettenbefehl
Kettenbefehl
Kettendämpfung
Kettenelevatorüberwachung
Kettenstruktur
Kieinstroboterdynamik
Kilobyte
Kilobyte
Kilobytes pro Sekunde
Kilobytes pro Sekunde
Kilohertz
Kilohertz
Kilohertz
Kinematik eines Industrieroboters
kinematische Abmessung
kinematische Analyse
kinematische Analyse (eines Greifergetriebes)
kinematische Ausgabe
kinematische Greiferabmessungen {Greiferdimensionen)
kinematische Kette
kinematische Kette (eines Zangengreifers)
kinematische Manipulatorstruktur
kinematische Roboterstruktur
kinematischer Zustand
kinematisches Schema
kinematisches Schema
kinematisches Schema
kinetische Energie der Wärmebewegung
kinetische Messdaten pl
kinetischer Parameter
kinetischer Scheinwiderstand
kinetisches Regelungssystem
Kippeinheit
kippen
Kippgenerator
Kippgenerator
Kippkreis
Kippkreis
Kippphase Kippschaltung
Kippschaltung Kippschwinger
Kippschwinger
Kippschwingungen
Klarkontrolle vor Arbeitsbeginn
Klarschriftlesen
Klarschriftleser
Klarschriftleser
Klartextanzeige
Klasseneinteilung für Messgeräte
klassieren
Klassierer von zeitlich veränderlichen Bildern
estimation
identification
feature v
ceramic pressing
ceramic pressing manipulator, ceramic pressing handler
ceramic sensor
core of membership function
nuclear energy
atomic energy
nuclear power plant
nuclear power plant
nuclear reaction
atomic pile
nuclear reactor
nuclear reactor controller
nuclear reactor simulator
nuclear resonance magnetic field meter
boiler testing
boiler testing
boiler efficiency
chain (of action)
direct action circuit
chain drive
chained drive
chain command
chain command, CC
iterative attenuation
chain elevator monitoring
series structure
miniature robot dynamics
kilobyte
KB
kilobyte per second
KBPS
kilohertz
kHz
kilocycles per second
robot kinematics
kinematic dimension
kinematic analysis (of gripper gear)
kinematic analysis (of gripper gear)
kinematic output
kinematic gripper dimensions
kinematic chain
kinematic chain (of pi nee gripper)
kinematic manipulator structure
kinematic robot structure
kinematic state
kinematic scheme, kinematic schedule
kinematic scheme
kinematic schedule
kinetic energy of thermal motion
kinetic measuring data
kinetic parameter
motional impedance
kinetic regulation system
time‐base unit
toggle v
relaxation [pulse] generator
relaxation [pulse] oscillator
relaxation circuit
sweep circuit sweep phase multivibrator
biased flip‐flop
relaxation [pulse] generator
relaxation [pulse] oscillator
relaxation oscillations
clearing control before commencing
optical character recognition, OCR
optical character reader
optical reader
clear text indication
measuring instrument classification
classify v
classifier of time‐variable patterns
stran 139 od 326
EN ‐DE: slovar avtomatizacije in robotike Klassifikationssystem
Klassifizierautomat
klassifizieren
Klassifizierung der Manipulatorsteuerungen
Klassifizierung von Montageoperationen
klassische Theorie des Elektromagnetismus
klassisches Informationsverarbeitungssystem
klassisches Schaltelement
Klauenbewegung
kleben (durch Roboter)
Klebespannung
kleine Automatisierung
kleine Greifmasse
kleine Regelabweichung
kleine Roboterbeschleunigung
kleiner Parameter
kleines Monitorprogramm
Kleinindustrieroboter
Kleinmanipulator
Kleinroboter
Kleinrobotereinsatz
Kleinserienfertigung f(von Robotern)
Kleinsignal
Kleinsignalanalyse
Kleinsignalkapazität
Kleinsignalstromverstärkung
Kleinsignalverstärker
Kleinstörungsmethode
Kleinstroboter
Kleinstroboter (Miniroboter
Kleinstroboterherstellung
kleintechnische Ausrüstung
Kleinteil
Kleinteilefertigung
Klemme
Klemmprinzip
Klemmschaltung
Klemmvorrichtung
Klimaanlage Klimaanlage klimatische Bedingungen
Klimatisierung Klimatisierungsprozess Klinometer
Klirrfaktor
Klirrfaktor
Klirrfaktormessbrücke
Klirrfaktormessgerät
Klirrverzerrung
Knickarm
Knickarm
Knickarmroboter
Knickbeanspruchung
Knickbelastung
Knickfestigkeit
Knickpunkt
Knickversuch
Kniehebelgreifer
Kniehebelkinematik
Knoten
Knoten
Knoten
Knoten
Knotenprozessor
Knotenpunkt
Knotenpunkt
Knotenpunkt
Knotenpunkt
Knotenpunktmethode
Knowbot
Knowbot
Koaxialleitung
Koaxialrelais
Koaxialresonator
Kode mit doppelter Fehlerkorrektur
Kodealphabet
classification system
grading automatic sorter
classify v
classification of manipulator controls
classification of assembly operations
classical electromagnetic theory
classical information processing system
classical switching element
movement off claw
adhere to, to cement (by robot)
sticking voltage
small automatization
small grip mass
small control deviation
small robot acceleration
small parameter
small monitor program
miniature robot, miniature industrial robot, minirobot
miniature manipulator
miniature robot, miniature industrial robot, minirobot
miniature robot application
small‐scale series production (of robots)
small signal
small signal analysis
small signal capacitance
small signal current gain
low‐level amplifier
small perturbation method
miniature robot, miniature industrial robot, minirobot
microrobot with five degrees of freedom
manufacture of micro robots
bench‐scale equipment
miniature part
manufacturing of miniature parts, miniature parts manufactur
terminal
clamping principle
clamping circuit
clamping device
air‐conditioning plant air‐conditioning system climatic conditions
air‐conditioning air‐conditioning process clinometer
distortion coefficient
distortion factor
distortion bridge
harmonic distortion measuring set
non‐linear distortion
buckling arm
folding arm
buckling arm robot
buckling stress
buckling load
buckling strength
buckling point
buckling test
toggle lever gripper
toggle lever kinematics
node
centre
junction
intersection
node processor
node
centre
junction
intersection
nodal analysis
knowledge robot
knowbot
coaxial line
coaxial relay
coaxial resonator
double error‐correcting code
code alphabet
stran 140 od 326
EN ‐DE: slovar avtomatizacije in robotike Kodeaufbau
Kodebasis
Kodebezeichnung
Kodediskriminator
Kodeelement
Kodeimpulsfolge
Kodekombination
Kodeprüfung
Kodeprüfzeit
Kodepunkt
Koderegeneration
Kodermarkierung
Kodesicherung
Kodesteuerungssystem
Kodestruktur
Kodeumsetzer
Kodeumsetzer
Kodeumsetzer
Kodeumsetzung Kodeumsetzung Kodewandler
Kodewandler
Kodewandler
Kodewort
Kodewortabstand
Kodeziffer
Kodiereinrichtung
Kodiereinrichtung
Kodiereinrichtung
kodieren
kodieren
Kodierer
Kodierer
Kodierer
kodierte Befehlsreihe
kodierte Befehlszeile
kodierte Bezeichnung
kodierte dezimale Schreibweise
kodierte Dezimaltziffer
kodierte Impulsfolge
kodierte Kennung
kodierter Befehl
kodierter Lichtstrahl
kodiertes Nachrichtenübertragungssystem
kodiertes Programm
kodiertes Robotersignal
kodiertes Signal
Kodierung
Kodierung eines Programms in Assemblersprache
Kodierung feines Roboterprogramms
Kodierungsbschnitt
Kodierungshypothese
Kodierungskreis
Kodierungsrelais
Koeffizient der Binomialreihe
Koeffizienten‐Einstellpotentiometer
kohärente Demodulation
kohärente elektromagnetische Schwingungen
kohärente Quelle
kohärente Strahlung
kohärente Trägerwelle
kohärente Übertragung cohesive energy density 128
kohärenter Träger
kohärentes Lasersignal
Kohärent‐Infrarotstrahlenradar
Kohärenzzeit
Koinzidenz‐Antikoinzidenz‐Zählanordnung
Koinzidenzauflösungsvermögen
Koinzidenzberichtigung
Koinzidenzbetrieb
Koinzidenzelement
Koinzidenzentfernungsmesser
Koinzidenzfehler
Koinzidenzflusselement
Koinzidenzgatter
Koinzidenzgatter
code structure
base of code
coded identification
code discriminator
code element
code pulse train
code combination
code check
code checking time
code point
code regeneration
label coding
code protection
code control system
code structure
code converter
code translator
transcoder
code conversion
code translation
code converter
code translator
transcoder
code word
code‐word distance
code digit
coder
encoder
code equipment
encipher v
encode v
coder
encoder
code equipment
coded instruction range
coding line
coded identification
coded decimal notation
coded decimal digit
code pulse train
identification code
coded instruction
coded light ray
coded communication system
coded program
coded robot signal
coded signal
coding
assembler language coding, ALC
robot program coding
coding section
coding hypothesis
coding circuit
coding relay
binomial coefficient
coefficient‐setting potentiometer
coherent detection
coherent electromagnetic oscillations
coherent source
coherent radiation
coherent carrier
coherent transmission
coherent carrier
coherent laser signal
coherent infrared radar
coherence time
coincidence and anticoincidence pulse counting assembly
coincidence resolving power
coincidence correction
coincidence mode
coincidence element
coincidence range finder
coincidence error
coincident flux device
coincidence gate
coincidence circuit
stran 141 od 326
EN ‐DE: slovar avtomatizacije in robotike Koinzidenzgatter
Koinzidenzgatter
Koinzidenzkurve
Koinzidenzmethode
Koinzidenzregister
Koinzidenzregister
Koinzidenzregister
Koinzidenzregister
Koinzidenzschaltung
Koinzidenzschaltung
Koinzidenzschaltung
Koinzidenzschaltung
Koinzidenzselektor
Koinzidenzsignal
Koinzidenzspektroskopie
Koinzidenzstrom‐Auswahlsystem
Koinzidenzstromspeicher
Koinzidenzverfahren
Koinzidenzverlust
Koinzidenzverstärker
Koinzidenzzähler
Kollektorelektrode
Kollektorelektrode
Kollektorklemme
Kollektorpol
Kollektorschaltung
Kollektorspannung
Kollektorstrom
Kollektorstromkreis
Kollektorübergang
Kollektorverlustleistung
Kollisionsermittlung
Kollisionsphase
Kollisionsschutz
Kollisionssicherung
Kollisionssicherung eines Industrieroboters
Kolonnenschalter
Kolorimeter
Kombination
Kombination von Regelelementen
Kombinator
kombinierte Aufgaben
kombinierte Automatensysteme
kombinierte Automatensysteme
kombinierte Bewegungsachse
kombinierte elektrochemische und Ultraschallbearbeitung
kombinierte Nichtlinearität
kombinierte Steuerung
kombinierter Arbeitsablauf
kombinierter Datenadressbus
kombinierter Daten‐Adress‐Bus
kombinierter Effektor
kombinierter Fügemechanismus
kombinierter Regler
kombinierter Servomechanismus
kombiniertes Antriebsglied
kombiniertes Dosimetersystem
kombiniertes Programm eines Manipulators
kombiniertes Rechensystem
kombiniertes Regelungssystem
Kommando eines Bedienprogramms
Kommandoanweisung
Kommandogerät
Kommandohauptroutine
Kommandoraum
Kommandoraum
Kommandosignale mit Tonfrequenz
Kommandozahl
Kommunikation
Kommunikation mit dem Roboter
Kommunikation zwischen Manipulator und Menschen
Kommunikation zwischen Roboter und Rechner
Kommunikationsbefehl
Kommunikationseinheit
Kommunikationsmodul
Kommunikationsmodus
gate [circuit]
gating circuit
coincidence curve
coincidence method
coincidence gate
coincidence circuit
gate [circuit]
gating circuit
coincidence circuit
coincidence gate
gate [circuit]
gating circuit
coincidence selector
coincidence signal
coincidence spectroscopy
coincident current selection system
coincident current store
coincidence method
coincidence loss
coincidence amplifier
coincidence counter
collecting electrode
collector electrode
collector terminal
collector terminal
collector circuit
collector voltage
collector current
collector circuit
collector junction
collector dissipation
collision detection, CD
collision phase
collision protection
collision protection
robot collision protection, industrial robot collision protection
column shift unit
colorimeter
combination
combination of control loop elements
combiner
combined tasks
combined system of automatons
combined systems of automatons
combined movement axis
combined electrochemical and ultrasonic machining
combined non‐linearity
combination control
combined cycle
combined data and address bus
combined data and address bus
combination actuator
combined joint mechanism
combined controller
mixed servomechanism
combination actuator
combined dosimetric system
combined program of manipulator
combined computing system
mixed control system
service program command
command statement
instruction machine
master command routine
central control station
control centre
command signals with audio frequency
number of command
communication
communication with the robot
communication between manipulator and man
communication between robot and computer
access instructions
communication unit
communication module
communication mode
stran 142 od 326
EN ‐DE: slovar avtomatizacije in robotike Kommunikationsnetz
Kommunikationsnetzwerkprozessor
Kommunikationsnetzwerkprozessor
Kommunikationsrechner
Kommunikationssignal
Kommunikationssteuerung
Kommunikationssteuerung
Kommunikationstheorie
Kommutationsfähigkeit von Relaiskontakten
kommutative Algebra
kommutativer Automat
kommutatives Gesetz
kommutiertes Fehlersignal
Kompaktabschirmung
Kompaktbauweise
Kompaktbauweise
kompakte Abschirmung
kompakte Baueinheit
kompaktes Recheninstrument
Kompaktgreifer
Kompaktheit
Kompaktoszilloskop
Kompaktroboter
Kompaktsystem
Komparation
kompatibel
Kompatibilität
Kompatibilität eines Roboterprogramms
kompatible Baugruppe
kompatibler Befehlssatz auf
kompatibles System
Kompensation
Kompensation
Kompensation
Kompensation
Kompensationsdruckgeber
Kompensationsdruckgeber
Kompensationseinstellung compensateur
Kompensationselement
Kompensationsferngeber
Kompensationsgrad
Kompensationskreis
Kompensationsleitung
Kompensationsleitung
Kompensationsmessmethode
Kompensationsmessmethode
Kompensationspolarimeter
Kompensationsregler
Kompensationsrückkopplung
Kompensationsschaltung
Kompensationsschaltung
Kompensationsschreibgerät
Kompensationssignal
Kompensationssignal
Kompensationsspannung
Kompensationssynchronisation
Kompensationsverhältnis
Kompensationsvorkopplung
Kompensationswicklung
Kompensationswiderstand
kompensatorischer ODER‐Operator
kompensatorischer Operator
kompensatorischer UND‐Operator
kompensierte Regelung
kompensierter Messwandler
Kompensograf
Kompilationsmethode
kompilierende Simulation
Komplement
komplementäre Nichtlinearität
komplementäres Ereignis
Komplementärfunktion
Komplementärkode
Komplementärkode
Komplementbildung (Modifikator)
Komplementdarstellung
communication network
communication network processor
communication network processor, CNP
communication computer, CC
communication signal
communication control
communication control, CC
communication theory
breaking capacity of relay contacts
commutative algebra
commutative automaton
commutative law
commutated error signal
bulk shielding
compact construction
compact design
bulk shielding
compact construction unit
compact computing instrument
compact gripper
compactness
compact oscilloscope
compact robot
compact system
comparison
compatible
compatibility
compatibility of robot program
compatible subassembly
machine‐code compatible instruction set
compatible system
dynamic compensation
equalization
balancing
compensation
compensating‐pressure transducer
force‐balance pressure gauge
compensation adjustment
compensation element
compensation transmitter
compensation factor
null circuit
compensating line
compensation lead
compensation measuring method
null point method of measurement
compensating polarimeter
compensating controller
compensating feedback
compensating circuit
compensating network
compensating selfrecording instrument
compensating action
compensation signal
compensation voltage
flywheel synchronization
compensation ratio
compensating feedforward
compensation winding
compensating resistor
compensatory OR
compensatory operator
compensatory AND
balanced control
compensated instrument transformer
compensograph
compiling method
compiling simulation
complement
complementary non‐linearity
complementary event
complementary function
complementary code
additional code
complement
complement representation
stran 143 od 326
EN ‐DE: slovar avtomatizacije in robotike Komplementimpuls
Komplement‐Operator
Komplettsystem
komplex
Komplexamplitude
komplexe Automatisierung
komplexe Automatisierung
komplexe Bauelementedimensionierung composants
komplexe Daten pl
komplexe Datenübertragung
komplexe Datenverarbeitung
komplexe Ebene
komplexe elektronische Baugruppe
komplexe Information
komplexe Informationsverarbeitung
komplexe Leistung
komplexe logische Operation
komplexe Montageaufgabe
komplexe Permeabilität
komplexe Produktionsanlage
komplexe Roboteraufgabe
komplexe Roboterszene
komplexe Struktur
komplexe System
komplexe Übertragungsfunktion
komplexe Umwelterfassung
komplexe Variable
komplexe Verknüpfungsvorschrift
komplexe Wurzel
komplexer Faktor
komplexer Handhabungsvorgang
komplexer Kraftsensor
komplexer Montageablauf
komplexer Montageroboter
komplexer Regler
komplexer Robotersensor
komplexer Schaltkreis
komplexer Scheinleitwert
komplexer Scheinwiderstand
komplexes elektronisches Gerät
komplexes Regelungssystem
komplexes Roboterprogramm
komplexes Umweltmodell
Komplexgruppe
Komplexmechanisierung
Komplexmechanisierung
Komplexmechanisierung
Komplexverfahren nach Box
komplizierte Beschickungsaufgabe
komplizierter Sensoraufbau
kompliziertes Montageobjekt
Kompliziertheit des Regelvorganges
Komponente
Komponente der Armlage
Komponentendatei
komportable Verteilungsfunktion
komportable Verteilungsfunktion
Komposition
Kompositionspotentiometer
Kompositionsregel der Inferenz
Kompoundregler
Kondensatorelektrometer
Kondensatormesszelle
Kondensatorspeicher
konditionierender Prozess
konduktive Kopplung direct
konduktometrische Analysenmethode
Konfigurations[kontroll]einheit
konfigurierbar
Kongruenzverhältnis
konische Abtastung
konjugierte Funktion
konjugierte komplexe Zahl
konjugierte Wurzel
konjugierter komplexer Wert
Konjunktionsoperation
complement pulse
fuzzy NOT
complete system
complex
complex amplitude
integrated automation
complex automati[zati]on
complex component parts proportioning
complex data
complex data transposition
complex data processing
complex plane
complex electronic subassembly
complex information
complex information processing
complex power
complex logical operation
complex assembly task
complex permeability
complex production plant
complex robot task
complex robot scene
complex structure
complex system
complex transfer function
complex environmental coverage, complex environmental acq
complex variable
complex connection instruction
complex root
complex factor
complex handling process
complex force sensor
complex assembly sequence
complex assembly robot
complex controller
complex robot sensor
complex circuit
complex admittance
complex impedance
complex electronic equipment
complex control system
complex robot program
complex environmental model
complex group
complete mechanization
full mechanization
complex mechanizing
Box's complex method
complicated feeding task
complicated sensor structure
complicated assembly object
complexity of the control process
component
component of arm position
component file
compatible distribution function
congruent distribution function
composition
composition potentiometer
compositional rule of inference
compound controller
capacitor electrometer
capacitor‐type measuring cell
capacitor store
conditioning process
conductive coupling
conductometric method of analysis
configuration unit
configurable
congruence relation
conical scanning
adjoint function
conjugate complex number
conjugate root
conjugate complex value
conjunction operation
stran 144 od 326
EN ‐DE: slovar avtomatizacije in robotike konjunktive Normalform
conjuctive normal form
konjunktives Aufsuchen
conjunctive search
Konklusion
conclusion
Konnektivität
connectivity
konservatives System
conservative system
konservierte Information
conserved information
Konsistenzsteuerung
consistence control
Konsole (eines Schweißroboters)
console (of welding robot)
Konsolenabfrageeinheit
console inquiry unit
Konsolenkommandoprozessor
console command processor, CCP
Konsol‐Handler
console handler
knee process unit, console process unit
Konsolverfahrenseinheit
Konsolverfahrenseinheit
knee process unit
Konsolverfahrenseinheit
console process unit
Konstante des Frequenzauflösungsvermögens
frequency resolution constant
konstante Greifkraft
constant grip force
konstante Komponente
constant component
konstante Periode
fixed period
konstante Strahlung
constant radiation
konstante Verzögerung
constant time lag
konstanter Algorithmus
constant algorithm
konstanter Bereich
constant area
konstanter Druckabfall
constant‐pressure drop
konstanter Faktor
constant factor
konstanter Faktor
constant coefficient
konstantes Zeitverzögerungsrelais
independent time‐lag relay
Konstanthaltungsprinzip
invariance principe
Konstantspannungsquelle
constant source
Konstantspannungsquelle
constant supply
Konstantspannungsregler
constant‐voltage regulator
Konstantspannungsregler
voltage stabilizer
Konstantstromquelle
constant‐current source
Konstantstromregler
constant‐current regulator
Konstantwiderstand
constant resistance
Konstruction
construction
konstruieren
design v
konstruieren
construct v
konstruierte Montageeinheit
constructed assembly unit
Konstrukteurarbeitsplatz
engineering working station, engineering workplace, construc
Konstruktion technischer Erzeugnisse
engineering product design
Konstruktionsalgorithmus (Auslegungsalgorithmus) eines Gredesign algorithm of gripper
Konstruktionsarbeitsplatz
engineering working station, engineering workplace, construc
Konstruktionsfehler
error of construction
Konstruktionsmerkmale von Robotern
design characteristics of robots
Konstruktionsprinzip
engineering concept
Konstruktionsregeln
root‐locus, construction rules
Konstruktionsroboter
construction robot
Konstruktionsstand
engineering level
Konstruktionsteile npi
construction parts
Konstruktionsteile
construction parts
Konstruktionsverfahren n
design method
Konstruktionswesen
engineering
konstruktive Antriebsgestaltung
constructive drive design
constructive gripper construction
konstruktive Greiferausführung
konstruktive Interfacebedingung
constructive interface condition
konstruktive Manipulatorgestaltung
constructive manipulator shaping
konstruktive Strukturvariante constructive structure variant
konstruktive Veränderung der Montageeinheit
constructive change of assembly unit
konstruktiver Roboteraufbau
constructive robot building
konstruktives Fließbild
machinery diagram
Kontakt
contact
Kontaktabfragepunkt
contact sense point
Kontaktabnahme
contact pick‐off
Kontaktabstand
contact gap
Kontaktanordnung
contact arrangement
Kontaktapparat
catalytic reactor
Kontaktdruck
contact pressure
Kontaktelement
contact element, contact piece
Kontaktelement
contact member
Kontaktelement
contact element
Kontaktelement
contact piece
Kontaktfeder
contact spring
Kontaktfläche
contact surface
Kontaktfühler
contact sensor
Kontaktgeber
contactor
Kontaktgeräusch
contact noise
stran 145 od 326
EN ‐DE: slovar avtomatizacije in robotike Kontaktglied
Kontaktglied
Kontaktglied
Kontaktkraft
kontaktlos arbeitender Fühler
kontaktlose Einrichtung
kontaktlose Messung
kontaktlose Schaltung
kontaktlose Steuerung
kontaktlose Zentralsteuerung
kontaktloser Aufnehmer
kontaktloser Aufnehmer
kontaktloser Aufnehmer
kontaktloser Drehmelder
kontaktloser Endschalter
kontaktloser fernwirktechnischer Vorwähler
kontaktloser Geber
kontaktloser Geber
kontaktloser Geber
kontaktloser Impulsgeber
kontaktloser Schalter
kontaktloses magnetisches Verzögerungsglied
kontaktloses Relaiselement
kontaktloses System
Kontaktlücke
Kontaktmesssystemanwendung
Kontaktmess‐Systemanwendung
Kontaktprofil
Kontaktpyramide
Kontaktpyramide
Kontaktsatz
Kontaktsensor
Kontaktspannung
Kontaktstrecke
Kontaktstrom
Kontaktstück
Kontaktstück
Kontaktstück
Kontaktstück
Kontaktthermometer
Kontaktunterbrecher
Kontaktunterbrecher
Kontaktvoltmeter
Kontaminationsmonitor
kontinuierlich arbeitender Luftmonitor
kontinuierlich arbeitendes
kontinuierlich wirkendes Optimisierungssystem
kontinuierliche
kontinuierliche Abhängigkeit
kontinuierliche Abtastung
kontinuierliche Anzeige
kontinuierliche Betriebseise
kontinuierliche Fahrweise
kontinuierliche Fahrweise
kontinuierliche Gasmengenmessung
kontinuierliche Herstellung
kontinuierliche Herstellung
kontinuierliche Korrektion
kontinuierliche Phase
kontinuierliche Reglerwirkung
kontinuierliche Schweißkopfbewegung (Roboter)
kontinuierliche Schwingungen
kontinuierliche Stabilisierung
kontinuierliche Struktur
kontinuierliche Variable
kontinuierliche Verteilung
kontinuierliche Wirkung
kontinuierliche Wirkung
kontinuierlicher Modus
kontinuierlicher Prozess
kontinuierlicher Regler
kontinuierlicher Verschiebungsarbeitsgang
kontinuierlicher Verschiebungsarbeitsgang .
kontinuierliches Frequenzspektrum
kontinuierliches Signal
kontinuierliches Steuersystemmodell contact member
contact element
contact piece
contact force
contactless active sensor
contactless device
contactless measurement
contactless circuit
contactless control
central contactless control
contactless pick‐up
non‐contact feeler device
non‐contacting sensor
contactless selsyn
contactless limit switch
contactless distributor in remote control
contactless pick‐up
non‐contact feeler device
non‐contacting sensor
contactless impulse generator
contactless switch
contactless magnetic delay member
non‐contact relay element
contactless system
contact gap
application of contact measuring system
application of contact measuring system
contact profile
relay pyramid
contact pyramid
contact set
contact sensor
contact‐potential difference
contact travel
contact current
contact element, contact piece
contact member
contact element
contact piece
contact thermometer
contact breaker
contact breaker, CB
contact voltmeter
contamination monitor
continuous air monitor
continuous air monitor
continuous‐action optimization system
continuous curve distance‐time protection
continuous dependence
continuous reading
continuous display
continuous [operation] mode
long‐term continuous duty
long‐term continuous operation
continuous gas quantity measurement
continuous fabrication
continuous manufacture
continuous correction
continuous phase
continuous controller action
continuous welding head movement
continuous oscillations
continuous stabilization
continuous structure
continuous variable
continuous distribution
continuous action
continuous operation
continuous [operation] mode
continuous process
continuous‐action controller
continuous displacement operation
continuous displacement operation
continuous frequency spectrum
continuous signal
control system continuous simulator
stran 146 od 326
EN ‐DE: slovar avtomatizacije in robotike kontinuierliches Zoomen
Kontinuität
Kontinuitätsbedingungen
Kontinuitätsbeziehungen
Kontinuitätsgleichung
Kontrast‐Intensivierung (Modifikator)
Kontrast‐Intensivierung (Modifikator)
Kontrast‐Intensivierung (Modifikator)
Kontroll‐ und Überwachungsgeräte
Kontroll‐ und Überwachungsgeräte
Kontroll‐ und Überwachungsgeräte
Kontrollabtastung
Kontrollabtastung
Kontrollautomat
Kontrollbit
Kontrollbit
Kontrollbit
Kontrollblock
Kontrollbus
Kontrolle
Kontrolle
Kontrolle
Kontrolle
Kontrolle der Greifkraft
Kontrolle des Aufgabenkomplexes
Kontrolle des Werkzeugbruchs
Kontrolle eines Industrieroboters
Kontrolle eines Montagevorgangs
Kontrolle feines Montagevorgangs
Kontrolleinheit
Kontrolleinrichtung
Kontrolleinrichtung
Kontroller
Kontroller
Kontroller
Kontrollfunktion einer Greifkraft
Kontrollfunktion einer Greif‐kraft
Kontrollgerät
Kontrollgerät
kontrollieren
kontrollierendes Unterprogramm
kontrolliertes Bauteil
Kontrolllösung
Kontrollmeldung
Kontrollmodulation
Kontrollösung
Kontrollproblem
Kontrollrechner
Kontrollrechnungen
Kontrollschaltung
Kontrollschirm
Kontrollschirm
Kontrollschirm eines Industrieroboters
Kontrollsignal
Kontrollstelle
Kontroll‐Steuerungssystem von Robotern
Kontrollstromkreis
Kontrollsummierung
Kontrolltätigkeit
Kontrolltermin
Kontrolltheorie
Kontrollvorrichtung
Kontrollwarte
Kontrollwert
Kontrollwert
Kontrollzeichen
Kontrollzeit der Anzeigen
Kontrollziffer
Kontrollzustand des Roboters
Kontur
Kontur
Konturen der Vorlage
Konturenauswertung
Konturenregelungssystem
Konturinstrumentverschiebung
Konvektionsstrom
continuous zooming
continuity
continuity conditions
continuity equations
equation of continuity
contrast intensification
intensification
intensification, contrast intensification
process instrumentation
monitoring instrumentation
monitoring equipment
test reading
control sensing
check automaton
check digit
check bit
test bit
control block
checking bus
control
monitoring
verification
supervision
checking of grip force
problem formulation check
tool fracture checking, tool rupture checking
robot checking], industrial robot check[ing]
checking of assembly process
checking of assembly process
checking unit
verifying device
monitor
controller
control device
control unit
checking function of grip force
checking function of grip force
testing instrument
check instrument
control v
checking subroutine
checked component
check solution
check message
check modulation
check solution
check problem
computer for testing
check computations
check circuit
check[ing] screen
checking screen, check screen
checking screen of industrial robot, check screen of industrial test signal
control station
robot checking control system
pilot circuit
check addition
control activity
control date
control theory
controlling device
control station
value of the check
check value
check digit
checking time of indications
check digit
robot checking state
contour
outline
pattern contours
contour analysis
contour control system
outline instrument displacement
convection current
stran 147 od 326
EN ‐DE: slovar avtomatizacije in robotike Konvektron
Konvention
konventioneller Montageablauf
konventionelles Bauelement
konvergente Regelung
Konvergenz
Konvergenzalgorithmus
Konvergenzbeschleunigung
Konvergenzeinstellung
Konvergenzelement
Konvergenzgebiet
Konvergenzgeschwindigkeit
Konvergenzgrad
Konvergenzkriterium
Konvergenzmesser
Konvergenzradius
Konvergenzregelung
Konvergenzschreiber
Konversionsgenauigkeit
Konversionskoeffizient
Konversionsverlust
Konverter
Konverter
Konverter
Konverterverfahren
Konverterverfahren
konvertieren
Konvertiersystem
Konvertierung
Konvertierung
Konvertierung
Konvertierung
Konvexität von Fuzzy‐Mengen
Konzentration (Modifikator)
Konzentration von Roboteroperationen
Konzentrationsregler
Konzentrationsüberspannung
Konzentrator auf Rechnerbasis
Konzentratorsystem
konzentrierte Charakteristik
konzentrierte Kapazität
konzentrierter Parameter
konzentrische Übertragungsleitung
konzentrischer Tubenarm (Röhrenarm)
konzentrisches Röhrenarmsystem
konzentrisches Tubenarmsystem
Konzept eines Rechners operations s 10090
Konzeptbildung
Konzeptkoordinierung
Konzolen‐Zusatzadapter
Kooperationsroboter
kooperative Struktur
kooperativer Geber
kooperativer Mehrachsensensor
kooperativer Mehrachsensensor
kooperativer Sensor
Koordinaten eines Arbeitsraums
Koordinaten läge
Koordinatendaten pl
Koordinateneinstellung
Koordinatenlage
Koordinatenorientierung
Koordinatenschalter
Koordinatenschreiber
Koordinatenschreiber
Koordinatenspeicher
Koordinatensystem
Koordinatensystem eines Getriebegliedes
Koordinatensystemursprung
Koordinatentransformation
Koordinatentransformation Koordinatentransformation einer Raumbahn
Koordinatenverschiebung
Koordinatenwähler für Messzentralen
Koordinatenwerte
Koordinatenwerte der Bewegungspunkte
convectron
convention
conventional assembly sequence
conventional component
convergent control
convergence
convergence algorithm
convergence acceleration
convergence adjustment
convergent component
convergence domain
rate of convergence
convergence degree
convergence attribute
convergence indicator
radius of convergence
convergence control
convergence recorder
conversion accuracy
conversion coefficient
conversion loss
converter
transducer
transductor
blast process
converter process
convert v
converting system
conversion
converting
transformation
transforming
convexity of fuzzy set (membership function)
concentration
concentration of robot operations
concentration controller
concentration overvoltage
computer‐based concentrator, CBS
concentrator system
lumped characteristic
lumped capacity
lumped parameter
coaxial transmission line
concentric tube arm, concentric tubular arm
concentric tube arm system concentric tube arm system
concentric tube arm system concentric tube arm system
concept of computer
concept formation
concept‐coordination
console auxiliary adapter
cooperation robot
cooperative structure
cooperative sensor
cooperative multiaxis sensor
cooperative multi‐axis sensor
cooperative sensor
working space coordinates
coordinate position
coordinate values
coordinate setting
coordinate position
coordinate orientation
cross‐bar switch
coordinate recorder
variable recorder
coordinate store
coordinate system
coordinate system of gear element
coordinate system origin
coordinate trasformation
coordinate transformation
coordinate transformation of space path
coordinate displacement
coordinate selector for data logging
coordinate values
coordinate values of movement points
stran 148 od 326
EN ‐DE: slovar avtomatizacije in robotike Koordinatenwerte der Bewegungspunkte mouvement
Koordinatenzuordnung
koordinierbare Bewegung der Roboterglieder
koordiniert geführter Roboter
koordinierte Bewegung der Glieder
koordiniertes Steuerungssystem
Koordinierung nach Konzept
Koordinierungsglied
Koordinierungsrechner
koorrigiertes Stellsignal
Kopierfräsen
Kopierfräsmaschine
Kopiergerät
Kopierlauf
Kopierprogramm
Koppelleitung
Koppelplan einer Steuerung
Koppler
Kopplungsanordnung
Kopplungseffekt
Kopplungseinstellung
Kopplungsfaktor
Kopplungsfunktion
Kopplungskette
Kopplungskomponente
Kopplungsreihenfolge
Kopplungswiderstand
Kopplungswiderstand
körperbeschreibendes Element
Korrektionsfarbfilter
Korrektionsfilter
Korrektionsglied
Korrektionstabelle
Korrektur der dynamischen Eigenschaften
Korrektur der Kennlinie
Korrektur dynamischer Eigenschaften
Korrektur von Nichtlinearitäten
Korrekturbereich
Korrekturbewegung
Korrekturbewegung
Korrekturbewegung
Korrekturbewegung feines Roboters
Korrekturblock
Korrekturfaktor
Korrekturfaktor
Korrekturfunktion
Korrekturglied
Korrekturglied
Korrekturglied
Korrekturglied
Korrekturimpuls
Korrekturkreis
Korrekturmethode
Korrekturprogramm
Korrekturregelung
Korrekturregelung correction
Korrekturregelung correction
Korrektursteuerung
Korrektursteuerung
Korrektursystem
Korrekturverögerung
Korrekturverögerung
Korrekturwert
Korrekturzustand
Korrelation
Korrelationsabhängigkeit
Korrelationsbahnverfolgung
Korrelationsbahnverfolgungssystem
Korrelationselektronik
Korrelationsfunktion
Korrelationsfunktionsmessung
Korrelationsgrad
Korrelationskoeffizientenmatrix
Korrelationskompensation
Korrelationsmesser
Korrelationsmethode
coordinate values of movement points
coordinate assignment
coordinable movement of robot elements
coordinated guided robot
coordinated movement of elements
coordinated control system
concept‐coordination
coordinating element
coordinating computer
corrected actuating signal
copy milling
copy milling machine
copy[ing] device
copy run
duplicate routine
interconnection line
coupling diagram of control
connective
order of connexion
coupling effect
coupling adjustment
coupling factor
coupling function
coupling circuit
coupling component
order of connexion
coupling resistance
coupling resistor (US)
body‐descriptive element
colour correction filter
correcting filter
correction member
correction table
dynamic properties correction
characteristic correction
correction of dynamic properties
non‐linearities correction
correcting range
correction movement, correction motion
correction movement
correction motion
correction movement of robot
correcting unit
correction factor
corrective factor
correcting function
correcting element
equalizer
correction element
correction term
correcting pulse
correcting circuit
method of correction
correction program
correction adjusting
correcting control
correction adjusting
correcting control
correction adjusting
correction system
correction lag
corrective lag
correcting condition
correcting condition
correlation
correlation dependence
correlation tracking
correlation tracking system
correlation electronics
correlation function
measuring of the correlation functions
correlation degree
correlation coefficient matrix
correlative compensation
correlation meter
correlation method
stran 149 od 326
EN ‐DE: slovar avtomatizacije in robotike Korrelationsrechner
Korrelationsregler
Korrelationstechnik
Korrelationstheorie
Korrelationstriangulation
Korrelationsverfahren
korrelierte Regler
korrespondierender Wert
korrigieren
korrigierender
korrigierendes Element
korrigierendes Element
korrigierendes Element
korrigierte Gelenkregelung
korrigierter Montagevorgang
korrigiertes Programm
korrigiertes Stellsignal
Korrosionsbeständigkeit
Korrosionsschutzmittel
Kosinuswelle
Kosten pl für Roboteranschaffung
kovariantes Element
Kovarianz
Kraft feine Softgreifers
kraftabhängige Bewegungsbegrenzung
Kraftadaption
Kraftanschlussart
Kraftaufnehmer
Kraftaufnehmer eines taktilen Sensors
Kraftbedarf
Kraftbedarf
kraftbetätigte Spannvorrichtung
kraftbetätigtes Spannmittel
Kräfteausgleich an Robotern
Kräfteausgleichpotentiometer
Kräftebestimmung (Antrieb)
Kräftebezugspunkt
Kräftegleichgewichtgeber
Kräfteüberwachung
Kraftgeber
kraftgesteuertes Fügen
Kraftkennlinie (einer Zangengreifeinheit)
Kraftmaschinensteuerung
Kraftmaschinensteuerung
Kraftmesseinrichtung
Kraftmesseinrichtung
Kraftmesseinrichtung
Kraftmessung (Robotergelenk)
Kraftrückführung
kraftsensibilisierter Greifer
Kraftsensor
Kraftsensor eines Industrieroboters
Kraftsensor für eine Manipulatorhand
Kraftsensorsystem
Kraftstrom
Kraftvektorsensor
Kraftverbrauch
Kraftverbrauch
Kräftvergleichsregler
Kraftverlauf im Gelenk
Kreis
Kreis für Abweichungsfeststellung
Kreis für Abweichungskorrektur
Kreis mit einseitiger Richtwirkung
Kreisabtastung
Kreisdiagramm
Kreiselkompaßregelung
kreisförmige Roboterarmbewegung
Kreisfrequenz
Kreisgüte
Kreisinterpolation
Kreiskriterium
Kreislauf
Kreislauf
Kreislauf
Kreislaufkühlung
correlation computer
correlated controllers
correlation technique
correlation theory
correlation triangulation
correlation technique
correlated controllers
corresponding value
correct v
corrective action
correcting element
correction element
correction term
corrected joint regulation
corrected assembly process
corrected program
corrected actuating signal
corrosion resistance
corrosion inhibitor
cosine wave
robot prime cost
covariant element
covariance
Soft gripper force, force of soft gripper
power‐dependent motion limitation
power adaptation
mode of power supply connection
receiver of force
force receiver of tactile sensor
power consumption
power demand
power‐operated holding tool
power‐operated holding tool
force compensation on robots
force‐balanced potentiometer
force destination (drive)
reference point of forces
force‐balance transducer
survey of forces
force sensor
force‐controlled joint(ing)
power characteristic line (of pincer grip unit)
motor control
engine control
force measurement device (installation)
force measurement device
force measurement installation
force measurement (robot joint)
force feedback
force‐sensibilized gripper force sensor
force sensor of industrial robot
power sensor for manipulator hand
force sensor system
power current
force vector sensor
power consumption
power demand
force‐balance regulator
behaviour of force in the joint
loop
error‐indicating circuit
error‐correction circuit
unidirectional circuit circular scanning
circle diagram
gyro‐control
circular robot arm (lever) movement
angular frequency
quality factor circuit
circular interpolation
circle criterion
cycle
cyclic process
circulation
closed‐cycle cooling
stran 150 od 326
EN ‐DE: slovar avtomatizacije in robotike Kreislaufprinzip
Kreislaufschaltung
Kreislaufverhältnis
Kreisliste
Kreisprozess
Kreisprozess
Kreisprozess
Kreisschaltung
Kreisschiebung eines Greiforgans
KreisStruktur
Kreisverstärkung
Kreisverstärkung
Kreisverstärkung
Kreiswirkungsgrad
Kreuzgelenk
Kreuzkopplung
Kreuzkorrelation
Kreuzkorrelationsfunktion
Kreuzmodulation
Kreuzspektraldichte
Kreuzungspunkt
Kreuzungspunkt
Kreuzverzerrung
Kriechfall)
Kriechstrecke
Kriechweg
Kriogenik
kristallische Struktur
Kristallstruktur
Kriterium
Kriterium der optimalen Steuerung
Kriterium der Verlustmittelwerte
Kriterium des optimalen Moduls
Kriterium für das Übergangsverhalten
kritisch
kritisch gedämpftes System (PT2‐Element mit D = 1)
kritisch machen
kritische Anpassung
kritische Dämpfung
kritische Dämpfung (D = 1 eines PT2‐Elements
kritische Dichte
kritische Entfernung
kritische Frequenz
kritische Frequenz
kritische Gitterspannung
kritische Haltung
kritische Induktion
kritische Konstante
kritische Spannungsdifferenz
kritische Stellung
kritische Temperatur
kritische Verstärkung
kritische Wellenlänge
kritischer Druck
kritischer Gitterstrom
kritischer Punkt
kritischer Verstimmungswinkel
kritischer Wert
kritischer Widerstand
kritischer Zustand
kritisches Potential
kritisches Volumen
Kryogengerät
Kryogenik‐Datenverarbeitungsanlage
Kryogenspeicher
Kryogensystem
kubische Gleichung
kugelförmiger Arbeitsraum
Kugelspindelantrieb
Kugelventil
Kühlaggregat
Kühlluftschacht Kühlmittelkreislauf
Kühlsystem mit Zwangsbelüftung
Kühlungsleistung
kumulative Ausfallzeit
cycle principle
circulation system
cycle ratio
circular list
cycle
cyclic process
circulation
closed‐loop circuit
circular displacement of grip organ
loop structure
closed loop gain
closed‐loop gain
loop gain
circuit efficiency
swivel joint
cross coupling
cross correlation
cross‐correlation function
cross modulation
cross‐spectral density
cross point
intercept point
cross distortion
overdamped system
leakage path
leakage path
cryogenics
crystal structure
crystal structure
criterion
optimal control criterion
criterion of middle losses
criterion of optimal modulus
performance index
critical
critically damped system
make critical v
critical matching
critical damping
critical damping
critical density
critical distance
cut‐off frequency
critical frequency
critical grid voltage
critical attitude
critical induction
critical constant
critical voltage difference
critical attitude
critical temperature
critical gain
critical wavelength
critical pressure
critical grid current
critical point
critical error angle
critical value
critical resistance
critical state
critical potential
critical volume
cryogenic equipment
cryogenic data processor
cryogenic store
cryogenic system
cubical equation
globular working zone
ball spindle drive
ball valve
cooling aggregate
air cooling channel cooling agent cycle
forced‐air cooling system
cooling capacity
cumulative down‐time
stran 151 od 326
EN ‐DE: slovar avtomatizacije in robotike kumulative Betriebszeit
kumulative spektrale Dichte
Kundendienst im Einsatzbereich
Kundeninformationssteuersystem
Kundeninformationssteuersystem
Kunden‐Interface
Kunden‐Interface
Kundenschaltkreis
künstliche Haut
künstliche Intelligenz
künstliche Roboterintelligenz (Intelligenz feines Roboters)
künstliche Sprache
künstlicher Übertrag
künstliches Dielektrikum
kuppeln
Kupplungsmontageroboter
Kupplungsroboter
Kupplungssteuerung
Kurbelschleife
Kursberichtigung
Kurtzstreckensystem
Kurvenabtaster
Kurvenabtastgerät
Kurvenanalysator
Kurvenbild
Kurvendarstellung
Kurveninstrumentenverschiebung
Kurvenpunkt
Kurvenschar
Kurvenschreiber
Kurvenschreiber
Kurvenschreiber
Kurvenverfolgungslogik
kurz
kurze Auswertezeit (von Roboterbildern)
kurze Erholzeit
kurzer Laserimpuls
kurzer optischer Impuls
kurzgeschlossene Leitung
Kurzschlußschutz
Kurzschlußstromspitzenwert
Kurzschlußsucher
Kurzstrecken‐Dopplerverfahren
kurzwellige Infrarotstrahlung
Kurzzeitbetrieb
kurzzeitige Abtastung von Messsignalen
kurzzeitige Programmierbarkeit
kurzzeitige Störung
kurzzeitige Umprogrammierbarkeit
kurzzeitige Umprogrammierbarkeit Roboterschultergelenk
Kurzzeitmessgerät
Kurzzeitphasenstabilität
Kurzzeitspeicher
Kybernetik
Kybernetik der Elektroenergiversorgungssysteme
Kybernetik in der Ökonomie
kybernetische Darstellung
kybernetische Führung
kybernetische Führung
kybernetische Leitung
kybernetische Leitung
kybernetische Regelung
kybernetische Regelung
kybernetische Struktur
kybernetischer Automat
kybernetisches Modell
kybernetisches Modell
kybernetisches System
Laboratoriumsautomat
Laboratoriumsmessgeräte
Laboreinrichtung
Laboreinsatz
Labor‐Logikprüfung
Labormaßstabsausrüstung
Labormodell
Laborprüfung der Logik
cumulative operating time
cumulative spectral density
field service
customer information control system
customer information control system, CICS
custom interface
customer interface
custom integrated circuit
artificial skin
artificial intelligence
artificial robot intelligence
artificial language
artificial carry
artificial dielectric
gang v
coupling assembly robot
coupling robot
clutch control
crank‐guide, Scotch yoke
course correction
short‐distance system
curve scanner
curve scanner
curve analyzer
plot of the function
curve tracing
curve instrument displacement
curve point
set of curves
graph plotter
plotter
curve plotter
curve follower logic
short
abbreviated evaluation time (of robot images)
short recovery time
fast laser pulse
short optical pulse
short‐circuited line
short‐circuit protection
short‐circuit current peak value
short‐circuit detector
short‐range Doppler
short infrared
short‐time duty
short scanning of measuring signals
short‐time programmability
momentary disturbance
short‐time re‐programmability
short‐time reprogrammability shoulder joint of robot
short‐time measuring apparatus
short‐term phase stability
short‐time memory
cybernetics
electric power system cybernetics
economical cybernetics
cybernetic representation
cybernetic control
cybernetic direction
cybernetic control
cybernetic direction
cybernetic control
cybernetic direction
cybernetic structure
cybernetic automaton
cybernetic simulator
cybernetic model
cybernetic system
laboratory automat
laboratory measuring instruments
laboratory equipment
laboratory use
laboratory logic testing
bench‐scale equipment
laboratory model
laboratory logic testing
stran 152 od 326
EN ‐DE: slovar avtomatizacije in robotike Laborversuch
Lade‐ und Ablesegerät
Lade‐ und Entladesystem (für Roboter)
Ladedruckregler
Ladeeinrichtung
Ladekammer
Laden mit absoluten Adressen
Ladeprogrammaufbautechnik chargeur
Ladepunkt
Lader
Lade‐und‐Start‐Assembler
Ladungsemissionsdetektor
Lageabweichung
Lageausgleich
Lagebestimmung f(von Werk stücken)
Lagebestimmungsgerät
Lageerkennung
Lageerkennungsprozedur
Lagefixierung
Lagefixierung
Lagefixierung
Lageinformation
Lageinformation 'durch Sensor
Lagerbestand
Lageregelung
Lageregelung
Lageregelung
Lageregler
lagern
Lagerung feines Greiforgans
Lagerung feines Roboterarmes
Lagesensor
Lagesensorsystem
Lagesicherung
Lagesicherungselement
Lagrangesche Funktion
Lagrangesche Multiplikatorenmethode
LAMA
Lamelle eines Greiforgans
Laminarbetriebszustand
Lampensignalisierung
Landedruckmesser
Länge der Montagebewegung
Längenbelastung
langkettig
langkettige Verzweigung
langsame Geschwindigkeitsänderung
Längsbewegung
längsgerichtete Schützeinrichtung
Längsmehrpunktsensor
Längsmehrpunktsensor multipoint longitudinal
Längsstabilität
Langzeitstabilität
Langzeittest
Langzeittest
Langzeitwirkung
Laplace
Laplace Variable
Laplace‐Operator
Laplace‐Rücktransformation
Laplacesche Transformation
Laplacesche Umformung
Laplace‐Transformationspaar
Laplace‐Transformierte
LAPLACE‐Übertragungsfunktion
Laplace‐Übertragungsfunktion
Laplace‐Variable
Lärmemission
Lärmschutz
Laser für kurze Impulse
Laser für lange Impulse
Laserabrunden
Laserabtastradar
Laseranordnung
Laseranreicherung
Laseranwendung
laboratory test
charger reader device
charging‐discharging system (for robots)
boost‐pressure controller
loading device
load chamber
absolute loading
bootstrapping (of program)
load point
loading device
load‐and‐go assembler
charge emission detector
position deviation
position balance
position determination (of s)
position finder
position identification, position perception (recognition)
position recognition procedure
position fixing, position fixage
position fixing
position fixage
position information
sensor position information
stock
position control
position control system
regulation of position
position[ing] controller
store v
support of grip organ, grip organ bearing
bearing of robot lever (arm)
position sensor
position sensor system
position protection, protection of position
element of position protection
Lagrangian function
Lagrangian multiplier method
LAMA, language for automatic mechanical assembly
lamina of grip organ
streamline regime
lamp signalling
boost‐pressure gauge
assembly movement length
linear heat rate
long‐chain
long‐chain branching
long‐term speed variation
longitudinal movement
longitudinal differential protection
longitudinal multipoint sensor
longitudinal multipoint sensor
longitudinal stability
long‐term stability
long‐run test
long‐time test
long‐term effect
Laplace
Laplace‐operator
Laplace operator
inverse Laplace transformation
Laplace transformation
Laplace transformation
Laplace‐transform pair
Laplace‐transform
continuous‐time transfer function
Laplace continuous‐time transfer function
Laplace operator
noise emission
noise protection
short‐pulse laser
long‐pulse laser
laser rounding
scanning laser radar
laser arrangement
laser enrichment
laser application
stran 153 od 326
EN ‐DE: slovar avtomatizacije in robotike Laseranzielen
Laserapertur
Laseraufklärungsgerät
Laserausgangscharakteristik
Laserausgangsleistung
Laserausgangsspektrum
Laserausstrahlung
Laserbeschleunigungsmesser
Laserbestrahlung
Laserbetrieb
Laserbetriebsintervall
Laserbetriebszeit
Laserbildschirm
Laserdarstellungssystem
Laserdatendarstellungsgerät
Laser‐Datenübertragungsleitung
Laserdatenverarbeitungsanlage
Laserdetektionssystem mit großer Ansprechgeschwindigkeit
Laserdrucker
Laserdruckmesser
Laserdurchflussmesser
Laserdurchschlagsvermögen
Lasereffekt
Lasereinstellung
Lasereinstrahlung
Laseremission
Laserempfängerstation
Laser‐Emulsionsspeicher
Laserenergie
Laserenergiequelle
Laserentfernungsmesser
Laserentfernungsmesser
Laserentfernungsmesser
Laserentfernungsmesser
Lasererfassungssystem
Lasererregung
Laserfernmeldeausrüstung
Laserfernmeldeeinrichtung f
Laserfokus
Laserfrequenz
Laserfrequenzstabilität
Lasergenerator
Lasergerät
Lasergewinn
Lasergyroskop
Laserhöhenmesser
Laserhöhenmesser
Laserimpulskompression
Laserimpulssteuerung
Laserinformationsdarstellungssystem
Laserinfrarotstrahlung
laserinterferometrische Justierung
Laserkanalkapazität
Laserkanalübertragungsfähigkeit
Laserkaskadenverbindung
Laserkreis
Laserleistungsschwankungen
Laserlenkung
Laserlesegerät
Laserlicht
Laserlicht
Laserlinienbreite
Lasermaschine
Lasermikrospektroanalysator
Lasermodulation
Lasernachlaufangaben
Lasernachlaufdaten pl
Lasernachrichtentechnik
Laser‐Nachrichtenübertragungssystem
Laserniveau
Laseröffnung
laseroptische Methode
Laseroszillator
Laserpegel
Laserradartechnik
Laser‐Raman‐System
laser aiming
laser aperture
laser search apparatus
laser output characteristic
laser output
laser output spectrum
laser emission
laser accelerometer
laser irradiation
laser operation
lasing time
lasing time
laser[‐scan] display
laser display system
laser data display equipment
laser data transmission line
laser data processing equipment
fast‐response laser detection system
laser[‐beam] printer
laser pressure gauge
laser flowmeter
laser piercing power
laser effect
laser alignment
laser irradiation
laser emission
laser receving station
laser‐emulsion storage
laser energy
laser power source
laser rangefinder
ranging laser
laser ranging device
laser ranging equipment
laser detection system
laser excitation
laser communication equipment
laser communication equipment
laser focus
laser frequency
laser frequency stability
laser generator
laser arrangement
laser gain
laser gyroscope
laser altimeter
laser altitude gauge
laser pulse compression
laser pulse control
laser information display system
infrared laser radiation
laser interferometric alignment
laser channel capacity
laser channel capacity
laser cascade connection
laser circuit
laser fluctuations
laser aiming
laser scanner
laser light
laser radiation
laser linewidth
laser machine
laser microspectroanalyzer
laser modulation
laser tracking data
laser tracking data
laser communication engineering
laser communication system
laser level
laser aperture
laser‐optical method
laser oscillator
laser level
laser radar technique
laser Raman system
stran 154 od 326
EN ‐DE: slovar avtomatizacije in robotike Laserrastermokroskop
Laserrückstrahl
Laserscanner
Laserschalter
Laserschnitt
Laserschwelle
Laserschwingungsdetektor
Laserschwingungserzeugung
Laserschwingzustand
Lasersendestation
Lasersendestation
Lasersignal
Laserspektroskopie
Laserstrahlablenkschaltung
Laserstrahlbearbeitungsmaschine
Laserstrahlbündelung
Laserstrahlendurchgriff
Laserstrahlerhitzung
Laserstrahlerwärmung
Laserstrahlfokussierung
Laserstrahlgefahr
Laserstrahlkohärenz
Laserstrahlmodulator
Laserstrahlschweißen laser
Laserstrahlsensor
Laserstrahlsensor
Laserstrahlung
Laserstrahlung
Lasersuchgerät
Lasersystem hoher Leistung
Lasertätigkeit
Lasertechnik
Laserüberlagerungsempfänger
Laserüberwachung
Laserverbindung
Laserverstärker
Laserverstärker mit aktivem Interferenzfilter
Laserverstärkerbandbreite
Laserweitverkehrsverbindung
Last‐ und Dehnungsmessung
Lastarm
Lastarmmanipulator
Lastaufnahme
Lastaufnahmegerät
Lastbegrenzer
Lasthebeeinrichtung
Lasthebeeinrichtung
Lastspannung
Lastteilverfahren
Lastwechsel
Latchregister
latente Reaktion
Latenzzeit
laufender Modus
Laufsimulation
Laufwerkplatte
Laufzeitcharakteristik
Laufzeitentzerrungsschaltung
Laufzeitkette
Laufzeitspeicher
Laufzeitsystem
Laufzeitverzerrung
Laufzeitverzerrung
Laugenbeständigkeit
Layout
Layout einer Montagestation
Layout eines Montageplatzes
Layout eines Montagesystems
Lebensdauer
Lebensdauer bei Belastung
Lebensdauerkurve
Lebensdauerprüfung
Lebensdauerprüfung bei konstanter Belastung
lecksichere Verkappung
Lecksicherheit
Leckstromeffekt
laser scanning microscope
return laser beam
laser scanner
laser switch
laser cut
laser threshold
vibration‐detecting laser apparatus
laser generation
oscillatory laser state
laser transmitting station
laser sending station
laser signal
laser spectroscopy
laser‐beam deflecting circuit
laser‐beam machining device
laser‐beam focusing
laser penetration
laser‐induced heating
laser‐induced heating
laser‐beam focusing
laser‐beam danger
laser coherence
laser‐beam modulator
laser‐beam welding
laser beam sensor
laser‐beam sensor
laser light
laser radiation
laser search apparatus
high‐power laser system
laser activity
laser technology
laser superheterodyne receiver
laser surveillance
laser communication
laser amplifier
active interference filter laser amplifier
laser amplifier bandwidth
long‐range laser communication
measurement of load and extension
weight arm
weight arm manipulator
load bearing capacity
load take‐up device
load limiter
load lifting device
manipulator load lift device, manipulator load lifting device,
load voltage
load sharing mode
load change
latch register
hidden response
latency time
current mode
simulation of movement
motor board
delay‐time characteristic
delay correction network
delayed‐line network chain
delay‐line memory
system of flight time, system of transit time
phase distortion
delay distortion
alkali resistance
layout
assembly station layout
layout of erection site
assembly system layout
operating life
load life
life curve
life test
constant‐stress life test
leak‐tight encapsulation
leak tightness
current leakage effect
stran 155 od 326
EN ‐DE: slovar avtomatizacije in robotike Leckstrommesser
electric leakage tester
leer
empty
Leerbefehl
blank instruction
leerer Zustand
idle state
Leergang
blank cycle
Leergang
idle cycle
Leergang
null cycle
Leerkontrolle
emptiness check[ing]
blank cycle
Leerlauf
idle cycle
Leerlauf
null cycle
Leerlauf
Leerlauf‐Abschaltautomatik vide
idling switching‐off automatic unit
Leerlaufarbeit
no‐load working
Leerlaufausgangskonduktanz
open circuit output conductance
idle mode
Leerlaufbetriebsart
no‐load characteristic
Leerlaufcharakteristik
unloaded characteristic
Leerlaufcharakteristik
Leerlaufeinrichtung vide
idling appliance
idle speed adjustment
Leerlaufeinstellung
Leerlaufgang
idling cycle
Leerlaufgeschwindigkeitseinstellung
idle speed adjustment
Leerlaufkennlinie
no‐load characteristic
Leerlaufkennlinie
unloaded characteristic
Leerlaufkontrolle
no‐load control
open‐circuit voltage
Leerlaufspannung
Leerlaufspannungsrückwirkungsfaktor
open circuit voltage transfer ratio
Leerlaufstrom
idle current
Leerlaufzustand vide
idling conditions
Leerspaltensucher
blank column detection device
Leerzustand
idle state
legieren (durch Roboter)
alloy to (by robot)
lehrender Automat
teaching automaton
lehrender Automat
teaching machine
initial value theorem
Lehrsatz vom Anfangswert
linearity theorem
Lehrsatz von der Linearität
lag theorem
Lehrsatz von der Phasennacheilung
leise laufender Gleichstrommotor (für Roboteranwendung) slight‐running DC‐motor (for robots application)
Leistung
performance
Leistung aufnehmen
absorb power v
Leistung eines Rechners
computer performance
Leistung
zero power
Leistung verbrauchen
absorb power v
Leistungsabfall eines Roboters
decrease in power of robot
Leistungsanforderung
performance requirement
Leistungsanpassung eines Roboters
power matching of robot, power adaptation of robot
performance evaluation
Leistungsauswertung
capacity demand
Leistungsbedarf
demand power
Leistungsbedarf
Leistungsbegrenzung eines Roboters
power limiting of robot
Leistungsbegrenzungsschutz
overpower protection
Leistungsberechnung feines Roboters
capacity rating of robot, capacity computation of robot
Leistungsbereich eines Roboters
capacity range of robot, robot power range
performance characteristics
Leistungscharakteristik
Leistungsdetektor
power detector
Leistungsdiagramm
rating chart
Leistungsdichte
power density
Leistungselektronik"eines Roboters
robot power electronics
efficient pulse transmission
leistungsfähige Impulsübertragung
leistungsfähiger Sensor
high‐capacity sensor
leistungsfähiger Sensor <
high‐capacity sensor
capacity
Leistungsfähigkeit
Leistungsfähigkeit eines Manipulators
manipulator performance
Leistungsfaktor eines Elektroantriebes electric drives blockin electric drive power coefficient
Leistungsfluss eines Industrieroboters
robot power flux, industrial robot power flux
Leistungsformel
power formula
Leistungsgrenze
limit of capacity
Leistungsgrenze eines Roboters power limit of robot
Leistungskennlinie
power of performance curve
Leistungskennwerte
performance characteristics
Leistungskreis
power circuit
Leistungskriterium
criterion of performance
Leistungsmodulation
intensity modulation
Leistungsniveau
level of capacity
Leistungsreferenz
performance reference
Leistungsregler
capacity controller
Leistungsschalter
power switch
stran 156 od 326
EN ‐DE: slovar avtomatizacije in robotike Leistungsschalter mit Schnellwiedereinschaltung
Leistungsschütz
Leistungsstabilisierung
Leistungsteiler
Leistungstransformator
Leistungstransiente
Leistungstreiber
Leistungsverbrauch im Bereitschaftszustand
Leistungsverlust power of performance curve 496
Leistungsvermögen
Leistungsverstärker
Leistungsverstärkung
Leitelement
Leiterplattenroboter
Leiterzug
Leiterzug
Leitfähigkeit
Leitfähigkeitsgeber
Leitfähigkeitsmessbrücke
Leitfähigkeitsregler
Leitfunktion Leitstation
Leitstrahlsteuerung
Leitstromkreis
Leitung
Leitungen des Unterbrechungsbusses
Leitungsadapter
Leitungsanpassung
Leitungsanpassungsteil
Leitungsanwahl
Leitungsband
Leitungseinrichtung
Leitungsimpedanz
Leitungskonzentrator
Leitungsrauschen
Leitungsrelais
Leitungsschema
Leitungssignal
Leitungssteuerung
Leitungsstrom
Leitungstakt
Leitungsteilnehmersystem
Leitungsteilungssystem
Leitungstreiber
Leitungsvermittlungssystem
Leitungunterbrechungsschutz
Leitweganzeiger
Leitwegkode
Leitwegtabelle
Leitwerk
Leitwerk
Leitwerk
Leitwert
Leitwertfunktion
Leitwertmatrix
Leitzahlenberechnung
lenkbar
lenken
Lenkung
Lenkung
Lenkung einer Robotermontage
Lenkungsphase
Lenkungsprogramm
Lenkungsrechner
lernender Automat
lernender Automat
lernender Rechenautomat
lernender Rechenautomat
lernendes Klassifikationssystem
Lernmaschine
Lernmaschine
Lernmodell
Lernphase
Lernprogramm
Lernroboter
Lernsystem
recloser
power contactor
power stabilization
power divider
power transformer
power transient
power driver
standby consumption
power loss
capacity
power amplifier
power amplification
pilot cell
circuit board robot
conducting path
conductor line, conducting path
conductivity
conductivity transmitter
conductivity measuring bridge
conductivity controller
steering function control station
command guidance
pilot circuit
management
lines of interruption bus
line adapter
line adaption
line adapter
line dialling
conduction band
line equipment
line impedance
line concentrator
line noise
line relay
connection diagram
line signal
line control
conduction current
line clock [pulse]
line‐sharing system
line‐sharing system
line driver
circuit switching system
open‐phase protection
routing indicator
routing code
routing table
controller
control device
control unit
conductance
admittance function
admittance matrix
guide numbers calculation
controllable
drive v
guidance
guide
steering of robot assembly
guidance phase
control program
guidance computer
learning machine
learning automaton
learning machine
learning automaton
learning classification system
learning machine
learning automaton
learning model
learning phase
learning program
learning robot
self‐learning system
stran 157 od 326
EN ‐DE: slovar avtomatizacije in robotike Lesebetrieb
Lesedaten pl
Lesegerät
Lesegerät
Leseimpuls
Leseoperation
Leser
Leser
Lese‐Schreib‐Zyklus
Lesestrom‐Schreibstrom‐Quelle
Leuchtdichteeinstellung
Leuchtdichteeinstellung
Leuchtsignal
Leuchtsignal
Leuchtsignal
lichtabhängiges Steuerglied
Lichtanlage
Lichtbogenautomatenschweißen
Lichtbogenschweißautomat
Lichtbogenschweißautomat
Lichtbogenschweißmanipulator
Lichtbogenschweißroboter
Lichtbogenschweißung durch Roboter
Lichtdetektor
lichtelektrisch leitend
lichtelektrische Emission
lichtelektrische Emission
lichtelektrische Steueranlagen
lichtelektrische Zelle
lichtelektrische Zelle
lichtelektrische Zelle
lichtelektrischer Abtaster
lichtelektrischer Impulsgeber
lichtelektrischer Verschiebungsgeber
lichtelektrisches Polarimeter
lichtelektronische Anlage
Lichtelement
Lichtelement
Lichtelement
Lichtgriffel
Lichtgriffel
Lichtgriffel
Lichtgriffel
Lichtimpuls
Lichtleiteranwendung
Lichtleiteranwendung
Lichtleitertechnik
Lichtleitertechnologie
Lichtleitertechnologie
Lichtleitertechnologie
Lichtleiterverbindungskarte (für Bus)
Lichtleitsensor
Lichtmessungsrechner
Lichtrelais
Lichtschrankenkontrolle
Lichtschrankensensor
Lichtsignal
Lichtsignal
Lichtsignal
Lichtspaltprüfeinrichtung
Lichtspaltregler
Lichtstift
Lichtstift
Lichtstift
Lichtstift
Lichtstiftanzeige
Lichtstiftempfindlichkeit
lichtstiftgesteuertes Programm
Lichtverlust (eines optischen Sensors)
Lichtwellengerät
Lichtwellenlängemaßeinheit
Lichtwellenleiter‐Messtechnik
Lichtwellenleiter‐Rechner‐Interface
Lichtwellenleitersystem
Lichtwellenleiter‐Übertragungsfunktion
Lidar mit hohem Auflösungsvermögen
read[ing] operation
read data
reading device
reader
reading pulse
read[ing] operation
reading device
reader
read‐write cycle
read‐write current source
brightness control
luminance control
light signal, luminous signal
light signal
luminous signal
light‐dependent control element
lighting installation
automatic arc welding
automatic arc welding equipment
automatic arc welding machine
arc welding manipulator
arc welding robot
arc welding by robot
light detector
photoconductive
photoelectric emission
photoemission
photoelectric control equipments
photoelectric cell
photocell
photoelement
photoelectric scanner
photoelectric pulse maker
photoelectric displacement transmitter
photoelectric polarimeter
photoelectronic installation
photoelectric cell
photocell
photoelement
light pen
light stylos
beam pen
electronic pen
light impulse
fibre optics application
fibre optics application, fiber optics application (US)
fibre optics technique, fiber optics technique (US)
light conductor technology, optical fibres technology (US: opti
light conductor technology
optical fibres technology
light line connecting card (for bus)
light conducting sensor
photometric computer
light relay
light barrier checking
light barrier sensor
light signal, luminous signal
light signal
luminous signal
light‐gap testing equipment
light‐gap regulator
light pen
light stylos
beam pen
electronic pen
light pen display
light pen sensitivity
light‐pen‐controlled program
light loss (of optical sensor)
light‐wave device
light‐wave measuring unit
optical fiber measurements
fiber optic computer interface
optical fiber system
optical fiber transfer function
high‐definition lidar
stran 158 od 326
EN ‐DE: slovar avtomatizacije in robotike linear ansteigendes Signal
linear geführtes Bauelement
linear unabhängig
linear wachsende Funktion
Linearabmessung
Linearantrieb
Linearbeschleuniger
Lineardämpfung
Lineardispersion
lineare (einreihige) Anordnung
lineare Abhängigkeit
lineare Abmessung
lineare algebraische Gleichung
lineare Annäherung
lineare Backenbewegung
lineare Bahninterpolation
lineare Beschränkungen
lineare Dämpfung
lineare Dichte
lineare Dispersion
lineare Einstellgenauigkeit
lineare Extrapolation
lineare Extrapolationslänge
lineare Funktion
lineare Gleichrichtung
lineare Interpolation
lineare Koordinatenumformung
lineare Nenngeschwindigkeit
lineare Polarisation
lineare Programmierung
lineare Regelung
lineare Roboterbewegungsgleichung
lineare Skale
lineare Stellungsregelung
lineare Systemanteile mpi
lineare Systemanteile
lineare Systemtheorie
lineare Übertragungsfunktion
lineare Unabhängigkeit
lineare Verschiebung
lineare Verschiebungsgeschwindigkeit (Roboter)
lineare Verzerrung
lineare Wärmebelastung
lineare Zerlegung
Lineareinheit
Lineareinheitenaufbau
linear‐elastische Bruchmechanik
linearer Akteur
linearer Akteur
linearer Akteur
linearer Arbeitsbereich
linearer Automat
linearer Bereich
linearer Effektor
linearer Empfänger
linearer Extrapolationsabstand
linearer Fehler
linearer Grad
linearer Impulsverstärker
linearer Kode
linearer Robotermodul
linearer Schaltkreis
linearer Stellantrieb
linearer Wandler
linearer Wärmeausdehnungskoeffizient
lineares
lineares Bewegungsglied
lineares Bewegungsglied
lineares Bewegungsglied
lineares diskretes System
lineares einschleifiges Regelungssystem
lineares Einstellen
lineares Entkopplungsglied
lineares Filter
lineares Gleichungssystem
lineares Glied
linear rising signal
linear‐guided component
linearly independent
ramp function
linear dimension
linear drive
linear accelerator
linear damping
linear dispersion
in‐line array
linear dependence
linear dimension
linear algebraic equation
linear approximation
linear jaw movement
linear trajectory interpolation
linear constraints
linear attenuation
linear density
linear dispersion
linear adjusting accuracy
linear extrapolation
linear extrapolation distance
linear function
linear detection
linear interpolation
linear transformation of coordinates
rated linear speed
linear polarization
linear programming
linear control
linear robot motion equation
linear scale
linear position control
linear system parts
linear system parts
linear system theory
linear transfer function
linear independence
linear displacement
linear displacement speed
linear distortion
linear heat rate
line[ar] scanning
linear unit
linear unit structure
linear‐elastic fracture mechanics
linear joint, linear acting element
linear joint
linear acting element
linear‐mode region
linear automaton
linear range
linear actuator
linear receiver
linear extrapolation distance
linear error
linear degree
linear pulse amplifier
linear code
linear robot module, linear module of robot
linear switching circuit
linear control electromechanism
linear transducer
coefficient of linear thermal expansion
linear
linear joint, linear acting element
linear joint
linear acting element
linear discrete‐time system
linear single‐loop control system
linear adjusting
linear decoupling joint
linear filter
linear equation system
linear element
stran 159 od 326
EN ‐DE: slovar avtomatizacije in robotike lineares Glied
lineares Integralkriterium
lineares Modell
lineares Optimierungsprogramm
lineares Regelungssystem
lineares Robotermodell
lineares Robotersystem
lineares stationäres System lineares System
lineares System mit variablen Koeffizienten
lineares System mit variablen Koeffizienten
lineares Tastsystem
lineares Übertragungsglied
lineares zeitinvariantes Regelungssystem
Linearfilter
Linearfrequenzspektrum
Linearfunktion
Lineargeschwindigkeit eines Roboters
linearisieren
linearisiertes Systemmodell
Linearisierung
Linearisierung der Abtastung
Linearisierung der Relaissysteme
Linearisierung der Roboterbewegung
Linearisierung durch die Methode kleiner Schwingungen
Linearisierung durch kleine Abweichungen
Linearisierung feiner Roboterregelung
Linearisierungsbereich
Linearität
Linearität von kapazitiven Mikrometern
Linearität von Strahlungsempfängern
Linearitätsbereich
Linearitätsbereich
Linearitätsfehler
Linearitätsprinzip
Linearitätsregelung
Linearkanal
linear‐logarithmischer Umsetzer
Linearmotor
Linearoptimierung
Linearpotentiometer
Linearregelung
Linearspeicher
Linearstromkreis
Linearstromkreis
Linearsystem mit variablen Parametern
linearte Optimalsysteme
linearveränderlicher Widerstand
Linearverschiebung
Linearverstärker
Linearwiderstandsdurchflussmesser
Linearzeitablenkgenerator
linguistische Regel
linguistische Variable
linguistischer Bezeichner
linguistischer Bezeichner
linguistischer Modifikator
linguistischer Modifikator
linguistischer Wertname
linguistischer Wertname
linguistischer Wertname
Linie konstanter Phase
Linienaktivität
Linienaufzeichnung
linienbeschreibendes Element
Liniendichte
Linieninterface
Linienrelais
Linienrelais
Linienrelais
Linienschreiber
Linienspektrum
Linienstruktur
linke s‐Halbebene
Links‐Max‐Methode
Lipschitz‐Bedingung
linear block
integral linear estimation
linear model
linear optimization program
linear control system
linear robot model
linear robot system
stationary linear system linear system
variable coefficient system
[linear] system of variable coefficients
linear discrete‐time system
linear transfer circuit
linear time‐invariant (LTI) control system
linear filter
linear frequency spectrum
linear function
linear speed of robot
linearize v
linearized system model
linearization
scanning linearization
linearization of relay systems
linearization of robot movement
linearization by method of small oscillations
small deflection method linearization
linearization of robot regulation
linearization range
linearity
linearity of capacitive micrometers
linearity of radiation receivers
zone of linearity
range of linearity
linearity error
principle of linearity
linearity control
linear channel
linear‐to‐log converter
linear motor
linear optimization
linear potentiometer
linear control
linear store
linear circuit
linear network
linear system with variable parameters
linear optimal systems
linear variable resistor
linear displacement
linear amplifier
linear resistance flowmeter
linear sweep generator
linguistic rule
linguistic variable
linguistic descriptor
linguistic label
linguistic hedge
linguistic modifier
linguistic label
linguistic term
linguistic value
phase contour
linear activity
continuous record
line‐descriptive element
linear density
line interface
line relay
calling relay
ringing relay
recorder with linear recording
line spectrum
line pattern
left half s‐plane (LHP)
first of maxima (FOM) defuzzification
Lipschitz condition
stran 160 od 326
EN ‐DE: slovar avtomatizacije in robotike Liste aktiver Aufgaben
Liste aktiver Aufgaben
Liste der Positionskoordinaten Liste der Verweisadressen
Listendatei
Listenkapitel
Listennamenerklärung r
Listenprogramm
Listenprogrammsystem
Ljapunow‐Funktion
Lochgreifer
logarithmische Additivität
logarithmische Amplitudencharakteristik
logarithmische Amplitudenfrequenzcharakteristik
logarithmischer Rechenstromkreis
logarithmischer Verstärker
logarithmisches Arbeitsprinzip
logarithmisches Dämpfungsglied
logarithmisches Register
logarithmisches Suchverfahren
Logik
Logik im Nanosekundenbereich
Logikanalysator
Logikanalyse
Logikanalyse
Logikbauteil
Logikentwurf einer Rechenmaschine
Logikschalter
Logiksimulation
Logiktabelle
Logiktester
logische Analyse
logische Analyse
logische Datenverarbeitung
logische Entscheidungsfunktion
logische Folgesteuerung
logische Führung
logische Funktion
logische Funktion
logische Grundfunktion
logische Grundschaltung
logische Implikation
logische Interfacebedingung
logische Kombinationsfunktion
logische Komponente
logische Leitung
logische Multiplikation
logische NICHT‐Schaltung
logische ODER‐Schaltung
logische Operation
logische Operation des Steuersystems
logische Operationsschaltung
logische UND‐Schaltung
logische Verknüpfung
logische Verschiebung
logischer Adder
logischer Ausdruck
logischer Automat
logischer Befehl
logischer Block
logischer Entwurf
logischer Entwurf von Schaltkreisen
logischer Fehler
logischer Impuls
logischer Kanal
logischer Vergleich
logischer Vorgang
logisches Anzeigesystem
logisches Diagramm
logisches Element
logisches Element
logisches Element der Analogrechenmaschine
logisches Gatter
logisches Glied
logisches Grundelement
logisches Kombinationselement
active task list
active task list, ATL
list of position coordinates
list of look‐up addresses
report file
report section
report description entry
list program
list program system
Liapunov function
hole gripper
logarithmic additivity
logarithmic amplitude characteristic
decibel‐log‐frequency
logarithmic computing circuit
logarithmic amplifier
logarithmic work principle
logarithmic attenuator
logarithmic register
logarithmic search method
logic
nanosecond logic
logic[‐state] analyzer
logic analysis, logical analysis
logic[al] analysis
logic device
machine logic design
logic switch
logic simulation
truth table
logic tester
logic analysis, logical analysis
logic[al] analysis
logical data processing
logical decision function
logic sequential control
logical direction
binary function
logic function
basic logic function
logic base circuit
logic implication
logical interface condition
combination logic function
logical component
logical direction
logical multiplication
logical NOT circuit
logical OR circuit
logic operation
logical operation of control system
operational logical circuit
logical AND circuit
logical connection
logical shift
logical adder
logical expression
logical automaton
logic instruction
logical block
logical design
logical design of switching circuits
logical error
logic pulse
logical channel
logical comparison
logic operation
logic display system
logical diagram
decision element
logical element
analog computer logical element
logical gate element
logical component
basic logic element
combinational logic element
stran 161 od 326
EN ‐DE: slovar avtomatizacije in robotike logisches Luftstrahlelement
logisches Netz
logisches Programmschema
logisches Rauschen
logisches Schaltelement
logisches Signal
logisches Steuersignal
logisches System
logisches Zeitelement
Logistik
lokale Betriebsweise
lokale Buserweiterung
lokale Datenerfassung
lokale Einheit
lokale Managementschnittstelle
lokale Nebenanlage
lokale Roboterzeile
lokale Rückführung
lokale Stabilität
lokale Stabilität
lokale Steuerung
lokale Struktur
lokale Verarbeitung
lokaler Iterationsblock
lokaler Kondensator
lokales Management‐Interface
lokales Netz
Lokalisation eines Fügelochs
lokalisieren
lokalisierter Roboterfehler
lokalisiertes Bauelement
Lokalisierung
Lokalisierungssystem
lokomotorische Roboterfunktion
Lokutor
Longitudinaldifferentialabschirmung
Lösbarkeit
löschbarer programmierbarer Festspeicher
löschbarer Speicher
Löschen der Information
Löschen eines Roboterprogramms
Löschimpuls
Löschimpuls
Löschkreis
Löschkreis
Löschschalter
Löschtreiber
Löschwiderstand
Lose
Lose
Lösen einer Bondverbindung
Lösung im eingeschwungenen Zustand
Lösung von Anfangswertproblemen
Lösungsfehler löten (durch Roboter)
Lötpistole
Lötpistoleneffektor
Lötroboter
Low‐High‐Übergang
Low‐Logikpegel
Low‐Power‐System
Low‐Zustand
Luenenburger‐Beobachter
luftangetrieben Luftaufbereiter Luftaufbereitungsanlage Luftaufbereitungssystem Luftbehälter
Luftbremsdynamometer Luftdämpfung
Luftdrosselklappe
Luftdruckprüfung Luftdruckregler Lufteintritt
Lufteintritt
Lufteintritt
logical element of air jet
logical net
logical program scheme
logical noise
logical switching element
logical signal
logical control signal
logical system
timing logic element
logistics
local mode
local bus extension
local data collection
local unit
local management interface
local extension plant
local robot cell
local feedback
stability in the small
local stability
local control
local structure
local processing
local iteration block
local capacitor
local management interface
local network
jointing hole localization
localize v
localized robot error
localized component
localization
localization system
locomotoric robot function
locutor
longitudinal differential protection
solvability erasable programmable read‐only memory, EPROM
erasable store
erasure of information
clearing of robot program
extinction pulse
reset pulse
blanking circuit
quenching circuit
eraser switch
erase driver
quenching resistance
backlash nonlinearity
system with play
bond failure
periodic solution
solution of initial value problems solution error solder to (by robot)
soldering pistol
effector of soldering pistol
soldering robot
low[‐to]‐high transition
logic low level
low‐power system
low state
Luenenburger observer
air‐powered air handler air handling plant air‐processing system air chamber air‐brake dynamometer air damping air throttling damper
air‐pressure test air‐pressure regulator air entry
access of air
air inlet stran 162 od 326
EN ‐DE: slovar avtomatizacije in robotike Luftfeuchtigkeitsanzeiger
Luftführungssystem luftgekühlter Reaktor Luftkammer Luftkontaminationsanzeiger Luftkontaminationsmesser
Luftkontaminationsmessgerät
Luftkreislauf
Luftkreislauf
Luftkühlsystem Luftkühlung Luftparameter Luftprobenehmer Luftprobensammler
Luftregler
Luftregler Luftregulierungsventil
Luftregulierungsventil Luftreinigungsanlage Luftschütz Luftspaltmethode Luftstrahlelement
Lufttrennungsanlage
Lufttrennungsanlage
Lufttrocknungsanlage Luftturbulenz
Luftüberwachungsgerät Lüftungsanlage
Lüftungsanlage
Luftzerlegungsanlage
Luftzerlegungsanlage
Luftzirkulation Luftzirkulation Luftzuführung
Luftzuführung
Luftzuführung
Luftzuleitung
Luftzuleitung
Luftzuleitung
Luftzutritt
Luftzutritt
Luftzutritt
Lyapunow‐Funktion
m automatisiertes digitales Ein‐und Ausgabesystem
m Computerinterface eines IR
m eines Handhabungsgerätes
m einfache Montageoperation
m einfacher Sensor
m horizontale Verschiebung eines Roboterarms
m integrierte Steuerung
m konstruktives Robotermerkmal
m koordinierte Industrieroboter
m korrigierter Informationsträger
m mechanische Greifereinrichtung
m mechanische vollautomatische Produktion
m Robotertechniker
m s. 124
m s. C 373
m s. H 110
Maclaurinsche Reihenentwicklung
Magazin eines Industrieroboters
Magazinierplatz
Magaziniersystem
Magazinierungstechnik
Magnetanalysator
Magnetaufzeichnungstechnik
Magnetband
Magnetbandeinheit Magnetbandeinheit Magnetbandeinheit Magnetbandgerät
Magnetbandgerät
Magnetbandgerät
Magnetbandkassette r*
Magnetbandmodus
magnetbandorientiertes Programmsystem
hygroscope
air duct circuit air‐cooled reactor air chamber air contamination indicator air contamination meter air contamination meter air circulation
air cycle air cooling system air cooling air conditions air sampler air sampler anemostat
air regulator air regulating valve
air regulating valve air cleaning plant air‐break contactor air‐gap method element of air jet
air separator
air separation plant air drying plant air turbulence
air monitor air ventilation system
fan system
air separator
air separation plant air circulation
air cycle air entry
access of air
air inlet air entry
access of air
air inlet air entry
access of air
air inlet Lyapunov function
automatic digital input‐output system, ADIOS
computer interface of IR
of handling device
simple assembly operation
simple sensor
horizontal shifting] of robot arm
integrated control
constructive robot feature
coordinated industrial robots
corrected information carrier
mechanical gripper equipment
mechanical full‐automatic production
robot technician
flexible production element
contact piece
hydraulic IR control
Maclaurin expansion
robot magazine, magazine of industrial robot
storage place, storing place
storage system
storing technique
magnetic analyzer
magnetic recording technique
mag[netic] tape
magnetic tape device
tape device
tape unit
magnetic tape device
tape device
tape unit
information carrier cartridge (casket), magnetic tape casket
[magnetic] tape mode
magnetic tape‐oriented program system
stran 163 od 326
EN ‐DE: slovar avtomatizacije in robotike Magnetblasenspeicher‐Einheit
magnetempfindlicher Sensor
Magnetfeldsensor
Magnetfeldstabilisierung
Magnetflussdichte
Magnetflussmesser
Magnetflussstabilisator
Magnetgreifeinheit
Magnetgreifer
Magnethalter
magnetisch abgeschirmtes Instrument
magnetisch aufgezeichnetes Programm
magnetische Ablenkung
magnetische Anziehungskraft
magnetische Anziehungskraft Magnetblasenspeicher
magnetische Dämpfung
magnetische Demodulation
magnetische Eigenschaften
magnetische Feldstärke
magnetische Hysterese
magnetische Hysterese
magnetische Induktion
magnetische Kernresonanzspektrometrie
magnetische Kopplung
magnetische Kopplung
magnetische Kopplung
magnetische Mikropulsation
magnetische Nuklearresonanz
magnetische Permeabilität
magnetische Polarisation
magnetische Sättigung
magnetische Schirmung
magnetische Schnellauslösung
magnetische Steuereinrichtung
magnetische Störung
magnetische Streuung
magnetische Verluste
magnetische Verzögerungsleitung
magnetischer Abschwächer
magnetischer Analog‐Digital‐Umsetzer
magnetischer Analysator
magnetischer Drucksensor
magnetischer Feldstärkenmesser
magnetischer Fluss
magnetischer Gasanalysator
magnetischer Kreis
magnetischer Schwimmerniveaugeber
magnetischer Sensor
magnetischer Spannungsregler
magnetischer Spektrograf
magnetischer Träger
magnetischer Verstärker mit Selbstsättigung
magnetisches Elektronenspektrometer
magnetisches Laufzeitglied
magnetisches Momentanrelais
magnetisches Objekt
magnetisches Potential
magnetisches Schalten
magnetisches Thermorelais
magnetisches Variometer
magnetisches Ventil
magnetisches Verknüpfungsglied
magnetisches Zeitrelais
Magnetisierungskurve
Magnetisierungsrichtung
Magnetisierungsvektor
Magnetisierungswicklung
magnetoakustische Verzögerungsleitung
magnetoelektrischer Sensor
magnetoelektrischer Wandler
Magnetohydrodynamik
magnetomechanische Dämpfung
magnetomechanischer Gasanalysator
Magnetometer mit sättigungsfähigem Kern
magnetooptische Anzeige
magnetooptischer Effekt
bubble memory device, BMD, magnetic bubble memory unit
magnetic‐sensitive sensor
magnetic field sensor
magnetic field stabilization
magnetic flux density
magnetic fluxmeter
magnetic flux stabilizer
magnetic grip unit
magnetic gripper
magnetic pick‐up
instrument with magnetic screening
magnetically recorded program
magnetic deflection
magnetic attractive force
magnetic attractive force
magnetic damping
magnetic demodulation
magnetic characteristics
magnetic field intensity
magnetic hysteresis
magnetic lag
magnetic induction
magnetic nuclear resonance spectrometry
induction coupling
inductive coupling
magnetic coupling
magnetic micropulsation
magnetic nuclear resonance
magnetic permeability
magnetic polarization
magnetic saturation
magnetic shield
instantaneous magnetic relay
magnetic controlling equipment
magnetic perturbation
magnetic leakage
magnetic loss
magnetic delay line
magnetic attenuator
magnetic analog‐digital converter
magnetic analyzer
magnetic pressure sensor
magnetic field strength meter
magnetic current
magnetic gas analyzer
magnetic circuit
magnetic float‐type level transmitter
magnetic sensor
magnetic voltage controller
magnetic spectrograph
magnetic carrier
self‐saturated magnetic amplifier
magnetic electron spectrometer
magnetic delay line
instantaneous magnetic relay
magnetic object
magnetic potential
magnetic switching
magnetic thermal relay
magnetic variometer
magnetic valve
magnetic logical element
magnetic time relay
magnetization curve
direction of magnetization
magnetization vector
excitation winding
magnetoacoustic delay line
magnetoelectric sensor
magnetoelectric transducer
magneto‐fluid dynamics
magnetomechanical damping
magnetomechanical gas analyzer
saturable magnetometer
magnetooptical diplay
magnetooptical effect
stran 164 od 326
EN ‐DE: slovar avtomatizacije in robotike Magnetostriktion
magnetostriction
Magnetostriktionsfilter
magnetostrictive filter
Magnetostriktionsgenerator
magnetostriction oscillator
Magnetostriktionsgenerator
magnetostrictor
Magnetostriktionsregelung
magnetostriction control
magnetostriktive Verzögerungsleitung
magnetostriction delay line
magnetostriktive Verzögerungsleitung
magnetostrictive delay line
magnetostriktiver Oszillator
magnetostriction oscillator
magnetostriktiver Oszillator
magnetostrictor
magnetic tester
Magnetprüfgerät
Magnetrotorbunker
magnetic rotor bunker
Magnetventil solenoid valve Magnetverstärkersteuerung elektrischer Getriebe
magnetic amplifier electric drive control
Magnistor
magnistor
Majorante
majorant
Majoritätselement
majority element
Majoritätsfunktion
majority function
Makbus
mak bus
Makrobefehl
macroinstruction
Makrobefehl
macrocommand
Makrobefehl
macrocode
Makrobefehl
macro[s]
Makrobewegung feines Industrieroboters
robot macro‐movement, macro‐movement of industrial robot
Makrobibliothek
Macro library
Makroblock
macroblock
Makrodefinition
macrodefinition
Makroeinrichtung
macrofacility
Makrogenerator
macrogenerating program
Makrogenerator
macrogenerator
Makrogenerierprogramm
macrogenerating program
Makrogenerierprogramm
macrogenerator
Makroinstruktion
macroinstruction
Makroinstruktion
macrocommand
Makroinstruktion
macrocode
Makroinstruktion
macro[s]
Makrooperation
macrooperation
Makrooperationsspezifikation
macrodefinition
Makroprogrammierung
macroprogramming
Makroprozessor
macroprocessor
Makros
macroinstruction
Makros
macrocommand
Makros
macrocode
Makros
macro[s]
Mamdani implication
Mamdani Implikation
MA‐Modell
MA model
MA‐Modell
moving‐average model
Management
management
Management‐Informationsbasis
management information base
Managementlehre
management science
Manipulator
manipulator, handler
Manipulator für Arbeitsmittelbewegungen
(manipulator), handler for working medium movement
Manipulator für Druckgießen
pressure cast[ing] manipulator, pressure moulding handler
Manipulator für Keramikpressen
ceramic pressing manipulator
Manipulator für Keramikpressen
ceramic pressing manipulator, ceramic pressing handler
Manipulator für Keramikpressen
ceramic pressing handler
Manipulator für Nahtschweißen
seam welding handler (manipulator)
Manipulator für Punktschweißen
spot welding manipulator
Manipulator für Spritzgießen (von Plasten)
manipulator for moulding by injection (of plastic material), US
Manipulator für Transport‐Operationen
manipulator for transport operations
Manipulator für Umladeoperationen
manipulator of transshipment operations
tool manipulator, manipulator for toot movement
Manipulator für Werkzeugbewegung
Manipulator klasse
manipulator class
Manipulator mit amerikanischen Normen
manipulator with American standard
Manipulator mit drei Freiheitsgraden
manipulator with three degrees of freedom
Manipulator mit europäischen Normen
manipulator with European standards
Manipulator mit kartesischem Arbeitsraum
manipulator with Cartesian working room
Manipulator mit numerischer Struktur
manipulator with numerical structure
Manipulator mit Positionsregelung positionnement
manipulator with position control
Manipulator mit Positionsregelung positionnement
position controlled manipulator
Manipulator mit sechs Freiheitsgraden
manipulator with six degrees of freedom
Manipulator mit zentraler Führungssäule
manipulator with central guide column
Manipulator mit zylindrischem Arbeitsraum
manipulator with cylindrical working room
Manipulator zur automatischen Handhabung von Bauelement automatic component handler
Manipulatorabsolutposition
absolute position of manipulator
Manipulatoranalyse
analysis of manipulator
Manipulatoranordnung
manipulator arrangement
stran 165 od 326
EN ‐DE: slovar avtomatizacije in robotike Manipulatoranordnungsvariante
Manipulatoranpassung
Manipulatorantrieb
Manipulatorantriebsvariante
Manipulatorarbeitsebene
Manipulatorarbeitsplatz
Manipulatorarm
Manipulatorarmgenauigkeit
Manipulatorausfallzeit
Manipulatorauslastung
Manipulatorbahn
Manipulatorbahnsteuerung
Manipulatorbasiskoordinate
Manipulatorbaueinheit
Manipulatorbaueinheit
Manipulatorbaukastensystem
Manipulatorbefehl
Manipulatorberechnung
Manipulatorbereich
Manipulatorbereich
Manipulatorbeweglichkeit
Manipulatorbewegungsbefehl
Manipulatorbewegungsgleichung
Manipulatorbewegungszyklus
Manipulatordaten pl
Manipulatordaten pl
Manipulatordaten pl
Manipulatordefektanalyse
Manipulatordefektauswirkung
Manipulatordimensionierung
Manipulatordreheinheit
Manipulatordynamik
Manipulatoreinheit
Manipulatoreinrichtung
Manipulatoreinsatz
Manipulatoreinsatzbedingung
Manipulatorelement
Manipulatorendpunkt
Manipulatorendpunktlage
Manipulatorendschalter
Manipulatorenergie
Manipulatorentwicklungsplan
Manipulatorentwicklungsprojekt
Manipulatorfeinpositionierung
Manipulatorfreiheitsgrad
Manipulatorführung
Manipulatorführungsschiene
Manipulatorgelenkeinheit
Manipulatorgelenkkoordinaten
Manipulatorgeneration
Manipulatorgeschwindigkeit
Manipulatorgestaltung
Manipulatorgestell
Manipulatorgestellelement
Manipulatorgestellsystematik
Manipulatorgrobposition
Manipulatorgröße
Manipulatorgrundausstattung
Manipulatorgrundbaugruppe
Manipulatorgrundplatte
Manipulatorhand
Manipulatorhaupttechnologien
Manipulatorinstallation
Manipulatorinstallation
Manipulatorkennzeichnung
Manipulatorkontaktelement
Manipulatorkontrolle
Manipulatorkontrolle
Manipulatorkontrolle
Manipulatorkoordinatenbasis
Manipulatorlasthebeeinrichtung
Manipulatorleistungsfähigkeit
Manipulator‐Maschine‐Zuordnung
Manipulatormodell
Manipulatorobjektbewegung
Manipulatorobjektmasse
manipulator arrangement variant
manipulator adaptation
manipulator drive
manipulator drive variant
manipulator working plane
manipulator operator position, handler operator position, man
manipulator arm
accuracy of manipulator arm
manipulator downtime
manipulator utilization
manipulator track
manipulator track control
manipulator base coordinate
construction unit of manipulator
construction unit of manipulator, manipulator construction un
manipulator building‐block system
manipulator instruction
manipulator calculation
range of manipulateur
range of manipulator
manipulator mobility, mobility of manipulator
manipulator movement instruction
manipulator motion equation
manipulator movement cycle, handler movement cycle
manipulator parameters, manipulator data
manipulator parameters
manipulator data
manipulator defect analysis
manipulator defect effect
manipulator dimensioning
manipulator rotation unit
manipulator dynamics
manipulator unit
manipulator equipment
manipulator use, manipulator application
manipulator application condition
manipulator element
manipulator end point
manipulator end point position
limit switch of manipulator
manipulator energy
manipulator development plan
manipulator development project
manipulator fine position
degree of freedom of manipulator
manipulator guide
manipulator guide rail
manipulator joint unit
manipulator joint coordinates
manipulator generation
manipulator speed
manipulator shaping
manipulator frame
manipulator frame element
manipulator frame systematic
coarse position of manipulator
manipulator size
manipulator basic equipment
manipulator basic unit
manipulator base plate
manipulator hand, handler hand
main technologies of manipulators
instalation of manipulator
installation of manipulator
manipulator marking
manipulator contact element
manipulator checking, handler checking
manipulator checking
handler checking
manipulator coordinate base
manipulator load lift device, manipulator load lifting device,
manipulator performance
manipulator‐machine coordination
manipulator model
manipulator object movement
manipulator object mass
stran 166 od 326
EN ‐DE: slovar avtomatizacije in robotike Manipulatorparameter
Manipulatorparameter
Manipulatorparameter
Manipulator‐Pedipulator‐System
Manipulatorplatzbedarf
Manipulatorportalwagen
Manipulatorposition
Manipulatorpositionierung
Manipulatorpositionsdaten pl
Manipulatorpräzision
Manipulatorpunktsteuerung
Manipulatorrechnersteuerung
Manipulatorregelstrecke
Manipulatorregelungssystem
Manipulatorreglerstrecke
Manipulatorroboter
Manipulatorschlitten
Manipulatorschritt
Manipulatorsequenz
Manipulator‐Soft‐Greifer
Manipulatorspeicher
Manipulatorspeicher
Manipulatorspeicherebene
Manipulatorsprache
Manipulatorstellung
Manipulatorsteuerhebel
Manipulatorsteuerimpuls
Manipulatorsteuersystem
Manipulatorsteuerung
Manipulatorsteuerungsdaten
Manipulatorsteuerungsdaten pl
Manipulatorstruktur
Manipulatorsystem
Manipulatortechnik
Manipulatortechnik
Manipulatortisch
Manipulatorträger
Manipulatortragfähigkeit
Manipulatortyp
Manipulatorübergabepunkt
Manipulatorüberwachung
Manipulatorwartung
Manipulatorwiederholgenauigkeit
Manipulatorzusatzeinrichtung
Manipulatorzustand
Manipulatorzustand
Manipulatorzustand
Manipulatorzustandsfolge
manipulieren
manipulieren
manipulierte Roboterdaten pl
manipuliertes Objekt
Mannigfaltigkeit
Manometerprüfpresse
manuell geführter Effektor
manuell gesteuerter Manipulator
manuelle Montage
manuelle Programmierung
manuelle Roboterprogrammierung
manuelle Robotersteuerung
manuelles Auswechseln der Greiforgane
manuelles Entgraten
Markierimpuls
Markierungsschaltung
Markowscher Prozess
Marktposition
maschinelle Bearbeitung
maschinelle Datenerfassung
maschinelle Datenerfassung
maschinelle Programmierung
maschinelle Rechentechnik
maschinenabhängige Robotertechnik
Maschinenanordnung
Maschinenausfall
Maschinenauslastung
Maschinenauslastung
manipulator parameters, manipulator data
manipulator parameters
manipulator data
manipulator‐pedipulator system
manipulator floor space required
manipulator portal car
manipulator position
manipulator positioning
position data of manipulator
manipulator precision
manipulator point control
manipulator computer control
controlled system of manipulator
manipulator control system
manipulator regulator distance
manipulator robot
manipulator carriage
manipulator step, handler step
manipulator sequence
manipulator soft gripper
manipulator memory
manipulator memory (store)
manipulator memory (store) plane
manipulator language, ML
position of manipulator
manipulator control lever
manipulator control impulsion
manipulator control system
manipulator control, handler control
data of manipulator control
data of manipulator control
manipulator structure
manipulator system
manipulator technique
manipulator technique'
manipulator table
manipulator support
manipulator load‐carrying capacity
manipulator type
manipulator transfer point
manipulator monitoring
manipulator servicing, manipulator maintenance
manipulator repetition precision
manipulator additional device
manipulator state, manipulator condition
manipulator state
manipulator condition
manipulator state sequence
handle v
manipulate v
manipulated robot data
manipulated object
variety
manometer test press
manual guided effector
Hand‐controlled manipulator, manual‐controlled manipulator
manual assembly
manual programming
manual robot programming
manual robot control
manual interchange of grip organs
manual trimming
marker impulse
marking circuit
Markovian process
market place
machining
mechanical data acquisition
mechanical data collection
computer‐assisted programming
machine‐computing technique
machine‐dependent robotics (robots technique)
machine arrangement
machine failure
machine utilization, assembly machine utilization
machine load
stran 167 od 326
EN ‐DE: slovar avtomatizacije in robotike Maschinenautomatisierung
Maschinenbedingung
Maschinenbefehl
Maschinenbelastung
Maschinenbeschickung
Maschinendarstellung
Maschinendefektanalyse
Maschinendefektauswirkung
Maschinenfunktionsschaltung
Maschinengestell
Maschinengleichung
Maschinengleichung
maschinenintegrierte Gerätetechnik
maschinenintegrierte Gerätetechnik machine
maschinenintegrierter Manipulator
maschinenintegrierter Roboter
maschineninterne Darstellung
maschinenkodekompatibler Befehlssatz
Maschinenkonfiguration
Maschinenkoordinatensystem
Maschinenlogik
Maschinenlogikentwurf
Maschinennullpunkt
Maschinenoperation
Maschinenordnung
maschinenorientiert
maschinenorientierte Geometriesprache
maschinenorientierte Geometriesprache machine
maschinenorientiertes Testhilfsprogramm
maschinenorientiertes Testhilfsprogramm mashine
Maschinenperiode
Maschinenprogramm
Maschinenprogramm
Maschinenprogramm
Maschinenprogrammierung Maschinenrüstzeit
Maschinensignal
Maschinenspeicherplatz
Maschinensprache
Maschinenstillstandszeit
Maschinensystem
Maschinentoleranz
maschinentypunabhängige Schnittstelle
maschinenunabhängiges Interface
Maschinenversion
Maschinenwirkzeit
Maschinenwort
Maschinenwort
Maschinenzeit
Maschinenzeit
Maschineprüfung
maskierbare Unterbrechung
Masseänderung
Masseausgleich der Armglieder
Massenabtastung
Massendatenverarbeitung
Massendatenverarbeitung
Massenkraft
Massenkraft
Massenspeicher für Fertigung
Massenspektrografie mit Lasersonde
Massenspektrometer mit Vakuumschleuse
massenspektrometrische Analyse
Massenverarbeitung
Maßnahme bei Fehlerbedingung
Maßstab
Maßstabänderung
Masterarm
Mastergerät
Mastergerät
Masterrechner (eines Roboterantriebs)
Masterroboterarm
Master‐Slave‐Betrieb
Master‐Slave‐Manipulator
Master‐Slave‐Manipulatorsystem
Master‐Slave‐Programmierung
machine automation
machine condition
machine instruction
machine load
machine loading
machine representation
machine defect analysis
machine defect effect
functional circuit of machine
machine rack, machine frame
machine equation
computer equation
machine‐integrated field of instrumentation
machine‐integrated field of instrumentation
integrated machine manipulator
integrated machine robot
machine representation
machine‐code compatible instruction set
machine configuration
machine coordinate system
machine logic
machine logic design
machine zero point
machine operation
machine order
machine‐oriented
machine‐oriented geometry language
machine‐oriented geometry language
machine‐oriented testing service program
machine‐oriented testing service program
machine cycle
computer routine
machine program
machine routine
macroprogramming
machine set‐up time
machine signal
auxiliary storage location of IR
machine language
machine down‐time
machine system
machine allowance
machine‐independent interface
machine‐independent interface
machine version
machine‐available time
computer word
machine word
computer time
machine time
machine check
maskable interrupt
change of mass
mass compensation of arm elements
mass scanning
bulk data processing
bulk data processing, BDP
mass force
force of inertia
manufacturing mass memory
laser probe mass spectrography
mass spectrometer with vacuum lock
mass spectrometric analysis
bulk processing
action in error condition
scale
scaling
master robot arm
master device
master
master computer (of robot drive)
master robot arm
master‐slave mode
master‐slave manipulator
master‐slave manipulator system
master‐slave programming
stran 168 od 326
EN ‐DE: slovar avtomatizacije in robotike Master‐Slave‐System
Master‐Slice‐Entwurf
Mastersynchronimpuls
Matchbytespezifizierung
Materialabführung
Materialhandhabung
Materialzuführungskontrolle
Materialzuführungsroboter
mathematische Annäherung
mathematische Approximation
mathematische Berechnungen
mathematische Erwartung
mathematische Grundlage
mathematische Logik
mathematische Maschine
mathematische Modellbildung
mathematische Modellierung
mathematische Operation mit pneumatischen Signalen
mathematische Statistik
mathematische Struktur
mathematische Subroutinen
mathematische Teilprogramme
mathematischer Algorithmus
mathematisches Manipulatormodell
mathematisches Modell
mathematisches Robotermodell
Matrix
Matrixanalysis
Matrixanordnung
Matrixarithmetik
Matrixdarstellung
Matrixdarstellung
Matrix‐e‐Funktion
Matrixelement
Matrixentzifferer
Matrixkodierschaltung
Matrixmethode
Matrixschreibweise
Matrixschreibweise
Matrixsensor
Matrixspeicher
Matrixspeicher
Matrixtransformation
Matrixzenfermesssystem
Matrizenauswertung
Matrizenexponentialfunktion
Matrizenmultiplikation
Matrizenschreibweise
Matrizenschreibweise der Effektorbewegung
MAX‐Average‐Produkt (arithmetischer Mittelwert)
maximal zulässige Bestrahlungswerte
Maximalausschalter
maximale Achsgeschwindigkeit
maximale Armverschiebung
maximale Ausgangsleistung
maximale Beschickungsmenge
maximale Fehlerdiagnostik
maximale Fügezeit eines Roboters
maximale Höhe
maximale Kommandozahl
maximale Lastaufnahme
maximale Permeabilität
maximale spektrale Empfindlichkeit
maximale Verschiebegeschwindigkeit
maximale Zählgeschwindigkeit
maximaler Ausgangsstrom
maximaler Einstellstrom des Einschaltrelais
Maximalprinzip
Maximalprinzip
Maximalskalenwert
maximieren
Maximum
Maximum auf dem Rande eines Intervalls
Maximum‐Mittelwert‐Methode
Maximum‐Mittelwert‐Methode
Maximum‐Mittelwert‐Methode
master‐slave system
master‐slice design
master synchronizing pulse
match byte specification
material unloading
material manipulation, material handling
material feeding checking]
material feeding robot
mathematical approximation
mathematical approximation
mathematical calculations
mathematical expectation
mathematical fundamental
mathematical logic
mathematical machine
mathematical modeling
mathematical simulation
mathematical operation with pneumatic signals
mathematical statistics
mathematical structure
mathematical subroutines
mathematical subroutines
mathematical algorithm
mathematical manipulator model
mathematical model
mathematical robot model
matrix
matrix analysis
matrix arrangement
matrix arithmetic
matrix representation
matrix notation
matrix exponential
matrix element
matrix decoder
matrix encoder
matrix method
matrix representation
matrix notation
matrix sensor (transmitter)
matrix memory
matrix store
matrix transformation
matrix telemetering system
matrix evaluation
matrix exponential function
multiplication of matrix
notation of matrix
matrix notation of effector movement
max‐average composition
maximum permissible exposure values
maximum cut‐out
maximum axle speed
maximum arm shifting, maximum arm shift
maximum output
maximum load capacity
maximum error diagnostic
maximum joint time of robot, maximum jointing time of robot
height defuzzification
maximum number of command
maximum load bearing capacity
maximum permeability
peak spectral [threshpld] sensitivity
maximum shifting speed
maximum counting speed
maximum output current
maximum current setting of starting relay
maximum principle
Pontrjagin maximum principle
maximum scale value
maximize v
maximum
boundary maximum
mean of maximum (MOM)
mean of maximum (MOM) defuzzification
middle of maxima defuzzification
stran 169 od 326
EN ‐DE: slovar avtomatizacije in robotike Maximum‐Operation
maximum function
Maximumverbrauchszähler
maximum demand indicator
MAX‐MIN‐Inferenz
Mamdani inference
MAX‐MIN‐Inferenz
max‐min inference
max‐min composition
MAX‐MIN‐Komposition (‐Produkt,‐Verkettung)
aggregation operator
MAX‐oder SUM‐Operator
aggregator
MAX‐oder SUM‐Operator
MAX‐PROD Verkettung)
max‐prod composition
MAX‐PROD‐Inferenz
max‐dot inference
MAX‐PROD‐Inferenz
max‐prod inference
max‐dot composition
MAX‐PROD‐Komposition
max‐prod composition
MAX‐PROD‐Komposition
max‐prod composition
MAX‐PROD‐Komposition (MAX‐PROD‐Produkt
MAX‐PROD‐Produkt
max‐dot composition
MAX‐PROD‐Produkt
max‐prod composition
max‐dot composition
MAX‐PROD‐Verkettung
max‐prod composition
MAX‐PROD‐Verkettung
Maxwell‐Körper
Maxwell element
Maxwellsche Gleichung
Maxwell equation
Maxwell element
Maxwellsches Element
MB
megabyte
MB
MB
Mechanik Newtonian fluid mechanics
Mechanik der Energieübertragung
energy transfer mechanics
mechanisch gekoppelt
mechanically coupled
mechanische Abweichung des Manipulatorarms
mechanical deviation of manipulator arm
mechanische Baugruppe
mechanical assembly
mechanische Baugruppen eines Roboters
mechanical subassemblies of robot
mechanical movement unit, mechanical motion unit
mechanische Bewegungseinheit
mechanical movement unit
mechanische Bewegungseinheit
mechanical motion unit
mechanische Bewegungseinheit
mechanische Elektromotorenkennlinien
electric motor mechanical characteristics
mechanische Endlagensicherung
mechanical limit fuse
mechanische Fernlenkung
mechanical remote control
mechanical remote control
mechanische Fernsteuerung
mechanische Festigkeit
mechanical strength
mechanical gripper flexibility
mechanische Greiferflexibilität
mechanische IR‐Steuerung
mechanical robot control, mechanical IR control
mechanische Manipulatorenergie
mechanical manipulator energy
mechanische Manipulatorenergie (Energie eines Manipulatorsmechanical manipulator energy
mechanische Messung
mechanical measurement
mechanische Montage
mechanical assembly
mechanische Nulleinstellung
mechanical zero setting
mechanische Produktionstechnik
mechanical production engineering
mechanische Prüfung
mechanical check[ing]
mechanische Roboterkupplung mechanical robot coupling
mechanische Robotermontage
mechanical robot assembly
mechanische Robotersteuerung
mechanical robot control, mechanical IR control
mechanische Schalteranordnung
mechanical switch arrangement
mechanische Sperrung
mechanical interlocking
mechanische Spezifikation
mechanical specifications
mechanische Teile
mechanical components
mechanische Teilebearbeitung
mechanical parts machining
mechanische Verriegelung
mechanical interlocking
mechanische vollautomatische Produktion
mechanical full‐automatic production
mechanisch‐elektrischer Sensor (Wandler)
mechanical‐electrical sensor
mechanisch‐elektrischer Wandler
mechanical‐electrical sensor
mechanischer Analysator
mechanical analyzer
mechanischer Antrieb
mechanical drive
mechanischer Aufbau
mechanical design
mechanischer Außengreifer
mechanical external gripper
mechanischer Fingergreifer
mechanical finger gripper
mechanischer Greiferaufwand
mechanical gripper expense
mechanischer Greiferfinger
mechanical grip finger
mechanischer Greiferparameter
mechanical gripper parameter
mechanischer optischer Schalter
mechanical optical switch
mechanischer Programmierer
mechanical programmer
mechanischer Roboterentwurf
mechanical robot design
mechanischer Roboterfinger mechanical robot finger mechanischer Sensor
mechanical sensor
mechanical overload protection
mechanischer Überlastschutz
mechanischer Verstärker
mechanical amplifier
mechanischer Wirkungsgrad
mechanical efficiency
mechanisches Digitaluhranzeigesystem
mechanical digital clock display system
mechanisches Folgesystem
mechanical servosystem
mechanisches Montagewerkzeug
mechanical assembly tool
stran 170 od 326
EN ‐DE: slovar avtomatizacije in robotike mechanisches Netzwerk
mechanical network
mechanisches Ordnungsprinzip
mechanical order principle
mechanisches Ordnungsprinzip mechanical order principle
mechanisches Robotergetriebe
mechanical robot gear
mechanisches Robotermodell
mechanical robot model
mechanisierte Kassettenbeschickung
mechanized charging of cassettes
mechanisierte Leitung
mechanized direction
mechanisierte Verwaltung
mechanized direction
Mechanisierung
mechanization
Mechanisierungsgrad
order of mechanization, automatization
Mechanisierungsgrad der Montage
mechanization order of assembly
Mechanismus
laser‐linewidth determining mechanism
mechanism of pincer
Mechanismus der Zangengreifeinheit
Mechanismusstruktur
mechanism structure
mechanochemische Einwirkung
mechanochemical effect
mechanochemischer Effekt
mechanochemical effect
mechatronischer Roboter
mecatronical robot, mecatronic = mechatronisch
medizinische Robotertechnik
medical robot technique, medical robotics
Megabit
megabit
Megabyte
megabyte
Megabyte
MB
Mehgruppentheorie multigroupe
multigroup theory
Mehrachsenbahnsteuerung
multiaxis path control
Multi‐axis path control
Mehrachsenbahnsteuerung
Mehrachsensensor
Multi‐axis sensor
mehrachsige Bahnbewegung
multi‐axle orbital motion
Mehradressbefehl
multiaddress instruction
Mehradresskode
multiaddress code
mehrdeutige Funktion
ambiguous function
mehrdeutige Koordinatentransformation
ambiguous coordinate transformation
Mehrdeutigkeit der Relaiskennlinie
ambiguity of relay characteristic
Mehrdeutigkeitsdiagramm
ambiguity diagram
mehrdimensional
multidimensional
mehrdimensional nachgiebiges Werkzeug n. Compliance‐Wer Multi‐dimensional elastic tool, compliance tool
mehrdimensionale
multiparameter analysis
mehrdimensionale
multidimensional analysis
mehrdimensionales aktives Robotergelenk
multidimensional active robot joint
mehrdimensionales Bewertungssystem dimensions
multidimensional evaluation system
mehrdimensionales Maximierungsproblem
multidimensional maximization problem
mehrdimensionales Optimierungsproblem
multidimensional maximization problem
multiple‐plane interrupt control
Mehrebenen‐ Unterbrechersteuerung
Mehrebenen‐ Unterbrechungen
multi[ple‐]level interrupts
Mehrebenen‐Interrupts
multi[ple‐]level interrupts
multiple‐plane interrupt control
Mehrebeneninterruptsteuerung
multiple‐plane interrupt control
Mehrebenen‐Interruptsteuerung
Mehrebenenoptimierung
multilevel optimization
Mehrelementdetektor
multielement detector
Mehrelementlaser
many‐element laser
multiplexing
Mehrfachausnutzung
Mehrfachbedingung
compound condition
Mehrfachbindung
multiple bound
mehrfache Ableitung
multiple derivative
mehrfache Ablenkung
multiple deflection
multiple precision
mehrfache Genauigkeit
mehrfache Resonanz
multiple resonance
multiple input selection logic
Mehrfacheingabeauswahllogik
Mehrfachelektrodenautomat
automatic multiple‐electrode machine
mehrfacher Regelkreis
multiple‐loop servomechanism
mehrfacher Regelkreis
control of many‐variable system
Mehrfacherregung
multiple excitation
mehrfaches Roboterfügen (Fügen mittels Industrieroboters) multiple robot jointing
Mehrfachgreifer
multiple gripper (gripping device)
Mehrfachimpulsregler
multipulse controller
Mehrfachkoppler
multiplexer
Mehrfachkreis
multiple circuit
Mehrfachpegel‐Fernmeldesystem multiples
multilevel communication system
Mehrfachpositionsschalter
multiposition switch
Mehrfachprogrammierung multiprogrammation
multiprogramming
Mehrfachquelle
multiple source
Mehrfachresonanz
multiple resonance
Mehrfachsensor
multisensor
multicontroller
Mehrfachsteuereinheit
Mehrfachverarbeitung
multiprocessing
Mehrfachverdampfer
multiple effect evaporator
mehrfachwirkender Regler
multiple‐action controller
Mehrfachzugriff‐Online‐System
multiaccess online system
stran 171 od 326
EN ‐DE: slovar avtomatizacije in robotike Mehrfachzugriff‐Online‐System
Mehrfingergreifer
Mehrfunktionsgreifer
mehrgelenkiger Roboterfinger
mehrgliedriger Dreifinger
Mehrgrößenregelungssystem
Mehrgrößensystem
Mehrgrößensystem
Mehrgruppenapproximation
Mehrgruppenmodell
Mehrheitslogik
Mehrkanal‐Datenerfassungsgerät multiples
Mehrkanaldekodierer
Mehrkanalgerät
Mehrkanalkommunikationssystem multiples
Mehrkanalmessverstärker multiples
Mehrkanalregler
Mehrkanalstreuung
Mehrkanalverstärker
Mehrkapazitätsregelsystem multiples
Mehrkoordinaten‐Ausrüstung
Mehrkoordinaten‐Ausrüstung
Mehrkoordinaten‐Manipulator
Mehrkoordinaten‐Manipulator
Mehrkörperkraft
Mehrkörperproblem
Mehrkörpersystem
Mehrkreisregelungssystem
mehrkriterielle Optimierung
Mehrlagenf multicouche
Mehrlaufregelung
Mehrlaufregler
Mehrleitungf multiligne
Mehrleitungsterminal
Mehrmaschinenbeschickung
Mehrmodenverhalten
Mehrmodusbetrieb
Mehrniveauanalyse
Mehrparameteranalyse
Mehrparameteranalyse
Mehrparameterregelkreis
Mehrperiodenbetriebszustand
mehrperiodischer Betriebszustand
Mehrphasenstrom
Mehrphasentrenneinrichtung
mehrpolige Schaltverbindung von Relaiskreisen
Mehrprozessor
Mehrprozessoreinsatz
Mehrprozessorsteuersystem
Mehrprozessorsystem
Mehrpunktgeber
Mehrpunktglied
Mehrpunktregler
Mehrpunktregler
Mehrpunktregler
Mehrpunktsignal
Mehrpunktverhalten
Mehrpunktverhalten
Mehrrechnersystem
Mehrrechnersystem
Mehrrobotereinsatz
Mehrrobotersystem
Mehrschicht‐
Mehrschichteninterferenzfilter
mehrschichtig
Mehrschichtkoppler
Mehrschichtstruktur
Mehrschleifenimpulssystem
Mehrschleifensystem
mehrschleifiger Regelkreis
mehrschleifiger Regelkreis
mehrschleifiges Folgesystem
Mehrstationenmaschinen
Mehrstellenmessgerät
Mehrstrahloszilloskop
Mehrstrahlquelle
Multi‐access on‐line system, MAOS
Multi‐finger gripper
multifunction gripper
multi‐jointed robot finger
multi‐linked trifinger
multidimensional system
multiple‐input multiple‐output system,, MIMO‐System
multivariable system
multigroup approximation
multigroup model
majority logic
multiple‐channel data asquisition device
all‐channel decoder
multiplexing equipment
multichannel communication system
multichannel measuring point amplifier
multichannel controller
multichannel scattering
multichannel amplifier
multicapacity control system
multicoordinate equipment
multi‐coordinate equipment
multicoordinate manipulator
multi‐coordinate manipulator
multi‐body force
multi‐body problem
multi‐body system [of robot]
multiloop control system
polyoptimization
multilayer
multispeed floating control
multispeed controller
multiline
multiline terminal
multi‐machine loading
multimode behaviour
multimode operation
multilevel analysis
multiparameter analysis
multidimensional analysis
multiparameter control circuit
multiperiodic regime
multiperiodic regime
polyphase current
multiphase contactor
multipole relay circuit connection
multiprocessor
multiprocessor application
multiprocessor control system
multiprocessor system
multipoint sensor
multiposition element
multilevel controller
multiposition controller
multistep controller (US)
multiposition signal
multilevel action
multistep action (US)
multicomputer system
multi‐computer system
multi‐robot application
multi‐robot system
multilayer
multilayer interference filter
multilayer
multilayer[ed] coupler
multilayer[ed] structure
multiloop pulse system
multiloop system
multiple‐loop servomechanism
control of many‐variable system
multiloop servosystem
multiple‐station machines
multipoint measuring instrument
multibeam oscilloscope
multi[ple ]beam source
stran 172 od 326
EN ‐DE: slovar avtomatizacije in robotike Mehrstufenzylinder
multistage cylinder
mehrstufig
multistage
mehrstufige Programmunterbrechung
multilevel interrupt
mehrstufige Robotermontage
multistage robot assembly
multistage separation
mehrstufige Trennung
mehrstufiger Entscheidungsprozess
multistage allocation process
mehrstufiger Servomechanismus
multicascade servomechanism
mehrstufiger Speicher
multilevel storage
mehrstufiger Verstärker
cascade amplifier
mehrteilig
complex
Mehrvariablensystem
many‐variable system
Mehrwegübertragung
multipath transmission
mehrwertig
many‐valued
mehrwertige Logik
multiple‐valued logic
mehrwertige Logik
many‐valued logic
Mehrwortbefehl
multiple‐word instruction
Mehrzweckanlage
multiple‐purpose plant
Mehrzweckanlage
multipurpose plant
Mehrzweckautomat
multipurpose automatic device
Mehrzweckautomat
universal automaton
Mehrzweckautomat [für Montage]
general‐purpose automatic machine [for assembly]
Mehrzweckautomat [für Montage]
general‐purpose automatic machine [for assembly], general‐p
multifunction unit
Mehrzweckeinheit
Mehrzweckforschungsreaktor
multipurpose research reactor
Mehrzweckmesser
all‐purpose meter
Mehrzweckmesser
multimeter
Mehrzweckradar
general‐purpose radar
Mehrzweckroboter
general‐purpose robot
Melderelais
annunciator relay
Melderelais
indicating relay
Melderelais
indicator relay
Meldung
message
Meldung
notice
Member
member
Member
element
Membranantrieb
diaphragm actuator
Membranantrieb
diaphragm drive
Membrane
diaphragm
Membrangreifer
membrane gripper
Membranlagerung
membrane support
Membranstellmotor
diaphragm servomotor
Membranventil
membrane valve
Memistor
memistor
set
Menge
Menge von Zeichen
alphabet
Mengenfließbild
quantity flow‐sheet
Mengenfließschema
mass flow‐sheet
Mengenmesser
mass flowmeter
set operator
Mengenoperator
Mengenregelung
quantity control
Mengenregler
quantity controller
menschliche Objektfixierung Hybridrechner
human object fixing
Mensch‐Maschine‐Kommunikation
man‐machine communication, MMC
Mensch‐Maschine‐Kommunikation fin der Robotertechnik (Roman‐machine communication in robotics
Mensch‐Maschine‐Schnittstelle
man‐machine interface
Mensch‐Maschine‐System
man‐machine system
Mensch‐Roboter‐Dialog
man robot dialogue
Merkmal
feature
Merkmalsextraktion
extraction of mark
Merkmalsraum
zone of flag
Messanlage
measuring installation
measuring instrument
Messapparat
Messapparat
measuring means
measuring apparatus
Messapparat
measuring equipment
Messausrüstung
messbar
measurable
messbare Roboterkraft
measurable robot force
Messbarkeit
measurability
Messbedingungen
conditions of measurement
Messbereich
instrument range
Messbereich
measuring range
Messblende
measuring diaphragm
Messblende
orifice plate
measuring block
Messblock
Messbrücke
measuring bridge
Messbrückenrückkopplung
bridge feedback
stran 173 od 326
EN ‐DE: slovar avtomatizacije in robotike Messdrahtregler
Messeinrichtung
Messen der Phasenwinkelschwankungen
Messen des Luftdurchflusses messender Sensor
Messfehler
Messfühler
Messgenauigkeit
Messgenauigkeit
Messgenauigkeit
Messgenauigkeit
Messgenauigkeit
Messgerät mit digitaler Anzeige
Messgerät mit mehreren Messbereichen
Messgeräteausstattung
Messgerätekonstante
Messgerätekorrektur
Messgeräteprogrammierbarkeit
Messgerätgüte
Messgrenze
Messgröße
Messgrößenerfassung
Messimpuls
Messinstrument
Messinstrument
Messinstrument
Messkreis
Messminizentrale
Messminizentrale
Messorgan
Messorgan
Messorgan
Messplatte
Messplatz
Messposition eines Roboters
Messpotentiometer
Messpumpe
Messpunkt
Messroboter
Messsicherheit
Messsignal
Messsignal
Messstelle
Messstelle
Messsystem
Messsystemanwendung
Messsystemanwendung
Messsystemanwendung
Messsystemnutzung
Messsystemnutzung
Messsystemnutzung
Messtafel
Messtafel
Messtafel
Messtafel
Messtafel für Prüfanlagen
Messtechnik
Messtisch
Messtisch
Messtisch
Messtisch
Messumformer
Messumformer
Messumformer für Gasanalysatoren
Messung
Messung der mechanischen Beanspruchung
Messung des Phasengangs
Messung dynamischer Dehnungsvorgänge
Messung mit Mittennullpunkt
Messung mittels Sensors
Messverfahren
Messvorrichtung
Messvorrichtung
Messvorrichtung
Messwähler
Messwandler
pilot wire regulator
measuring device
measuring of the phase angle changes
air‐flow measurement measuring sensor
measuring error
detecting element
measurement precision
measuring accuracy, measuring precision
measuring precision
measuring accuracy
accuracy of measurement
measuring instrument with digital indication
multirange instrument
measuring equipment
measuring apparatus constant
instrumentation correcting
instrument programmability
meter quality
limit of measurement
measured quantity
measuring magnitude acquisition
measuring impulse
measuring instrument
measuring means
measuring apparatus
measuring circuit
measuring mini central
measuring minicentral
measuring instrument
measuring means
measuring apparatus
measuring place
measurement setup
measuring position of robot
measuring potentiometer
metering pump
measuring point
measurement robot
measuring safety
measured signal
measuring signal
point of measurement
measuring point
measuring system
application of measuring system, use of measuring system
application of measuring system
use of measuring system
application of measuring system, use of measuring system
application of measuring system
use of measuring system
instrument table
test stand
test board
test table
measuring panel for testing installations
measuring technique
instrument table
test stand
test board
test table
measuring transducer
measuring transmitter
measuring transducer for gas analyzers
measurement
measurement of mechanical stress
phase response measurement
dynamic extension measurement
centre zero measurement
sensor measurement
measuring procedure
measuring instrument
measuring means
measuring apparatus
test selector
instrument transformer
stran 174 od 326
EN ‐DE: slovar avtomatizacije in robotike Messwandler
Messwandler
Messwandler geometrischer Größen
Messwerkzeug
Messwerkzeugführung
Messwert
Messwertausgabe
Messwerteingabe
Messwerterfassung
Messwerterfassung
Messwerterfassung
Messwerterfassung
Messwerterfassung
Messwerterfassungsgerät
Messwertfehler
Messwertgeber
Messwertgeber mit Digitalausgang
Messwertübertragungssystem
Messwertverarbeitung
Metallamelle
Methode
Methode der Beschreibungsfunktion
Methode der Beschreibungsfunktion
Methode der Defuzzifizierungsverfahren
Methode der ersten Annäherung
Methode der Funktionsbeschreibung
Methode der Funktionsbeschreibung
Methode der kleinsten Quadrate
Methode der kleinsten Quadrate
Methode der kleinsten Quadrate
Methode der langsam veränderlichen Funktionen
Methode der maximalen Höhe
Methode der Phasenebene
Methode der Phasenebene
Methode der Pseudozufallszahlen
Methode der Punkttransformation
Methode der schrittweisen Annäherung
Methode der Störungen
Methode der sukzessiven Approximation
Methode der Variation der Konstanten
Methode der verzögerten Koinzidenz
Methode der vollständigen Induktion
Methode des energetischen Gleichgewichts
Methode des energetischen Gleichgewichts
Methode des energetischen Gleichgewichts
Methode des kleinen Parameters
Methode des kleinen Parameters
Methode des steilsten Abstiegs
Methode des zusätzlichen Halbschrittes
Methode mit alternierender Richtung
Methode trapezförmiger Frequenzcharakteristiken
Methode von Kochenburger
Methode zur Abgrenzung der Stabilitätsbereiche
Methode zur logischen Analyse
Methoden der Analyse
Metrik
metrische Information
metrischer Raum
metrisches System
Michailovsches Kriterium
Mietleitung
Mikrobaueinheit
Mikrobefehl
Mikrobefehlsregister
Mikrobefehlsspeicher
Mikrobibliothek
Mikroblockbauweise
Mikrodiskette
Mikroelektronik
Mikroelektronikblock
Mikroelektronikblock einer
Mikroelektronikeinsatz für Roboter
mikroelektronischer Digitalisierroboter
mikroelektronisches Bauteil
mikroelektronisches Sensorprinzip
Mikrofertigung
measuring transducer
transducer
electromechanical dimension tranducer
measuring instrument
measuring instrument guide
measuring value
output of measured value
input of measured value
measured value acquisition
measuring value acquisition
data acquisition
data collection
measured value logging
logger
datum error
detecting element
digital output transducer
measuring values transmission system
processing of measured data
metal lamina
method
describing function analysis
describing function method
height defuzzification
first approximation method
describing function method
harmonic balance method
least squares method
least squares method, LS
LS
slow‐changing function method
max‐height defuzzification
phase plane analysis
phase plane method
pseudorandom number method
point mapping method
method of successive approximation
perturbation method
method of successive approximation
method of variation of constants
delay coincidence method
principle of finite induction
energetic balance method
method of energetic balance
power balance method
method of small parameter
small parameter method
method of steepest descent
supplementary half‐step method alternating direction method
method of trapezoidal frequency responses
method of Kochenburger
method of determination of stability domains
logical method for the analysis
analysis procedures
metric
metric information
metric space
metric system
Michailov criterion
leased line
microassembly
microinstruction
microinstruction register
microinstruction memory
micro‐library
microblock design
microdiskette
microelectronics
block of microelectronics
block of microelectronics of
application of microelectronics for robots
microelectronic digitizing robot
microelectronic component
microelectronic sensor principle
microfabrication
stran 175 od 326
EN ‐DE: slovar avtomatizacije in robotike Mikrofunktionsbus
Mikroherstellung
Mikroinformatik
Mikroinformatik
mikroinformatische Werkzeuge
mikroinformatische Werkzeuge
Mikrokontrolle
Mikrokontrolle
Mikrologik
Mikrologikschaltung
Mikrolotung
Mikromanipulator
Mikromanipulator‐Roboter
Mikrominiaturisierung
Mikromodul
Mikromodultechnik
Mikromontagetechnik
Mikromontagetechnik microassemblage
Mikromontagetechnik microassemblage
Mikrooperation
Mikroprogramm
Mikroprogrammauswahl
Mikroprogrammemulation
mikroprogrammgesteuertes Automatiksystem
mikroprogrammgesteuertes Robotersystem
Mikroprogrammierbarkeit
mikroprogrammierte Emulation
Mikroprogrammiertechniken
Mikroprogrammierung
Mikroprogrammlogik
Mikroprogrammspeicheradresse
Mikroprogrammsteuereinheit
Mikroprogrammsteuereinheit microprogrammes
Mikroprogramm‐Steueroperation microprogramme
Mikroprogrammsteuerschaltkreis
Mikroprogrammsteuerschaltkreis
Mikroprogramm‐Steuerspeicher
Mikroprogrammsteuerung
Mikroprogrammsteuerung
Mikroprogrammsteuerwerk
Mikroprozessor
Mikroprozessor eines Industrieroboters
Mikroprozessor‐Analysator
Mikroprozessoranwendung
Mikroprozessor‐Ausbildungssystem
mikroprozessorbestückte Steuerung
mikroprozessorbestücktes Produkt
Mikroprozessor‐Entwicklungssystem microprocesseur
Mikroprozessorentwurf
Mikroprozessorfunktion
mikroprozessorgesteuerte Messtechnik
mikroprozessorgesteuerte Messtechnik microprocesseurs
mikroprozessorgesteuerter Bohrroboter (für Leiterplatten)
mikroprozessorgesteuerter Feinmanipulator
mikroprozessorgesteuerter Manipulator
mikroprozessorgesteuerter Roboter
mikroprozessorgesteuertes Europakartensystem
mikroprozessorgesteuertes Modem
mikroprozessorgesteuertes System
mikroprozessorgesteuertes Terminal
Mikroprozessor‐Hardware
Mikroprozessornachbildner
Mikroprozessornetz
Mikroprozessorsimulator
Mikroprozessorsoftware
Mikroprozessorsteckeinheitensystem
Mikroprozessorsteuersystem
Mikroprozessorsteuerung eines IR
Mikroprozessorsystem mit
Mikroprozessorsystem mit verteilter Intelligenz
Mikroprozessortechnik
Mikroprozessortechnologie
Mikrorechner
mikrorechnergesteuerte Fehlermessung
mikrorechnergesteuerte Feinpositionierung
mikrorechnergesteuerte Fügebewegung
micro‐function bus
microfabrication
microinformatics
Microinformatics, micro informatics
microinformatic tools
microinformatic tools, micro informatic
microchecking
micro‐checking
micrologic
micrologic circuit
micro sounding
micromanipulator
Micro‐handler robot
microminiaturization
micromodule
micromodule technique
micro‐mounting technique, micro‐assemblage technique
micro‐mounting technique
microassemblage technique
microoperation
microprogram
microprogram selection
microprogram emulation
microprogram‐controlled automatic system
microprogram‐controlled robot system
microprogrammability
microprogram emulation
microprogramming techniques
microprogramming
microprogram logic
microprogram memory (store) address
microprogram control unit
microprogram control unit
microprogram control operation
microprogram control circuit
microprogram control circuit, microprogram control switchin
microprogram control memory
microprogram control
microprogrammed control
microprogram control unit
microprocessor
microprocessor of [industrial] robot
microprocessor analyzer
microprocessor application
microprocessor education system
microprocessor‐based control
microprocessor‐based product
microprocessor development system
microprocessor design
microprocessor function
microprocessor‐controlled measuring technique
microprocessor‐controlled measuring technique
microprocessor‐controlled drill robot (for printed‐circuit boar
microprocessor‐controlled fine manipulator
microprocessor‐controlled manipulator
microprocessor‐controlled robot
microprocessor‐controlled European card system
microcontrolled modem
microprocessor‐piloted system
microprocessor‐controlled terminal
microprocessor hardware
microprocessor simulator
microprocessor net
microprocessor simulator
microprocessor software
microprocessor card system
microprocessor control system
microprocessor control of industrial robot
microprocessor card system
distributed‐intelligence microprocessor system
microprocessor engineering
microprocessor technology
microcomputer
microcomputer‐controlled error measurement
microcomputer‐controlled fine positioning
microcomputer‐controlled joint movement
stran 176 od 326
EN ‐DE: slovar avtomatizacije in robotike mikrorechnergesteuerte Fügebewegung
mikrorechnergesteuerte Greifkraftbegrenzung
mikrorechnergesteuerte Messeinrichtung
mikrorechnergesteuerter Digitalisierroboter
mikrorechnergesteuerter Industrieroboter
mikrorechnergesteuerter Kleinmanipulator
mikrorechnergesteuerter Manipulator
mikrorechnergesteuerter Montagekopf
mikrorechnergesteuerter Roboter
mikrorechnergestützte Roboterkoordinatenberechnung
mikrorechnergestützte Robotermatrizenauswertung
mikrorechnerorientierte Automatisierung
mikrorechnerorientierte Prozesseinrichtung
Mikrorechnerprogrammentwicklung
Mikrorechnersoftware
Mikrorechnersoftware für Roboter
Mikrorechnersoftwareprojekt
Mikrorechnersteuerung
Mikrorechnersteuerung eines Montagekopfes
Mikroroboter
Mikroroboter) mit fünf Freiheitsgraden
Mikroschaltung
Mikroschaltungstechnik
Mikroschaltungstechnik
Mikrosekunde
Mikrosteuergerät
Mikrosynchronisation
Mikroverarbeitung
Mikroverformung
Mikroverstellvorrichtung
Mikrowellenrefraktometer
Mikrowellenspektroskopie
Mikrowellenübertragung
Milieu
Milieu
Minderung der Übertragungsgüte durch Verzerrung
Mindestabstand
Mindestbelastung
Mindestbelastung
Mindestleistung
Mindestspannung
Mindeststabilität
Mindestwertpunkt
Mindestzeit
Mindestzündenergie
miniaturisierte Automation
Miniaturisierung
Miniaturisierung
Miniaturlaser
Miniaturschalter
Minim[is]ierung
Minim[is]ierung
Minimalabweichung
Minimalausrüstung
minimale Abweichung
minimale Einfangzeit
minimale Freiheitsgradezahl
minimale Temperaturdifferenz
minimales feststellbares Signal
Minimalglied einer logischen Funktion
Minimalisierung
Minimalisierung
Minimalphasensystem
Minimalphasenverschiebungssystem n
Minimaxverfahren
minimieren
Minimierung des Greiferwechsels
Minimisierung des mittleren Fehlerquadrats
Minimisierungsmethode
Minimontagetechnik
Minimontagetechnik miniassemblage
Minimontagetechnik miniassemblage
Minimum
Minimum auf dem Rande eines Intervalls
Minimum des mittleren quadratischen Fehlers
Minimum‐Operation
microcomputer‐controlled joint[ing] movement
microcomputer‐controlled limitation of grip power
microcomputer‐controlled measuring device
microcomputer‐controlled digitizing robot
microcomputer‐controlled industrial robot
microcomputer‐controlled miniature manipulator
microcomputer‐controlled manipulator
microcomputer‐controlled assembly head
microcomputer‐controlled robot
microcomputer‐aided robot coordinate calculation
microcomputer‐aided matrix evaluation of robot
microcomputer‐oriented automation
microcomputer‐oriented process device
microcomputer program development
microcomputer software
microcomputer software for robots
software project of microcomputer
microcomputer control
microcomputer control of assembly head
microrobot
microrobot with five degrees of freedom
microcircuit
microcircuit technique
microcircuit engineering
microsecond
microcontroller
microsynchronization
microprocessing
microdeformation
microadjuster
microwave refractometer
microwave spectroscopy
microwave transmission
environment
environs
distortion transmission impairment
minimum distance
minimum capacity
minimum charge
minimum efficiency
minimum voltage
minimum stability
minimum point
minimum time
minimum ignition energy
miniaturized automation
miniaturization
miniaturizing
miniature laser
microswitch
minimization
minimizing
minimum deviation
minimum configuration
minimum deviation
minimum time to capture
minimal degree of freedom number
minimum temperature difference
minimum detectable signal
logical function minimal member
minimization
minimizing
minimum‐phase system
minimum phase‐shift system
minimax strategy
minimize v
gripper change minimizing
minimization of integral squared error
minimizing method
mini mounting technique, miniassemblage technique
minimounting technique
miniassemblage technique
minimum
boundary minimum
mean square error minimum
minimum function
stran 177 od 326
EN ‐DE: slovar avtomatizacije in robotike Minirechner mit 32‐bit‐Wortlänge
Miniroboter
Miniroboterherstellung
MIN‐MAX‐Komposition
Minorität
mischen
mischen
mischen
Mischen von elektrischen Analogsignalen
Mischer
Mischgaslinse
Mischkreis
Mischsteilheit
Mischstufe
Mischtechnik
Mischungsanalysator
mit aktiver Kopplung
mit ODER verknüpfte Regeln
mit phasenstarrer Kopplung
mit Rauschen
mit Servomotor
miteinbegriffen
miteinbegriffen
mitgeschleppter Fehler
mitlaufend
mitlaufende Diagnose
mitlaufende Testung
Mitnahmebedingungen
Mitnahmefrequenz
Mitnehmerband
Mitnehmerfunktionskriterien
Mitphasensystemrelais positive de la phase
Mitte eines Greifbackens
Mitteilung
Mitteilung
Mitteilungstransfersystem
Mittelabweichung
Mittelerwartungswert
mittelnder Operator
Mittelpunktstemperatur
Mittelrauschen
mittelschnelle Datenübertragung
mittelschnelle Leitung
Mittelstellung
Mittelverstärker
Mittelwert
Mittelwert
Mittelwert des Rauschens
Mittelwertanzeiger
Mittelwertanzeiger
Mittelwert‐Operator
Mittelwertspannungsmesser
Mittelwertvoltmeter
mittlere Abweichung
mittlere Abweichung variation mittlere Anregungsenergie
mittlere Ausführungszeit
mittlere Impulsleistung
mittlere Ist‐Bahn eines IR
mittlere Komplexität
mittlere Leistung
mittlere Leistung
mittlere Operation
mittlere optische Leistung
mittlere quadratische Abweichung
mittlere quadratische Abweichung
mittlere Rechengeschwindigkeit
mittlere Reparaturzeit
mittlere Robotergeschwindigkeit
mittlere spezifische Leistung
mittlere spezifische Leistung
mittlere spezifische Leistung
mittlere spezifische Leistung
mittlere spezifische Leistung
mittlere störungsfreie Zeit
mittlere störungsfreie Zeit
minicomputer of 32‐bit word length
miniature robot, miniature industrial robot, minirobot
manufacture of micro robots
min‐max composition
minority
blend v
mix v
mingle v
mixing of electric analog signals
mixer
gas mixture lens
mixing circuit
conversion transconductance
mixing stage
merged technology
mixture analyzer
actively coupled
disjunctive rules
phase‐locked
noisy
servo‐driven
implicit
implied
inherited error
online
online diagnostics
concurrent testing
capture conditions
pull‐in frequency
band of entrainment
driver function criteria
positive‐phase sequence relay
centre of grip jaw
message
notice
message transfer system
average deviation
expected average value
averaging operator
central temperature
average noise
medium‐speed data transmission
medium‐speed line
intermediate position
intermediate amplifier
average
average value
average noise
average value pulse indicator
mean‐pulse indicator
averaging operator
average voltmeter
average voltmeter
average deviation
mean deviation
average excitation energy
average execution time
average impulse power
mean actual path of IR
medium complexity
mean power
average power
average operation
average optical power
mean square deviation
standard deviation
average calculating speed
mean repair time
mean robot speed
average fuel rating
average intensity
angle‐integrated intensity
mean fuel rating
average specific power
mean time between failures
mean time between failures, MTBF
stran 178 od 326
EN ‐DE: slovar avtomatizacije in robotike mittlere Stromaufnahme
mittlere Trägheitsachse
mittlere Übertragungsgeschwindigkeit
mittlere Wahrscheinlichkeit
mittlere Wartezeit
mittlere Wartungszeit
mittlere Winkelgeschwindigkeit
mittlere Zugriffszeit
mittlerer
mittlerer Ausfallabstand
mittlerer Ausfallabstand
mittlerer Fehler
mittlerer quadratischer Fehler
mittlerer Verstärkungskoeffizient
mittleres Infrarot
mittleres Quadrat der Intensitätsschwankung
mittleres quadratisches Fehlermoment
Mitziehfrequenz
ML (von IBM)
Mnemokode
Mnemonik
Mnemonikplan
mnemonische Abkürzung
mnemonischer Befehlskode
mnemonischer Kode
mobiler Manipulator
mobiles (bewegliches) Objekt
mobiles Hindernis (im Roboterarbeitsraum)
mobiles Manipulatorgestell
Modell
Modell eines Nachrichtenübertragungsprozesses
Modell mit gleitendender Mittelwertbildung
Modell mit gleitender Mittelwertbildung
Modell mit gleitender Mittelwertbildung
Modellanlage
Modellanlage
Modellblockspeicher Modellentwicklung
Modellerkennung
Modellermittlung
Modellermittlung
Modellexperiment
Modellexperiment
Modellierung
Modellierung der Verfahrenssteuerung
Modellierung eines Industrieroboters
Modellierung kontinuierlicher Mehrfachsysteme
Modellierung logischer Operationen
Modellierung von Impulssystemen
Modellmaßstab
Modellparameter
Modellprojektierung
Modelltheorie
Modellvereinfachung
Modellversuch
Modellversuch
Modem
Modem
Modem‐Steuerung
Modenberechnung
moderne Datenorganisation
moderne Datenorganisation
moderne Informationsverarbeitung
moderne Kommunikationstechnik
moderne Kommunikationstechnik
moderne Mikrobausteine moderne Mikrobausteine pl
moderne virtuelle Maschine
moderner abhängiger Prozessor
moderner Nebenprozessor m. moderner Zusatzprozessor"
moderner Slave‐Prozessor
modernes Betriebssystem
modernes Betriebssystem modernes Datenübertragungssteuerverfahren
modernes Fernverarbeitungssystem
modernes flexibles Fertigungssystem
average supply current
mean axis of inertia
average transfer rate
mean probability
average waiting time
mean time to maintain
mean angular velocity
average access time
average logarithmic energy decrement
mean time between failures
mean time between failures, MTBF
average error
mean square error
average gain coefficient
medium infrared
mean square of intensity fluctuation
mean square error moment
pull‐in frequency
manipulator language, ML
mnemonic code
mnemonic
mnemoscheme
mnemonic
mnemonic code
mnemonic code
mobile manipulator
mobile object
mobile obstacle (in operating space of robot)
mobile manipulator frame
model
model of a communication process
MA model, moving‐average model
MA model
moving‐average model
pilot plant
experimental unit
model block memory model development
model recognition
estimation
identification
model experiment
model test
simulation
process control simulation
robot modeling
simulation of continuous multiloop control system
simulation of logical operations
pulse system simulation
model scale
model parameter
model design
model theory
model simplification
model experiment
model test
modem
modulator‐demodulator
modem control
calculation of modes
advanced data organization advanced data organization, ADO
modern information processing
advanced communication technology
advanced communication technology, ACT
advanced micro devices advanced micro devices
advanced virtual machine, AVM
advanced support processor, ASP, advanced slave processor
advanced support processor, ASP, advanced slave processor
advanced support processor, ASP, advanced slave processor
advanced operating system, AOS
advanced operating system advanced data‐communications control procedure
advanced teleprocessing system, ATS
advanced flexible manufacturing system
stran 179 od 326
EN ‐DE: slovar avtomatizacije in robotike modernes Leitungssystem
modernes lineares Programmsystem
modernes lineares Programmsystem
modernes Programmsystem zur linearen Optimierung
modernes Programmsystem zur linearen Optimierung
modernes Textverwaltungssystem
modernes Verwaltungssystem
modernisierte Montagestraße
Modifikation
Modifikation des Steuerprogramms
Modifikator
Modifikatorregister
Modifizierung
Modul
modular
modular aufgebauter Mikroprozessor
modulare Bauweise
modulare Erweiterung
modulare Montagemaschine
modulare Programmierung
modulare Roboterhardware
modulare Robotersoftware
modulare Struktur
modulare taktile Greifereinheit
modulare Verbindungstechnik
modularer Entwurf
modularer programmierbarer Automat
modulares Handhabungsgerät
modulares Kontrollsystem
modulares Kontrollsystem
modulares programmierbares System
modulares Robotersystem
modulares Speichersystem
modulares Steuerungssystem
modulares System
modulares taktiles Greifersystem
modulares taktiles Sensorsystem
Modularisierung
Modularität
Modularsystem
Modulation
Modulation durch Lichtintensität
Modulation mit Trägerwellenunterdrückung
Modulationsantwort
Modulationsgrad
Modulationskennlinie
Modulationskontrollgerät
Modulationsübertragungsfunktion
Modulationsverfahren für die Datenübertragung
Modulationswirkunsgrad
Modulator
Modulator‐Demodulator
Modulator‐Demodulator
Modulatorsteuersignal
Modulbauweise
modulbeschränkte Einwirkung
Modulierbarkeit
modulieren
modulierte Größe
modulierter Trägerfrequenzkanal
modulierter Trägerstromkanal
moduliertes monochromatisches Licht
moduliertes Signal
Modulo‐n‐Kontrolle
Modulo‐n‐Prüfung
Modulo‐Operation
Modulprinzip
Modulroboter
Modulsteckbaugruppe
Modulsystem automatischer Regelung
Modulsystemtechnologie
Modulübersicht
Modulüberwachung
Modus
Moduswechsel
mögliches Ereignis post‐detection gain 494
advanced administrative system, AAS
advanced linear programming system advanced linear programming system, ALPS
advanced linear programming system advanced linear programming system, ALPS
advanced text management system, ATMS
advanced administrative system, AAS
modernized assembly fine
modification
modification of control program
modificator
modifier register
modification
module
modular
modulary structurized microprocessor
modular construction
modular expansion
modular assembly machine
modular programming
modular robot hardware
modular robot software
modular structure
modular tactile gripper unit
modular connecting technique
modular design
modular programmable automaton
modular handling system
modular check[ing] system
modular checking system
modular programmable system
modular robot system
modular memory system
modular control system
modular system
modular tactile gripper system
modular tactile sensor system
modularization
modularity
modular system
modulation
light‐intensity modulation
quiescent‐carrier modulation
modulation response
modulation factor
modulation response
modulation monitor
modulation transfer function
modulation technique for data transmission
modulation efficiency
modulator
modem
modulator‐demodulator
modulator control signal
modular concept
action limited by absolute value
modulation capability
modulate v
modulating signal
modulated carrier channel
modulated carrier channel
modulated monochromatic light
modulating signal
modulo‐n check
modulo‐n check
modulo operation
modular principle
module robot
plug‐in module
modular system of automatic control
module system technology
module map
module supervision
mode
mode change
possible event
stran 180 od 326
EN ‐DE: slovar avtomatizacije in robotike Molek[ularelek]tronik
molecular electronics
molekularer Generator
molecular generator
Moment
moment
Moment der Zufallsfunktion
moment of random function
Momentanablesung
instantaneous reading
momentane Schraubachse
momentary screwed axis
momentane Störung
momentary disturbance
Momentanfehler
instantaneous error
Momentanfrequenz
instantaneous frequency
Momentanleistung
instantaneous power
Momentanphasenmesser
momentary phase meter
Momentanwert
instantaneous value
Momentanwertumsetzer
instantaneous value converter
Momentbestimmung
moment destination
moment reference point
Momentbezugspunkt
Momenteinschaltung
snap closing
momentfreies Relaisfolgesystem
momentless relay servosystem
Momentkennlinie
torque characteristics
momentloses Relaisfolgesystem
momentless relay servosystem
Momentüberwachung
survey of moments
Monitor
verifying device
Monitor
monitor
Monitoring‐Verfahren
monitoring procedure
Monitorinterface
monitor interface
Monitorprogramm
monitor program
Monitorsteuerung
monitor control
monoenergetisches Manipulatorsystem
monoenergetic manipulator system
monoenergetisches Manipulatorsystem (System eines Manipumonoenergetic manipulator system
monolithisch
monolithic adj
monolithische Schaltung
monolithic circuit
monolithische Struktur
monolithic structure
monolithischer Aufbau
monolithic structure
monolithischer Schaltkreis
monolithic circuit
monolithischer Taktgenerator
monolithic clock generator
monolithischer Umsetzer
monolithic converter
Monolokutor
monolocutor
Monomodebetrieb
single‐mode operation
Monomode‐Lichtwellenleitersensor
single‐mode optical fiber sensor
Monoprozessorsystem
monoprocessor system
Monopulslidar
monopulse lidar
monostabile Schaltung
monostable circuit
monostabiler Multivibrator
monostable multivibrator
monostabiler Multivibrator
one‐shot multivibrator
monostabiler Sperrschwinger
single‐shot blocking oscillator
monoton
monotonous
monotone Funktion
monotonic function
monotonous transient response
monotoner Übergangsprozess
monotoner Vorgang
monotonous process
Montage
installation
Montage (durch Roboter)
mounting (by robot)
Montage einer Baugruppe
assembly mounting
Montage einer Unterbaugruppe
sub‐assembly mounting
Montage im Mikrobereich
assembly within micro‐range
Montage mittels Industrieroboters
robot mounting, robot assemblage, industrial robot mounting,
Montageablauf
assembly sequence, assembly flowing
Montageablauf mittels Industrieroboters
robot assembly sequence, mounting sequence by means of the
Montageabteilung
assembly department
Montagealternative
assembly alternative
Montageanweisung
fitting instruction, assembly instruction
Montagearbeit
assembly operation (working)
Montagearbeitsplatz
montage working station, montage operator position
Montageaufgabe
assembly task
Montageausrüstung
assembly equipment
Montageautomat
assembly automaton
Montageautomatisierung (mit Robotern)
assembly automation (by robots)
Montageband
assembly line
Montagebasisteil
assembly base part
Montagebauteil
component of assembly
Montagebauweise
precast construction
Montagebedingung
assembly condition
Montagebefehl
assembly instruction
Montagebeschreibungsdatei
assembly description file
Montagebewegung
assemblage movement, mounting motion
Montagebewegung feines Industrieroboters
robot mounting motion, industrial robot mounting motion
Montagebewegungslänge
assembly movement length
Montagebewegungsrichtung
assembly movement direction
stran 181 od 326
EN ‐DE: slovar avtomatizacije in robotike Montagebewegungszeit
Montagebewertung
Montagebock
Montagedaten pl
Montagedokumentation
Montageeinheit
Montageeinheit
Montageeinrichtung
Montageeinrichtung
Montageeinrichtung montage
Montageerfahrung
Montagefamilie
Montagefolge
Montagegraph
Montagegreifer
Montagegreifer mit elastischen Elementen
Montagegreiferbewegung
Montagegrundverfahren
Montagehalle
Montagehaltevorrichtung
Montagehauptprogramm
Montagehilfe
Montagehilfe
Montagehinweis Montageindustrieroboter
Montagekonzeptuntersuchung
Montagekopf eines Montageroboters
Montagekosten bei Robotereinsatz
Montagekraft
Montagekran
Montagelage
Montageleimung
Montagelinie
Montagelösung
Montagemanipulator
Montagemaschine
Montagemaschinenkonfiguration
Montagemechanisierungsgrad
Montagemethode
Montagemikrobibliothek
Montagemittel
Montagemodell
Montagemomente
Montageobjekt
Montageobjektdaten pl
Montageoperation
Montageoperation eines Industrieroboters
Montageoperationsdatei
Montageorganisation
Montageorganisation für lR
Montageperipherie
Montageplanung für IR
Montageplatte
Montageplatz
Montageplatzlayout
Montagepositionierfehler
Montagepositionsfehler
Montageprinzip
Montageproblem eines Industrieroboters
Montageprogramm
Montageprojekt
Montageprozess
Montageprozessbestimmung
Montageprozessperipherie
Montagepunkt
Montagereihenfolge
Montageroboter
Montageroboter für elektronische Bauelemente
Montageroboter mit direkter Steuerung von Werkzeugen
Montageroboteranpassung
Montageroboterart
Montagerobotergruppe
Montageroboterhardware
Montagerobotersoftware
Montageroboterstruktur
Montageroboterverhalten
assembly movement time
assembly valuation
assembly stand
assembly data
erection drawing
assembling unit
assembly unit
assemblage device
assembly fixture
erecting tool
assembly experience
assembly family
assembly sequence
montage graph
assembly gripper
assembly gripper with elastic elements
movement of assembly gripper, motion of assembly gripper
basic assembling procedure
assembly hall
assembly support
assembly main program, assembly master routine
assemblage device
assembly fixture
assembly instruction
assembly industrial robot
assembly draft investigation
assembly head of assembly robot
robot assembly costs
assembly force
erection crane
assembly position
constructional gluing
assembly line (automated)
assembly solution
assembly manipulator
assembly machine, mounting machine
assembly machine configuration
mechanization order of assembly
assembly method
assembly micro‐library, AML
assembly instrument
assembly model
assembly moments
assembly object
assembly object data
assembly operation, assemblage operation
robot assemblage operation, IR assemblage operation
assembly operation file
assembly organization
robot assembly organization
assembly periphery
robot mounting planning, robot assembly planning
mounting plate
erection site
layout of erection site
assembly positioning error
assembly position error
assembly principle
assembly problem of [industrial] robot
assembly program
erection project
assembly process
assembly process determination
assembly process periphery
assembly point
assembly sequence
mounting robot, assemblage robot, industrial robot for mount
assembly robot for electronic components
assembly robot with direct control of tools
adaptation of assembly robot
assembly robot kind
assembly robot group
assembly robot hardware
assembly robot software
assembly robot structure, structure of assembly robot
assembly robot behaviour
stran 182 od 326
EN ‐DE: slovar avtomatizacije in robotike Montageroboter‐Wechselsystem
Montageschema
Montageschema
Montageschraube
Montageschwierigkeit
Montageschwierigkeit montage
Montageschwierigkeit montage
Montageschwierigkeitsgrad
Montagesensor
Montagesimulationsprogramm
Montagesimulationsverfahren
montagespezifische IR‐Programmierung
Montagesprache Assembly Language (Robotersprache)
Montagestation
Montagestationenlayout
Montagesteuersystem
Montagesteuersystem
Montagestraße f. Montagebahn
Montagestückzahl
Montagesystem
Montagesystem
Montagesystem
Montagesystem mit Robotern
Montagesystemgenerieren
Montagesystemnachgiebigkeit
Montagesystemparameter
Montagetechnik
Montagetechnik
Montagetechnik montage
Montagetechnik montage
Montagetechnikmodell
Montagetechnologie
Montagetechnologie
Montagetechnologie
Montagetechnologie
montagetechnologischer Ablauf
montagetechnologisches Prinzip
Montageteil
Montageteilhandhabung
Montageteilhandhabung
Montageteilhandhabung
Montageteilprozess
Montageumdrehoperation
Montageuntergruppe
Montageunterlagen
Montageversuch
Montageversuch mit Industrierobotern
Montagevorgang
Montagevorzugsrichtung
Montagewerkzeug
Montagezeichnung
Montagezeit
Montagezelle
Montagezentrum
Montagezubringervorrichtung
Montagezustand eines Roboters (Industrieroboters)
Montagezyklus eines Industrieroboters
Monte‐Carlo‐Simulation
Monte‐Carlo‐Verfahren
montieren (durch Roboter)
montierte Einzelteile pl
montierte Endposition
montiertes Bauelement
montiertes Kugellager
Moore‐Penrose‐Inverse
Moore‐Penrose‐Inverse
Motor
Motor mit regelbarer Drehzahl
Motordrehzahlregelung
Motorführung
Motorführung
Motorgeschwindigkeitssteuerung
motorgetriebener Roboter
Motorimpulssteuerung
Motorkompensator mit PID‐Regler PID
Motorlebensdauer change system of assembly robot
installation diagram
installation lay‐out
fitting bolt
mounting difficulty, assembly difficulty
mounting difficulty
assembly difficulty
difficulty coefficient of assembly
assembly sensor
assembly simulation program
assembly simulation process
assembly‐specific IR‐programming
assembly language, AL (robot language)
assembly station
assembly station layout
assembly control systems
assembly control systems, ACS
assembly line
assembly number of pieces
assembly system, mounting (assemblage) system
assembly system
mounting system
robot assembly system
assembly system generation
elasticity of assembly system, flexibility of assembly system
assembly system parameter
assembly technique
mounting technique, assemblage technique
mounting technique
assemblage technique
assembly technique model
assembling technology
mounting technology, assembly technology
mounting technology
assembly technology
technological development of assembly
technological principle of assembly
assembly part
handling of assembly parts, manipulation of assembly parts
handling of assembly parts
manipulation of assembly parts
assembly sub‐process
assembly revolution operation
sub‐assembly, assembly elements, assembly module
assembly documentation
assembly test
robot assembly test, industrial assembly test
assembly process
assembly‐preferred direction (of robot)
assembly tool
assembly drawing
erecting time, assembling time
assembly cell
assembly centre
assembly feed device
assembly state of [industrial] robot
robot assembly cycle, industrial robot mounting cycle
Monte‐Carlo modelling
Monte‐Carlo techniques
mount to (by robot)
assembled parts (pieces)
assembled end (final) position
assembled component
assembled ball bearing
Moore‐Penrose pseudoinverse
pseudoinverse
motor
change‐speed motor
motor speed control
motor control
engine control
motor speed control
motor‐driven robot
motor pulse control
motor compensator with PID regulator
working life of motor
stran 183 od 326
EN ‐DE: slovar avtomatizacije in robotike Motorsteuerungseinheit
Motorversorgungsstrommessung
Motorzeitkonstante
Multibusfamilie
Multibusstruktur
multidimensionale Verteilung
Multielement‐Aktivierungsanalyse
Multielementtrennung
Multifunktionsrelais
Multigruppenmodell
Multigruppennäherung
Multigruppentheorie
Multikanalbus
Multilokutor
Multimikroprozessorsystem
Multiparameteranalyse
Multiparameteranalyse
multiplex
Multiplexbetrieb
Multiplexbetrieb
Multiplexeinrichtung
Multiplexer
Multiplexfernmessverfahren
Multiplexierung
Multiplexkanalsteuereinheit
multiplikatives Gegenstromverfahren
Multiplikator
Multiplikator
Multiplikator
Multipliziereinheit f
Multipliziereinheit f
Multipliziereinheit f
Multiplizierer
Multiplizierer
Multiplizierer
Multiplizierschaltung
Multiplizität
Multiplizitätsfilter
Multipositionsschalter
Multiprozessor
Multiprozessor mit Verbindungskanälen
Multiprozessoranwendung
Multiprozessorarbeit
Multiprozessorbetrieb
Multiprozessorsteuersystem
Multiprozessorsystem
Multipunktsensor
Multipunktsteuerung
Multipunktsteuerung MP
Multisensor
Multisoft‐Roboter
Multistabilität
Multivibrator
Muster
Mustererkennung
Mustererkennungsalgorithmus
Musterfunktion
Musterfunktion für IR
Musterkarte
Musterkartenvorbereitung
Musterklassifizierung
Mustermaske
Mustermodell
myoelektrisch gesteuerte Roboterhand .
myoelektrisches Signal
myoelektrisches Signal n
n auswechselbarer Greifer
n definierte Greiferbahn
n definierte Roboterraumbahn
n energieunabhängiger Speicher
n flexible Handhabetechnik
n hydraulische Flüssigkeit
n Kontaktkraft
n mechanischer Sensor
n optischer Inkrementalkodierer (für Roboter)
n optisches Zeichenlesen
motor control assembly
motor supply current measurement
motor time constant
Multi bus family
multiple‐bus structure
multidimensional distribution
multielement activation analysis
multielement separation
multifunction relay
multigroup model
multigroup approximation
multigroup theory
multichannel bus
multilocutor
multimicroprocessor system
multiparameter analysis
multidimensional analysis
multiplex
multiplex mode
multiplexed operation
multiplex device
multiplexer
multiplex telemetering
multiplexing
multiplexer channel control unit
multiplicative counter‐current process
multiplier
multiplying device
multiplying unit
multiplier
multiplying device
multiplying unit
multiplier
multiplying device
multiplying unit
multiplication circuit
multiplicity
multiplicity filter
multiposition switch
multiprocessor
channel‐coupled multiprocessor
multiprocessor application
multi[ple‐]processor operation
multi[ple‐]processor operation
multiprocessor control system
multiprocessor system
multipoint sensor
multipoint control
multipoint control, MPC, multipoint, MP
multisensor
multisoft robot
multistability
multivibrator
sample
master identification
algorithm for pattern recognition
pattern function
robot pattern function
sample card
sample card preparation
pattern classification
pattern mask
demonstration model
myoelectric‐controlled robot hand
myoelectric signal
myoelectric signal
interchangeable gripper
defined gripper path
defined robot space path
energy‐independent store
flexible handling technique
hydraulic fluid
contact force
mechanical sensor
optical incremental encoder (for robots)
optical character recognition, OCR
stran 184 od 326
EN ‐DE: slovar avtomatizacije in robotike n s. C 227
complex environmental acquisition
n Schwingbewegung
oscillatory motion
n stabile Roboterdaten pl
stable robot data
theory of numerical treatment
n Theorie der numerischen Behandlung
tool quality checking
n Werkzeugqualitätsprüfung
nach geschalteter Prozessor
back‐end processor, BEP
nach visuellen Informationen
cording to visual information
Nacharbeit
patch work
Nachbarelement
adjacent element
Nachbarkanal
adjacent channel
Nachbarkanalschwebungsfrequenz
adjacent‐mode beat frequency
Nachbarmodenüberlagerungsfrequenz
adjacent‐mode beat frequency
Nachbarzustände
adjacent states
Nachbearbeitung
additional treatment
Nachbearbeitung
subsequenttreatment
Nachbehandlung
additional treatment
Nachbehandlung
subsequenttreatment
nachbilden
simulate v
Nachbildung eines kybernetischen Systems
simulation of cybernetic system
Nachbildung von digitalen Systemen auf einem Rechner
computer simulation of digital systems
Nacheilungsdarstellung
lag representation
Nacheilungswinkel
lag angle
nacheinander
sequential
nacheinander
serial
automatic guidance system
Nachführautomatik
Nachführregelung f(eines IR)
master‐and‐slave control (of IR)
nachgeschalteter Prozessor
back‐end processor
nachgiebige Greiferlagerung elastic gripper support
nachgiebiges Robotergelenk
elastic robot joint
Nachgiebigkeit feines Montagesystems
elasticity of assembly system, flexibility of assembly system
Nachlaufperiode
hunting period
Nachlaufregelungssystem
follow‐up system
Nachlaufregelungssystem
servosystem
Nachlaufverzögerung
tracking lag
Nachleuchtdauer
decay time
Nachregelung
readjustment
Nachricht
message
Nachricht
notice
Nachrichtenaufbau
information build‐up
Nachrichtenbehandlung
message handling
Nachrichteneinheit
information unit
Nachrichteneinheit
information bit
Nachrichtenelement
information unit
Nachrichtenelement
information bit
Nachrichtenfernverkehr m
remote communications
Nachrichtenführung
message routing
Nachrichtenkanal
communication channel
Nachrichtenleitung
message routing
Nachrichtenmittel communication
communication medium
Nachrichtenpriorität
message priority
Nachrichtenquelle
information transmitter
Nachrichtenquelle
message source
Nachrichtentheorie
communication theory
Nachrichtenübertragung und Steuerung im Tier und in der Macommunication and control in the animal and in the machine
Nachrichtenübertragungsnetz
communication network
Nachrichtenübertragungsprozess communications
communication process
Nachrichtenübertragungs‐Steuerprogramm
message control program
Nachrichtenübertragungssystem
message transfer system
Nachrichtenverkehrsanwendung
communication application
Nachrichtenvermittlung
message switching
Nachrichtenverwaltung
message handling
Nachschaltprozessor
back‐end processor
Nachschaltprozessor
back‐end processor, BEP
Nachspeisung
make‐up [feed]
Nachstellglied
reset component
Nachstellwirkung
floating action
nachweisbar
identifiable
Nachweisempfindlichkeit
detection sensibility
Nachweisschwelle
detecting threshold
Nachweiszeit
detection time
nahangeordneter Sensor
proximity sensor
zero (ZO)
nahe‐Null (ZE)
Näherung
approximation
Näherungsdetektor
proximity detector
proximity effect
Näherungseffekt
approximate design
Näherungsentwurf
stran 185 od 326
EN ‐DE: slovar avtomatizacije in robotike Näherungsformel
Näherungsgleichung
Näherungsgröße
Näherungsgröße
Näherungsintegration
Näherungslösung
Näherungsmodell eines IR
Näherungsrechnung
Näherungsrechnung
Näherungssensor
Näherungssensorsystem
Näherungssimulation
Näherungsverfahren
Näherungswert
Näherungswert
Nahgeber
Nahsensoren
Nahtschweißen
Nahtschweißmanipulator
NAND‐Glied
NAND‐Operation
NAND‐Schaltung
Nanosekunde
Nanosekunde
Nanosekundenimpulsgenerator nanosecondes
Nanovoltzerhacker nanovolts
naturgetreue Antwort
natürlich
natürliche Erregung
natürliche Kühlung
natürliche Nichtlinearität
natürliche Sprache
natürliches Ansprechen
natürliches Wort
Navigation
Navigationskommunikation
NC‐Bearbeitungsprogramm
NC‐Datensicherung
NC‐Maschine
n‐dimensionaler Spaltenvektor
Nebenachse feines IR
Nebenanlagen
Nebenarbeitsraum eines IR
nebeneinandergeschaltet
Nebenfunktion
nebengeschalteter Regelkreis
nebenlaufend
Nebenmodulation
Nebennichtlinearität
Nebenprozessor
Nebenprozessor
Nebenprozessor
Nebensprechmesser
Nebenstromkreis
Negation
negativ (NE)
negativ definit negative feedback coupling resistor 426
negative Bahnabweichung
negative Beschleunigung
negative Impedanz
negative Logik
negative Rückführung
negative Rückführung
negative Schaltungslogik
negativer Impuls
negativer Scheinwiderstand
negativer Selbstausgleich
negativer Widerstand
negativer Wirkwiderstand
negatives Phasensequenzrelais
negativ‐groß (NG)
negativ‐klein (NK)
Negativlogikschaltung
Negativlogiksignal
negativ‐mittel (NM)
Negativschaukasten
approximate formula
approximate equation
approximate quantity
approximate value
approximate integration
approximate solution
approximation model of IR
approximate calculation
approximate computation
approximation sensor
approximation sensor system
approximation simulation
approximation method
approximate quantity
approximate value
proximity sensor
close sensors
seam welding
seam welding handler (manipulator)
NAND‐element
NAND‐operation
NAND‐circuit
nanosecond
millimicrosecond
nanosecond impulse generator
nanovolt chopper
natural response
natural
natural excitation
natural cooling
natural non‐linearity
natural language
natural response
natural parole
navigation
navigation communication
numerical control processing program, NC‐processing program
numerical control data backup
numeric controlled machine tool
n‐dimensional column vector
auxiliary axis of IR
off‐sites
slave working room of IR
parallel‐connected
secondary function
parallel control loop
concurrent
spurious modulation
intentional non‐linearity
support processor, slave processor
support processor
slave processor cross‐talk meter
subcircuit
negation
negative (N)
negative definite
negative path deviation
negative acceleration
negative impedance
negative logic
degenerative feedback
negative feedback
negative logic
negative pulse
negative impedance
negative self‐regulation
negative resistance
negative resistance
negative phase sequence relay
negative big (NB)
negative small (NS)
negative‐logic circuit
negative‐logic signal
negative medium (NM)
negatoscope
stran 186 od 326
EN ‐DE: slovar avtomatizacije in robotike Negierbefehl
negieren
Neigungswinkelmesser
NEIN‐Schaltung
NEIN‐Schaltung
Nennabgabe
Nennausschaltvermögen
Nennbelastung
Nennbelastung
Nennbereich
Nennerpolynom
Nennfrequenz
Nenngröße
Nennlast
Nennlebensdauer
Nennleistung
Nennleistung für Aussetzbetrieb
Nennreichweite
Nennspannung
Nennspannung
Nennspannungsbereich
Nennstrom
Nennumwandlungsverhältnis
Nennwert
Nennwert
Neodym‐Laser
Neondigitalanzeige
Neondigitaldarstellung
Neper
Nephelometer
nephelometrische Analyse
Nernstbrücke
Nettoimpulsrate des Kernstrahlungsdetektors
netzabhängiger Wechselrichter
Netzanschlusswert
Netzaufbau
Netzausfall
Netzcomputer
Netzdämpfung
Netzdämpfung
Netzfrequenz
Netzgerät
Netzkonstante
Netzmodell
Netzoptimierung
Netzphasenrelais
Netzplantechnik
Netzregler
Netzspannung
Netzspannungsregler
Netzspannungsregler
Netzspannungsschwankungen
Netzstabilität
Netzstrom
Netzstruktur
Netzüberwachung
Netzwechselspannung
Netzwerk
Netzwerkanalysator
Netzwerkanalyse
Netzwerkanalyse
Netzwerkanwendung
Netzwerkelement
Netzwerkelement
Netzwerkelement
Netzwerkgleichungslöser
Netzwerksimulator
Netzwerksteuerungssystem
Netzwerksynthese
Netzwerktheorie
Netzwerktopologie
Netzwerkübertragungsschaltkreis
Netzwerkübertragungsschaltung
Neueinstellung
neutral gesteuertes Objekt
neutrale Zone
ignore instruction
negate v
clinometer
NOT‐circuit
NOT‐gate
nominal output
rated breaking capacity
rated load
nominal load
nominal range of use
denominator polynomial
nominal frequency
rated quantity
rated capacity
rated life
nominal output
periodic rating
nominal range of use
rated voltage
nominal voltage
range of rated voltage
rated current
nominal transformation ratio
nominal value
rating
neodymium laser
neon digital display
neon digital display
neper
nephelometer
nephelometric analysis
Nernst bridge
net pulse rate of nuclear radiation detector
dependent inverter
mains connection value
network configuration
power fail[ure]
network computer
network attenuation
network damping
power frequency
power supply unit
network constant
network model
network optimization
network phasing relay
network technique
voltage regulator
line voltage
line voltage regulator
line variation
line voltage fluctuations
network stability
supply current network configuration
net control
alternating‐current line voltage
network
network analyzer
circuit analysis
network analysis
network application
circuit element
switching element
network element
network analyzer
network analyzer
network control system
network synthesis
network theory
network topology
network communications circuit
network communications circuit
reset[ing]
neutral‐controlled plant
neutral zone
stran 187 od 326
EN ‐DE: slovar avtomatizacije in robotike neutrales Relais
neutrales System
Neutralisation
Neutralisieren
Neutronenaktivierungsanalyse
Neutronengenerator
Neutronenimpuls
Newtonsche Bewegungsgleichung
Newtonsche Strömungsmechanik
Newtonsches [Iterations‐] Verfahren
nichlineares Entkopplungsverfahren
Nichols‐Plan
Nichols‐Plan
nicht abgestimmte Dämpfung
nicht abgestimmte Dämpfung
nicht abgewichenes Energieniveau
nicht abnehmende Funktion
nicht ausfallsichere Betriebsweise
nicht behebbarer Fehler
nicht beherrsch bare Roboterregelung
nicht definierte Robotertrajektorie
nicht definierter Arbeitspunkt eines Roboters
nicht in der richtigen Reihenfolge
nicht steuerbares System
nicht umkehrbare Steuerung
nicht umkehrbarer Zähler
nicht verketteter Manipulator
nicht zerstörungsfreie Prüfung
nichtadressierbarer Speicherbereich
nichtanzeigender Regler
nichtäquivalentes Element
Nichtäquivalenz
nichtarithmetische Operation
Nichtauslegungsstörfall
Nichtauslegungsunfall
nichtautomatisches Ansprechen
nichtautomatisiertes Informationssystem
nichtbehebbarer Fehler
nichtbehebbarer Fehler
nichtbeobachtbares System nichtdeterminierter Automat
nichtdigitale Information
nichtdispersive Spektrometrie
nichtdringlicher Alarm
nichtdringliches Alarmsignal
nichtelektrische Größe
NICHT‐Element
NICHT‐Element
nichtentartetes System
nichtetikettiert
nichtgeforderte Funktionszeit
nichtgerichteter Stromschutz
nichtgestörter Wert
Nichtgleichgewicht
Nichtgleichgewichtszustand
nichthomogenes Magnetfeld
nichthomogenes Magnetfeld
nichtintegrierte Bauweise
nichtisotherme Messdaten pl
nichtkohärente Detektion
nichtkohärentes Empfängersystem
nichtkohärentes Signal
Nichtkompatibilität
nichtkompatibler Mikroprozessor
nichtkritische Abmessung
nichtkritische Masse
nichtkritischer Reaktor
nichtlinear
nichtlineare Abhängigkeit
nichtlineare Dämpfung
nichtlineare Differentialgleichung
nichtlineare Differentialgleichung
nichtlineare dynamische Operation
nichtlineare Entkopplungsschaltung
nichtlineare Erscheinungen im akustischen Feld
nichtlineare Gleichung
non‐polarized relay
neutral system
neutralization
neutralization
neutron activation analysis
neutron generator
neutron pulse
Newton's motion equation
Newtonian fluid mechanics
Newton‐Raphson method
non‐linear decoupling process
Nichols chart
Nichols diagram
aperiodic damping
aperiodic attenuation
non‐degenerate energy level
non‐decreasing function
non‐failsafe mode
unrecoverable error
non‐controllable robot regulation
non‐defined trajectory of robot
non‐defined working point of robot
out of sequence
Uncontrollable system
non‐reversible control
non‐reversible counter
non‐chained manipulator
destructive test
non ‐addressable memory area, non‐addressable store zone
non‐indicating controller
non‐equivalence element
non‐equivalence
non‐arithmetical operation
non‐design‐basis accident
non‐design‐basis accident
non‐automatic tripping
non‐automated information system
unrecoverable error
uncorrectable error unobservable system non‐deterministic automaton
non‐digital information
non‐dispersive spectrometry
non‐urgent alarm
non‐urgent alarm
non‐electric value
NOT‐component
NOT‐element
non‐degenerate system
unlabelled non‐required time
non‐directional current protection
quiescent value
non‐equilibrium
non‐equilibrium state
inhomogeneous magnetic field
nonhomogeneous magnetic field
non‐integrated concept
non‐isothermal measuring data
incoherent detection
incoherent reception system
incoherent signal
incompatibility
incompatible microprocessor
non‐critical dimension
non‐critical mass
non‐critical reactor
non‐linear
non‐linear dependence
non‐linear damping
nonlinear differential equation
non‐linear differential equation
non‐linear dynamic operation
non‐linear stopper circuit
non‐linear effects in acoustical field
non‐linear equation
stran 188 od 326
EN ‐DE: slovar avtomatizacije in robotike nichtlineare Kopplung
nichtlineare Mechanik
nichtlineare Modulationskennlinie
nichtlineare Optik
nichtlineare optische Eigenschaften
nichtlineare optische Suszeptibilität
nichtlineare optische Wechselwirkung
nichtlineare Programmierung
nichtlineare Reaktanz
nichtlineare Regelung
nichtlineare Regelung
nichtlineare Roboterbewegungsgleichung
nichtlineare Suszeptibilität
nichtlineare Transiente
nichtlineare Verzerrung
nichtlineare Wechselwirkung
nichtlinearer Anteil
nichtlinearer Anteil
nichtlinearer Anteil
nichtlinearer Bauteil
nichtlinearer Bauteil
nichtlinearer Entkopplungsanteil
nichtlinearer Funktionsgenerator
nichtlinearer Geschwindigkeitsregler
nichtlinearer optischer parametrischer Prozess
nichtlinearer Umwandler
nichtlinearer Verstärker
nichtlineares
nichtlineares Element
nichtlineares Element
nichtlineares Element
nichtlineares Element mit Begrenzung
nichtlineares Element mit eindeutiger Kennlinienfunktion
nichtlineares Element mit Hysterese
nichtlineares Element mit Lose
nichtlineares Element mit mehrdeutiger Kennlinienfunktion
nichtlineares Element mit Sättigung
nichtlineares Element mit Totzone
nichtlineares Element mit zweideutiger Kennlinienfunktion
nichtlineares Element mit Zweipunktverhalten
nichtlineares Entkopplungsverfahren
nichtlineares Filtersystem
nichtlineares Glied
nichtlineares Glied
nichtlineares Regelungssystem
nichtlineares Regelungssystem
nichtlineares Regelungssystem
nichtlineares System
nichtlineares System
nichtlineares Übertragungsglied
Nichtlinearität
Nichtlinearität
Nichtlinearität als prinzipielle Eigenschaft
nichtmanuelle Robotersteuerung
nichtmarkiert Nichtmischbarkeitsanalyse
Nichtmoderator
nichtmodulierte Trägerwelle
nichtnormalisierte Darstellung
nichtnumerische Punktsteuerung
nichtnumerische Steuerung
nichtparametrischer Roboteralgorithmus
nichtperfekte Kontur
nichtperiodische Funktion
nichtperiodisches Amperemeter
nichtprivilegierter Befehl
nichtprogrammierbare Handhabungsgeräte
nichtradioaktiver Indikator
nichtrealisierter Befehl nichtrelevanter Ausfall
Nichtresonanzprozess
nichtreziproker parametrischer Verstärker
NICHT‐Schaltung
NICHT‐Schaltung
nichtschwingendes System
nichtselektiver pneumatischer Detektor
non‐linear coupling
non‐linear mechanics
non‐linear modulation response
non‐linear optics
non‐linear optical properties
non‐linear optical susceptibility
non‐linear optical interaction
non‐linear programming
non‐linear reactance
non‐linear regulation
non‐linear control
non‐linear motion equation of robot
non‐linear susceptibility
non‐linear transient
non‐linear distortion
non‐linear interaction
non‐linear share, non‐linear part
non‐linear share
non‐linear part
non‐linear link
non‐linear element
non‐linear decoupling part
non‐linear function generator
non‐linear speed controller
non‐linear optical parametric process
non‐linear converter
non‐linear amplifier
nonlinear
nonlinear element
non‐linear link
non‐linear element
limiting nonlinearity
single‐valued nonlinearity
hysteresis nonlinearity
backlash nonlinearity
multivalued nonlinearity
saturating nonlinearity
dead zone nonlinearity
two‐valued nonlinearity
on‐off nonlinearity
non‐linear decoupling process
non‐linear filter system
non‐linear link
non‐linear element
nonlinear control system
non‐linear control system
nonlinear feedback control system
nonlinear system
non‐linear system
non‐linear transfer circuit
nonlinearity
non‐linearity
inherent nonlinearity
non‐manual robot control
unlabelled immiscibility analysis
non‐moderator
unmodulated carrier non‐normalized representation
non‐numerical point control
non‐numerical control
non‐parametric robot algorithm
non‐perfect contour
non‐periodical function
dead‐beat ammeter
unprivileged instruction, non‐privileged instruction
non‐programmable manipulation devices
non‐radioactive indicator
unimplemented instruction non‐relevant failure
non‐resonance process
non‐reciprocal parametric amplifier
NOT‐circuit
NOT‐gate
non‐oscillating system
non‐selective pneumatic detector
stran 189 od 326
EN ‐DE: slovar avtomatizacije in robotike nichtsensorisiertes System
Nichtsicherheitsfunktion
nichtsinguläre Matrix
nichtsingulärer Punkt
nichtstationär
nichtstationäre Bewegung
nichtstationärer Betriebszustand
nichtstationärer Eingang
nichtstationärer Prozess
nichtstationärer stochastischer Prozess
nichtstationärer Vorgang
nichtstationäres System
nichtsteuerbares System
nichtsymmetrische Selbstschwingungen
NICHT‐Tor
NICHT‐Tor
nichttriviale Lösung
nichtumlaufende Drehbewegung
NICHT‐UND‐Glied
NICHT‐UND‐Operation
nichtunterbrechbare Betriebsweise nichtvorgespannt nichtzerstörendes Lesen
Niederdruckbereich
Niederdruckkreislauf
Niederdruckprozess
Niederdruckteil
Niederfrequenzdemodulator
Niederfrequenzfilter
Niederfrequenzinduktionsheizung
Niederfrequenzintervall
Niederfrequenzkanal
Niederfrequenzkreis
Niederfrequenzverstärker
Niederfrequenzverzerrung
Niederleistungsanwendung
Niederspannungskreis
Niedertemperaturbolometer
Niedertemperaturdemodulator
Niedertemperaturdetektor
niedrige Robotergeschwindigkeit
niedrige Schwellenstromdichte
niedriger Zustand
Niedrigpegelschaltung
Nietarbeitsgang durch Roboter
Nieten mittels Industrieroboters
Nietroboter
Niveauanzeiger
Niveaudetektor
Niveaufernanzeiger
Niveaufernanzeiger
Niveaugeber
Niveaukreuzung
Niveauquantisierung
Niveauregler
NNC
nochmalige Abtastung
nockengeführte Achse
nockenloser Automat
Nockenpositionierung
Nockensteuerung
Nockensteuerung
nomalisierte unscharfe Menge
nominales Motoranzugsmoment
Nominalsteilheit der Wellenfront
Nomogramm
NOR‐Funktion
Norm
Norm
Norm eines Vektors
Normalausrüstung
Normalband
Normalbetrieb
Normale
normale Markow‐Algorithmen
normale Permeabilität
non‐sensorized system
non‐safety function
non‐singular matrix
non‐critical point
non‐steady
unsteady motion non‐steady running conditions
non‐stationary input
non‐stationary process
non‐stationary random process
non‐stationary process
non‐stationary system
uncontrollable system
non‐symmetric autooscillations
NOT‐circuit
NOT‐gate
non‐trivial solution
non‐circulating rotation movement
NAND‐element
NAND‐operation
uninterruptable mode unbiased non‐destructive reading
low‐pressure range
low‐pressure circuit
low‐pressure process
low‐pressure subsystem
low‐frequency demodulator
low‐frequency filter
low‐frequency induction heating
interval of low frequencies
audio channel
audio‐frequency circuit
audio‐frequency amplifier
low‐frequency distortion
low‐power application
low‐voltage circuit
low‐temperature bolometer
low‐temperature demodulator
low‐temperature detector
low robot speed
low‐threshold current density
low state
low‐level circuit
rivet operation by robot
robot riveting, riveting by means of the industrial robot
rivet robot
level indicator
level detector
level teleindicator
remote level indicator
level transmitter
level crossing
amplitude quantization
level controller
non‐numerical control
repeat scanning
cam‐operated axle
camless automatic machine
cam positioning
cam control
cam‐set control
normalized fuzzy set
rated motor torque
nominal steepness of wave front
nomogram
NOR‐function
norm
standard
norm of vector
standard equipment
normal band
normal operation
normal
normal Markov algorithms
normal permeability
stran 190 od 326
EN ‐DE: slovar avtomatizacije in robotike normaler Anfahrvorgang
normaler Energiepegel
normaler Kernmasseneffekt
normaler Start
normales Anfahren
Normalform (kanonische Form)
Normalgerät
normalisieren
normalisierte Daten pl
normalisierte Form
Normalisierung
Normalmagnetband
Normalmagnetisierungskurve
Normalverteilung
Normalverteilung
Normalverteilung von zwei Größen
Normalzustand
Normalzustand
normierte Dämpfung
normierte Spektraldichte
normierte spektrale Leistungsdichte
normierte Zeit
Normierungsprinzip
Normsignal
NOR‐Schaltung
Nortstrom
Not
Notabschaltung
Notausschalter
Notausschalter eines tR
Notausschaltknopf
Noteregelung
Notschalter (eines Industrieroboters)
Notstoppprogramm
Notstromversorgung
notwendige Optimalitätsbedingungen
n‐Spurenband
Nuklearmessinstrumente
Null
Null
Nullabgleich
Nullabgleich
Nullabgleich
Nullabgleichglied
Nullanschluss
Nullanschluss
Nullanzeigegerät
Nullast
Nullausgangssignal
Nullbyte
Nullbyte
Nulldatenlänge
Nulldimension
Nulldispersion
Nulldurchgang
Nulldurchgang
Nulleffektimpulsrate
Nulleinstellen von Selsynen
Nulleinstellung
Nulleinstellung
Nulleinstellung
Nulleiter
Nullenunterdrückung
Nullereignis
Nullfehlerstellungssystem
Nullfolge
Nullform
Nullfrequenz
Nullgang
Nullgeschwindigkeit
Nullimpuls
Nullimpulsgeber
Nullindikatorverstärker
Nullinstrument
Nullkoordinatensystem
Nullmatrix
normal start‐up procedure
normal energy level
normal mass effect
normal start‐up procedure
normal start‐up procedure
normal form
standard instrument
normalize v
normalized data
normalized form
normalization
normal band
normal magnetization curve
Gaussian distribution
normal distribution
bivariate normal distribution
normal condition
normal state
damping ratio
normalized power spectral density
normalized power spectral density
non‐dimensional time
standardization principle
standard signal
NOR‐circuit
standby current emergency
emergency shut‐down
emergency cutout
off‐emergency of industrial robot
emergency stop‐button
emergency control
emergency switch (of industrial robot)
emergency stop program
emergency power supply
necessary optimality conditions
n‐channel tape
nuclear measuring instruments
zero
null
balance check
null balance
zero balance
null‐balance device
neutral connection
neutral lead
null [indicating] device
zero charge
zero output
zero byte
byte of zero
zero data length
zero dimension
zero dispersion
zero point
null point
background pulse rate
zero setting of selsyns
zero adjustment
reset[ing]
zero resetting
neutral conductor
zero suppression
null event
zero error position system
zero series
zero form
zero frequency
null stroke
zero velocity
reset pulse
zero impulse generator
zero‐balance amplifier
null instrument
zero‐phase‐sequence coordinate system
null matrix
stran 191 od 326
EN ‐DE: slovar avtomatizacije in robotike Nullmatrix
Nullmessmethode
Nullmessmethode
Nullmethode
Nullmethode
Nullmethode
Nullmethode
Nullpotential
Nullpunkt
Nullpunkt
Nullpunkt der Skale
Nullpunktabgleich
Nullpunktabgleich
Nullpunktabgleich
Nullpunktabweichung
Nullpunktabweichung
Nullpunktdetektion
Nullpunkteinstellung
Nullpunkteinstellung
Nullpunkteinstellung
Nullpunkteinstellung
Nullpunkteinstellung
Nullpunkteinstellvorrichtung
Nullpunkteinstellvorrichtung
Nullpunkteinstellvorrichtung
Nullpunkteinstellvorrichtung
Nullpunktempfindlichkeit
Nullpunktenergie
Nullpunktkonstanz
Nullpunktlage eines Greifers
Nullpunktrichtung
Nullpunktsensor
Nullpunktstabilität
Nullpunktwanderung
Nullspannung
Nullspannungsauslöser
Nullspannungsauslöser
Nullstelle
Nullstelle
Nullsteller
Nullsteller
Nullsteller
Nullsteller
Nullstellung
Nullstellungsanzeigevorrichtung
Nullstellungsausschaltung
Nullstellungszustand
Nullsystemschutz
Nulltyp‐Elektrometer
Nullvorlaufsteuerung
Nullvorspannung
Nullwahrscheinlichkeit
Nullwert
Nullzeitimpuls
Nullzustand
numerisch gesteuerte Arbeitsmaschine
numerisch gesteuerte Handhabeeinrichtung
numerisch gesteuerte Manipulatoreinrichtung
numerisch gesteuerte Werkzeugmaschine
numerisch gesteuerter Drei‐Achsen‐Roboter
numerisch gesteuerter Industrieroboter
numerisch gesteuerter Verdrahtungsautomat
numerische Analysis
numerische Behandlung
numerische Behandlung
numerische Behandlung
numerische Daten pl
numerische Datenübertragung
numerische Differentiation
numerische Einrichtung
numerische Einstellung
numerische Größe
numerische Integration
numerische Iteration
numerische Konstante
numerische Positionsanzeige
zero matrix
compensation measuring method
null point method of measurement
null‐balance principle
zero method
balanced method
null method
zero potential
zero point
null point
scale zero
balance check
null balance
zero balance
zero error
zero variation
null detection
zero adjustment
zero adjuster
zero adjusting device
zero resetting device
zero set[ting] control
zero adjuster
zero adjusting device
zero resetting device
zero set[ting] control
zero‐level sensitivity
zero point energy
zero point constancy
gripper zero point position
zero direction
zero point sensor
zero stability
zero drift
zero voltage
no‐voltage release
no‐voltage trip
zero
null
zero adjuster
zero adjusting device
zero resetting device
zero set[ting] control
zero position
null [indicating] device
disengaging zero position
reset condition
zero‐phase‐sequence protection
null‐type electrometer
zero offset control
zero bias
zero probability
zero value
generator zero pulse time
zero state
numeric controlled working machine
numerically controlled manipulation equipment
numeric controlled manipulator equipment
numeric controlled machine tool
numerically controlled three‐axes robot
numeric controlled industrial robot
numerically controlled line wiring automaton
numerical analysis
numerical handling, numerical treatment
numerical handling
numerical treatment
numerical data
digital data communication
numerical differentiation
numerical setting‐up
numerical setting‐up
digital quantity
numerical integration
numerical iteration
numerical constant
numerical position indication
stran 192 od 326
EN ‐DE: slovar avtomatizacije in robotike numerische Positionsanzeige numerical position indication
numerische Positionssteuerung
numerical position control
numerical point control
numerische Punktsteuerung
numerische Rechenschemen
numerical computation schemes
numerische Robotersteuerung
computerized numerical control of IR
numerische Steuerung
digital control
numerische Steuerung
numerical control
numerische Steuerung
discrete control
numerische Steuerung von Werkzeugmaschinen
numerical machine tool control
numerische Steuerungsanlage (Roboter)
numerical control equipment
numerische Struktur
numerical structure
numerische Techniken
numerical techniques
numerische Techniken
digital technique
numerischer Frequenzmesser
digital frequency meter
numerischer Kodierer
digital encoder
numerischer Programmierschritt
numerical programming step
numerischer Wert
numerical value
numerisches Präzisionsmanometer
numerical precision manometer
numerisches Signal
numerical signal
numerisches Signal
digital signal
numerisch‐grafische Methode
numerical‐graphic method
numerisierte Parole o
numerized parole
Nutationskonstante
nutation constant
nutzbare Große utilize quantity (for computer) Nutzdämpfung
effective transmission equivalent
Nutzenergie
net energy
nutzerorientierter Entwurf m,anwendungsorientierter Entwu user‐oriented design Nutzkomponente
desired portion
Nutzkomponente
useful component
Nutzleistung
active power
Nutzleistung
real power
Nutzleistung useful performance
Nutzleistung effective power Nutzprogramm utility program Nutzsignal useful signal
Nutzsignal desired signal Nutzungsdauer
period of use
Nutzungsfaktor eines Industrieroboters
working factor of industrial robot
Nutzungsgrad eines Rechners
computer efficiency
Nyquist stability criterion
Nyquist Kriterium
Nyquist‐Ebene object configuration 442
Nyquist plane
Nyquist‐Methode
method of Nyquist
Nyquist‐Methode
Nyquist method
Nyquistsches Diagramm
Nyquist curve
Nyquistsches Diagramm
Nyquist diagram
Nyquistsches Kriterium
Nyquist criterion
obenaktives Signal
high‐active signal
obere Integrationsgrenze upper limit of integration obere Schranke upper bound oberer Grenzwert upper limit oberer Roboterarm
upper robot arm
oberes logisches Niveau
logic high level
Oberflächenbehandlung
surface treatment
Oberflächenbeschaffenheit
surface quality
Oberflächenbeschaffenheit surface
character of the surface
Oberflächendruckverteilung
surface pressure distribution
Oberflächengüte
surface quality
Oberflächenkontrolle
surface checking
Oberflächenmesssonde
surface measuring probe
Oberflächenschleifroboter
surface grinding robot
Oberflächenstruktur
surface structure
Oberwelle
overtone
Oberwelle
higher harmonic
Oberwellenanalysator
Fourier analyzer
Oberwellenanalysator
harmonic analyzer
Objektabtastung durch Greifer Objektoberfläche
object sensing by gripper
Objektaggressivität
aggressivity of object
Objektaggressivität aggressivity of object Objektaufnahme
object receiving
Objektbeschreibung
object description
Objektbild
object image, image of object
Objektbild
object image
Objektbild
image of object
Objektbildanalyse
object image analysis
Objektbildrestaurierung
restoration of object image
Objektbildverbesserung
object image improvement
stran 193 od 326
EN ‐DE: slovar avtomatizacije in robotike Objektdaten pl
Objektdatensatz
Objektdatensatz
Objektdimension
Objektebene
Objekteigenschaft
Objekterfassung
Objektergreifen
Objekterkennung
Objekterkennung
Objekterkennung
Objekterkennung grafischer Strukturen
Objekterkennungseinrichtung
Objekterkennungsfehler
Objekterkennungsfehler
Objekterkennungsfehler
Objekterkennungssystem
Objekterkennungssystem
Objekterkennungssystem
Objektfixierung
Objektform
Objektform
Objektfunktion
Objektgestalt
Objektgewicht
Objekthalten
Objektherstellung
objektive Veränderliche
objektives Fotometer
Objektkonfiguration
Objektlage
Objektmasse
Objektmasse eines Manipulators
Objektmaterial
Objektmodul
Objektoberflächenreflexion
objektorientierte Robotertechnik (Robotik)
Objektparameter
Objektposition
Objektprogramm
Objektraum
Objektraumerweiterung
Objektraumerweiterung r*
Objektspeicher am Roboter
Objekttemperatur
Objektverzerrung
Objektwerkstoff
OCP
ODER‐Glied
ODER‐Glied
ODER‐Operation
ODER‐Schaltung
ODER‐Verknüpfung
off
off
offene kinematische Kette eines Greifergetriebes
offene Robotersteuerkette
offene Schleife
offene Schleifensteuerung
offene Steuerkette eines Industrieroboters
offene Steuerung
offener Stromkreis
offener Wirkungskreis
offener Wirkungskreis
offenes Impulssystem
offenes Impulssystem mit veränderlichen Parametern
offenes System
Offline‐ Verarbeitung
Offlinef offline
Offlinef offline
Offline‐Konvertiersystem
Offline‐Modus
Offline‐Organisation
Offline‐Programmierung
Offline‐Programmierung
Offline‐Steuerung
object data
object data set
objet data set
object dimension
plane of object
property of object
object registration
object gripping
object identification, pattern recognition
object identification
pattern recognition
object identification of graphic structures
object recognition device
object recognition error (fault)
object recognition error
object recognition fault
object recognition system, system of object detection
object recognition system
system of object detection
object fixing
object form
form of object, shape of object
object function
form of object, shape of object
object weight, weight of object
holding of object
object production
objective variable
physical photometer
object configuration
object position
object mass, mass of object
manipulator object mass
material of object
object module
object surface reflection
object‐oriented robotics
parameter of object
object position
object program
object zone
extension of object zone
extension of object zone
robot object memory
temperature of object
distortion of object
material of object
optimal point control, optimal control of points, OCP, optimal s
OR‐component
OR‐element
OR‐operation
OR‐circuit
disjunction
off
out of circuit adj
open kinematic chain of gripper gear
open robot control chain
open loop
open‐loop control
open robot control chain
open‐loop control
open circuit
open cycle control
open loop
open‐loop pulse system
open‐loop sampled data system with variable parameters
open system
offline processing
offline
autonomous
offline converting system
offline mode
offline organization
offline programming
off‐line programming
offline control
stran 194 od 326
EN ‐DE: slovar avtomatizacije in robotike Öffnen des Greiforgans
Öffnen eines Greifers (Roboterbefehl)
Öffnungsimpuls
Öffnungskontakt
Öffnungskontakt
Öffnungsweg eines Greiforgans
Öffnungswinkel
Öffnungswinkel der Greiferbacken
Öffnungswinkel eines Greiforgans
Öffnungswinkel eines Zangengreifers
ohmsche Aufheizung
ohmsche Belastung
ohmsche Belastung
ohmsche Komponente
ohmsche Last
ohmsche Last
ohmscher Kontakt
ohmscher Spannungsabfall
ohmscher Spannungsabfall
ohmscher Verlust
ohne Rückkehr zu Null
Ohrroboter
Ökonomie der IR‐Technik
ökonomische Kriterien von Robotern
ökonomische Kybernetik
ökonomischer Variantenvergleich
ölhydraulischer Geschwindigkeitsregler
ölpneumatisch
Ölrückführung
Ölschalter
Ölspurenmessgerät
Online‐Datenerfassung
Online‐Datenerfassung
Online‐Datenverarbeitung
Online‐Diagnose
Onlinef
Online‐System
Online‐Testeinrichtung
Operation
Operation eines Roboterrechners
Operation zwischen scharfen Mengen
Operationsabschlusssignal
Operationsabschlusssignal
Operationsalgorithmus
Operationsanalyse
operationsanalytische Methode
Operationsausführung
Operationsbefehl
Operationsbefehl
Operationsbereich
Operationsbereich
Operationsbeschleunigung
Operationsentschlüßler
Operationsfaktor
Operationsgeschwindigkeit
Operationskode
operationsloser Zustand
Operationsmethode
Operationsmethode
Operationsprinzip
Operations‐Research‐Problem
Operationsroboter
Operationsschritt eines IR
Operationsschwelle
Operationsspeicher (einer Robotersteuerung)
Operationssteuerpult
Operationssteuerpult
Operationssteuerung
Operationssystem
Operationsverstärker
operativer Programmteil
operativer Programmteil
Operatoren folge feines Industrieroboters
Operatorgleichung
Operatormethode oproelektronisches Gerät
opening of grip organ
gripper opening (robot command)
break impulse
break contact
resting contact
opening path of grip organ
acceptance angle
groove angle of gripper jaw
groove angle of grip organ
groove angle of pincer gripper
ohmic heating
ohmic load
resistive load
resistive component
ohmic load
resistive load
ohmic contact
ohmic drop
resistance drop
ohmic loss
non‐return‐to‐zero
robot with ears, ear robot
economy of industrial robots technique
economical criteria of robots
economical cybernetics
economic comparison of variants
oil‐hydraulic speed controller
oil‐pneumatic
oil return
oil switch
oil traces measuring instrument
online data acquisition
online data collection
online data processing
online diagnostics
online
online system
online test facility
operation
operation of robot computer
binary operation
operating limiting signal
operation limiter
operation algorithm
operational analysis
method of operation analysis
operation version
operational command
operational instruction
operating range
working range
speeding‐up of operations
operation decoder
operation factor
performing operation speed
operation code
idle state
operation method
method of operation
operating principle
operations research problem
operational robot
operation step of IR
threshold of operation
operation memory (of robot control)
operation console
benchboard
control of operations
operating system
operational amplifier
operative program part
operative program section
robot operator sequence, operator sequence of industrial robo
operator equation
operational programming method
light‐wave device
stran 195 od 326
EN ‐DE: slovar avtomatizacije in robotike Optimalantwort
Optimalbedingung
optimale Adaptation
optimale Anpassung
optimale Bahnsteuerung
optimale Bewegungsstrategie
optimale Dämpfung
optimale Digitalisation
optimale Digitalisierung
optimale Einstellung
optimale Greiferanpassung
optimale Greiferauswahl
optimale Greiferbewegung
optimale Greiferkonstruktion
optimale Greifstelle
optimale Handlungsstrategie
optimale Kenngröße
optimale Kodierung
optimale Kopplung
optimale Lagerhaltung
optimale Maschinenbelegung optimale Montage[reihen]folge
optimale Montagefolge
optimale Montagereihenfolge
optimale Montagetechnologie
optimale Programmierung
optimale Prozesslösung
optimale Punktsteuerung
optimale Punktsteuerung
optimale Punktsteuerung
optimale Raumtemperatur bei Robotereinsatz
optimale Regelung
Optimale Regelung
optimale Regelung
optimale Regelung
optimale Roboterführung
optimale Robotersteuerung
optimale Robotertechnologie
optimale Schaltfunktion
optimale Schaltlinie
optimale Strategie
optimale Struktur
optimale Suchmethode
optimale Übergangscharakteristik
optimale Übertragungsfunktion
optimaler Betriebszustand
optimaler Durchsatz
optimaler Durchsatz
optimaler Extrapolator optimal
optimaler Prozess
optimaler Regler
optimaler Relaisservomechanismus
optimaler Übergangsprozess
optimaler Verlauf
optimales Datenabtastsystem
optimales Impulssystem
optimales Lagerhaltungsproblem
optimales Nichtlinearsystem
optimales Programmieren optimale
optimales Regelungs‐ und Steuerungssystem
optimales Schalten
optimales Suchfilter
Optimalfilter
Optimalitätsforderung
Optimalitätskriterium
Optimalitätsprinzip
Optimalpunkt
Optimalregelung
Optimalregelung
Optimalregelung
Optimalregelung
Optimalsystem
Optimalsystem
Optimalwert
optimieren
optimierendes System
optimum response
optimum condition
optimal adaptation
optimal adaptation
optimal path control
optimal movement strategy
optimal damping
optimal digitization
optimal digitization
optimal adjustment
optimal adaptation of gripper
optimal selection of gripper
optimal gripper movement
optimal gripper construction (design)
optimum grip place
optimal action strategy
optimal parameter
optimum coding
optimum coupling
optimal inventory
optimal machine loading
optimal assembly sequence
optimal assembly sequence
optimal assembly sequence
optimal mounting technology, optimal assembly technology
minimum access programming
optimal process solution
optimal point control, optimal control of points, OCP, optimal s
optimal point control
optimal spot control
optimum room temperature for robot application
extremum control
optimal control
peakholding control
optimum control;
optimal robot guide
optimal robot control
optimal robot technology
optimum switching function
optimum switching line
optimal strategy
optimum structure
optimum seeking method
optimum transient response
optimum transfer function
optimum behaviour
optimum throughput
optimal throughput
optimum predictor
optimum process
minimum error controller
optimum relay servomechanism
optimum transient response
optimum process
optimum sampled‐data system
optimum sampled‐data system
optimal inventory problem
non‐linear optimalizing system
optimum programming
optimal control system
optimal switching
optimum detecting filter
optimal filter
optimality demand
optimality criterion
principle of optimality
optimum point
extremum control
optimal control
peakholding control
optimum control;
optimal system
optimizing system
optimum value
optimize v
automatically taught system
stran 196 od 326
EN ‐DE: slovar avtomatizacije in robotike optimierendes System
optimierte Anordnung
optimiertes Layout
Optimierung
Optimierung adaptiver Steuerung
Optimierung dynamischer Systeme
Optimierung mittels Hybridrechner
Optimierung von selbst ablaufender Reaktion
Optimierungsmethode
Optimierungsmodul (eines Industrieroboters)
Optimierungsproblem
Optimierungsprogramm
Optimierungssystem für Auftragsabwicklung
Optimierungsvariable
Optimisator
Optimum
optisch angeregt
optisch gepumpt
optisch‐akustischer Gasanalysator
optische {optisch gesteuerte) Montage
optische Abtastung
optische Achse
optische Analogsignalübertragung
optische Analogübertragung
optische Anzeige
optische Anzeige
optische Ausrichtung
optische Datenverarbeitung
optische Detektion
optische Dichte
optische Einstellung
optische Energiedichte
optische Entzerrung
optische Faser
optische Folgeprogrammierung
optische Frequenz
optische Geradeausverstärkung
optische Impulskodemodulation
optische Kontrolle
optische Korrelation
optische Logik
optische Montage
optische Montage (durch Oberflächenreflexion des Objekts)
optische Nachbildung
optische Nachführanlage mit elektronischer Abtastung
optische Phasenabweichung phase optique
optische Polarisationsmethode
optische Resonanz
optische Rückkopplung
optische Sendeeinrichtung
optische Sensorik
optische Sensorik
optische Sensorik (Sensortechnik)
optische Sensortechnik optique
optische Sensortechnik optique
optische Signalerfassung
optische Signalverarbeitung
optische Speicherschaltung
optische Spektroskopie
optische Spitzenleistung
optische Strahlenauslenkung
optische Strahlenrichtungssteuerung
optische Übertragungsfunktion
optische Verstärkung
optische Verzögerungschaltung
optische Verzögerungsleitung
optische Zeilenabtastungseinheit
optisch‐elektronisches System
optischer Abtaser
optischer Abtaser
optischer Analogrechner
optischer Bildsensor
optischer Eingang
optischer Erfassungssensor
optischer Erfassungssensor
optischer Fühler
self‐teaching system of automatic optimization
optimized layout
optimized layout
optimization
adaptive control optimization, ACO
optimization of dynamic systems
hybrid optimization
optimization of sustained reaction
optimization method
optimization module (of industrial robot)
optimization problem
optimization program
optimization system for order processing
optimization variable
optimizer
optimum
optically excited
optically pumped
optical‐acoustic gas analyzer
optical mounting
optical scanning
optical axis
analog optical transmission
analog optical transmission
optical display system
optical projection system
optical alignment
optical data handling
optical detection
optical density
optical alignment
optical energy density
optical equalization
optical fibre
optical sequence programming
optical frequency
optical direct amplification
optical pulse code modulation
optical check[ing]
optical correlation
optical logic
optical mounting
optical assembly (by surface reflection of object)
optical simulation
electronically scanned optical tracker
optical phase deviation
polarization optical method
optical resonance
optical feedback
optical transmitting set
optical sensorics
optical sensor technique
optical sensorics, optical sensor technique
optical sensorics
optical sensor technique
optical signal acquisition
optical signal treatment
optical storage line
optical spectroscopy
peak optical power
optical beam deflection
optical beam‐direction control
optical transfer function
optical amplification
optical delay circuit
optical delay line
optical line scan equipment
optoelectronic system
photoelectric reader
optical scanner
optical analog computer
optical image sensor
optical input
optical acquisition sensor
optical pick‐off
optical pick‐off
stran 197 od 326
EN ‐DE: slovar avtomatizacije in robotike optischer Fühler
optischer Geber
optischer Geber
optischer Geber (Sensor)
optischer Gleichheitsprüfer
optischer Höhenmesser
optischer Kanal
optischer Kodierer
optischer Kontakt
optischer Kopf
optischer Koppler
optischer Leistungsmesser
optischer Leistungsteiler
optischer Leser
optischer Radarsender
optischer Richtkoppler
optischer Schalter
optischer Schaltkreis
optischer Schaltkreis
optischer Schaltkreis (eines Sensors)
optischer Sender
optischer Signalträger
optischer Spannungskoeffizient
optischer Speicher
optischer Verarbeitungskreis
optischer Vergleicher
optischer Verschlüßler
optischer Verstärker
optischer Wegmesswandler
optischer Wirkungsgrad
optischer Zeichenleser
optischer Zugriff
optisches Abbildungssystem
optisches Abtastsystem optique d'exploration
optisches Anzeigesystem
optisches Anzeigesystem
optisches Ausgangssignal
optisches Ausgleichselement
optisches Bildverarbeitungsgerät
optisches Breitband‐Übertragungssystem
optisches Dämpfungsglied
optisches Datenübertragungssystem fibres optiques
optisches Datenverarbeitungssystem
optisches Empfangsbauelement
optisches Erkennungssystem
optisches Erkennungssystem
optisches Erkennungssystem
optisches Erkennungssystem für Industrieroboter
optisches Erkennungssystem für visuelle informationen
optisches Faserbündel
optisches Fernmeldesystem
optisches Filter
optisches Informationsverarbeitungssystem
optisches Informationsverarbeitungssystem optique
optisches Interferenzfilter
optisches kohärentes Radar
optisches Kohärentstrahlenradar
optisches Kommunikationssystem
optisches Kompensationsfilter
optisches Laserradar
optisches Laufzeitglied
optisches Lesen
optisches Messverfahren
optisches Phasendifferenzradar
optisches Signal
optisches Signal
optisches Signal
optisches Überlagerungsgerät
optisches Überlastsignal
optisches Verbindungsgerät
optisches Wahrnehmungssystem
optisch‐sensorisierter Greifer
optoelektronische Datenspeicherung
optoelektronische Digitallogik
optoelektronische Schaltung
optoelektronischer Sensor
optical acquisition sensor
optical pick‐off
optical acquisition sensor
optical sensor
optical comparator
optical altimeter
optical channel
optical encoder
optical contact
opto‐head
optical coupler
optical power meter
optical fiber power splitter
optical reader
optical radar transmitter
optical directional coupler
optical interrupter
optical circuit (of sensor)
optical switching circuit
optical circuit (of sensor)
optical transmitting set
optical signal carrier
stress optical coefficient
optical memory
optical processing circuit
optical comparator
optical encoder
optical amplifier
optical sensor for displacement measurement
optical efficiency
optical character reader
optical access
optical imaging system
optical scanning system
optical display system
optical projection system
optical output signal
optical balancing element
visual image processor
broadband optical transmission system
optical attenuator
fiber optic data transmission system
optical data processing system
light detecting component
optical identification system, optical perception system
optical identification system
optical perception system
optical identification system for industrial robots, optical perc
optical perception system for visual information
optical fibre bundle
optical communication system
optical filter
optical information processing system
optical information processing system
optical interference filter
optical coherent radar
coherent optical radar
optical communication system
optical compensating filter
optical laser radar
optical delay line
optical reading
optical measuring method
optical phase‐difference radar
optical signal
visual signal
visible signal
optical superposition device
optical overload signal
optical communication device
visual perception system
optical‐sensorized gripper
optoelectronic data storage
optoelectronic digital logic
optoelectronic circuit
opto‐electronic sensor
stran 198 od 326
EN ‐DE: slovar avtomatizacije in robotike optoelektronischer Sensor optoelectronic sensor system 458
optoelektronischer Signalempfänger
optoelektronischer Signalgeber
optoelektronischer Signalgeber
optoelektronisches Bauelement
optoelektronisches Kopplungselement
optoelektronisches Sensorsystem
optoelektronisches Sensorsystem
optoelektronisches System
Optokopf
oraler Dialogprozessor
orales Signal
Ordinatenachse
Ordinatenachse
ordnen
Ordnung
Ordnung der logischen Funktion
Ordnung der Regelstrecke
Ordnung der Ziffer
Ordnungseinrichtung
Ordnungsparameter
Ordnungsprinzip
Organisation der Betriebsführung und Betriebswirtschaft
Organisation der Wiederherstellung
organisatorische Operationen
organisatorisches Programm
organisatorisches Programm
organische Busstruktur
orientiert
orientierter Automat
orientierter Graph
Orientierung eines Robotereffektors
Orientierung eines Greifers am Roboter
Orientierung von Handhabungsobjekten
Orientierungsangabe
Orientierungsangabe des Greifers
Orientierungsbewegung
Orientierungsdaten pl
Orientierungshilfe für Robotereinsatz
Orientierungskode für Robotermontage
Orientierungssystem
Orientierungsvektor
Originaldaten pl
Originalfunktion
orthogonale Darstellung
orthogonale Datenfolge
orthogonale Transformation
orthogonaler Einheitsvektor
orthogonales Filter
orthogonales Filter
orthogonales Rechtssystem (für IR‐Bezeichnung)
Orthogonalitätsfehler
Orthogonalitätsfehler
örtliche Rückkopplung
ortsbewegliche Maschine
ortsbeweglicher Roboter
ortsfeste Montageeinheit
ortsfester Industrieroboter
ortsfester Robotereinsatz
Ortsfunktion
Ortskurve der Frequenzgangfunktion
Ortskurve der Frequenzgangfunktion
Ortskurve der Frequenzgangfunktion
Ortsvektor
Ortsvektor eines Effektors
Ortsvektor eines Handhabungsobjekts
ortsveränderliches Gerät
Ortsvermittlungsstelle
Ortung
Oszillation
Oszillatorinduktionsgeber
oszillatorische Bewegung
Oszillatorschaltung
oszillierende Eigenbewegung
oszillierende Eigenbewegung
oszillierende Eigenbewegung
optoelectronic sensor
opto‐electronic signal receiver
optoelectronic signal generator
opto‐electronic signal generator
optoelectronic component
optical‐electronic coupling element
optoelectronic sensor system
opto‐electronic sensor system
optoelectronic system
opto‐head
oral dialogue processor
oral signal
axis of the ordinates
Y‐axis
order v
order
order of logic function
order of controlled system
number order
order device
order parameter
order principle
organization of industrial management
recovery management
non‐productive operations
master program
steering program organic structure of bus
oriented
oriented automaton
oriented graph
effector orientation of robot
gripper orientation of robot
orientation of handling objects
specification of orientation
orientation specification of gripper
orientation movement
orientation data
aid of orientation for robot use
robot orientation code
orientation system
orientation vector
original data
original function
orthogonal representation
orthogonal data sequence
orthogonal transformation
orthogonal unit vector
orthogonal filter
rectangular filter
orthogonal right system
orthogonality error
non‐orthogonality (of an oscilloscope)
local feedback
stationary mobile machine
stationary mobile robot
stationary assembly unit
stationary industrial robot
stationary application of robots
position function
Nyquist diagram
Nyquist plot
polar plot
local vector
local vector of effector
local vector of handling object
mobile device
local exchange
localization
oscillation
oscillatory induction transmitter
oscillatory motion
oscillator circuit
autooscillation
self‐oscillation
selfvibration
stran 199 od 326
EN ‐DE: slovar avtomatizacije in robotike oszillierende Eigenbewegung
oszillierende Eigenbewegung
oszillierender Regelkreis
oszillografische Darstellung von Vorgängen
Oszillogrammzeitmarken
Oszilloskop
Oszillotitrator
OUTPUT‐ERROR‐Modell
OUTPUT‐ERROR‐Modell
OUTPUT‐ERROR‐Modell
Oval‐Speicher (IR‐Werkstückspeicher)
Override‐Schalter (einer IR‐Steuerung)
P
Paarungsmesseinrichtung
Packungsdichte
Packungsschema
Pade‐Approximation
Palettenbeladungsplan
Palettenladeeinrichtung
Palettieren von Werkstücken
Palettierungsproblem (eines Industrieroboters)
Paley‐Wiener‐Kriterium
Pantografenarm
Pantografen‐Roboterarm
Parabel
Parabelfunktion
Parabelinterpolation
parabolförmige Charakteristik
parabolische Belastung
parabolische Charakteristik
parabolische Geschwindigkeit
parabolische partielle Differentialgleichung
Parabolreflektor
Parallaxefehler
Parallaxeneinstellung
parallaxfreies Ablesen
parallel bewegbare Greiferbacken
parallel geschaltetes Korrekturglied
Parallel Struktur
Parallelabfrage
Parallelaufauswahl
Parallelbetrieb
Parallelbewegung eines Greiforgans
Paralleldarstellung
Paralleldatenkanal
Paralleldatensteuergerät
Paralleldatenumwandler
Paralleldigitalrechner
parallele Ausführung f(von Programmabschnitten)
parallele Backenbewegung (eines Greifers)
parallele Klauenbewegung
parallele Organisation
parallele Programmausführung
parallele Robotermontage
parallele Sensoren
parallele Stabilisation
parallele Stabilisierung
parallele Verbindung
parallele Verbindung
Paralleleingabe
Paralleleingang
paralleler Zugriff
parallelgeschaltet
Parallelinterface
Parallelkaskadenverhalten
Parallelkurven
Parallelmanipulator
Paralleloperation
Parallelrechenwerk
Parallelregler
Parallelresonanz
Parallelresonanz
parallelrückgekoppelter Funktionsverstärker
Parallelschaltkreis
Parallelschaltung
Parallelschaltung
free oscillation
natural oscillation
oscillating control servomechanism
oscillographic presentation of processes
oscillogram time‐marks
oscilloscope
oscillotitrator
OE model
OE model (OE = OUTPUT‐ERROR)
OUTPUT‐ERROR model
oval memory
override switch (of IR‐control)
P (proportional)
pairing measuring device
packing density
packing scheme
Pade approximation
pallet loading plan
pallet loading device
palletizing of work pieces
palletization problem (industrial robot)
Paley‐Wiener criterion
pantograph robot arm
pantograph robot arm
parabola
parabolic function
parabolic interpolation
parabolic characteristic
parabolic charge
parabolic characteristic
parabolic velocity
parabolic partial differential equation
parabolic reflector
parallax error
parallax adjusting
parallax‐free reading
parallel movable gripper jaws
parallel correcting element
parallel structure
parallel search
parallel‐operation recognition
parallel operation
parallel motion of grip organ
parallel representation
parallel data channel
parallel data controller
parallel data converter
parallel digital computer
parallel execution (of program sections)
parallel movement of jaws (of gripper)
parallel movement of claws
parallel organization (of computers)
parallel program execution
parallel robot mounting, parallel robot assembly
parallel sensors
parallel stabilization
parallel stabilization
parallel connection
parallel circuit
parallel input
parallel input
parallel access
parallel‐connected
parallel interface
parallel cascade action
parallel curves
parallel manipulator
time‐shared operation
parallel arithmetic unit
parallel run controller
antiresonance
parallel phase resonance
parallel feedback operational amplifier
parallel switching circuit
parallel combination
parallel connection
stran 200 od 326
EN ‐DE: slovar avtomatizacije in robotike Parallelschaltung
Parallelschaltung des Gleichrichters
Parallelschaltung von Regelkreisgliedern
Parallelschnittstelle
Parallelschwingkreis
Parallel‐Seriell‐Umsetzung
Parallel‐Serien‐Struktur
Parallelsteuerung
Parallelstruktur
Parallelsuche
Parallelsystem
Parallelübertragung
Parallelübertragung der Information
parallelwirkendes Register
paramagnetisches System
Parameter
Parameter
Parameter der Handoperation
Parameter eines Anwenderprogramms
Parameter eines Industrieroboters
Parameter eines Montagesystems
Parameterabbildung
parameterabhängiger Befehl
parameterabhängiger Roboterbefehl
Parameteränderung
Parameterannahme
Parameterbegrenzer
Parameterbereich
Parameterbereich
Parameterbestimmung
Parameterempfindlichkeit
Parametererkennung
Parametergebiet
Parametergebiet
Parametergleichung
Parametergrenze
Parameteridentifikation
Parameteridentifikation
Parameteroptimierung
Parameteroptimierung einer IR‐Steuerung
Parameterrandwert
Parameterrangfolge
Parameterraum
Parameterschätzung
Parameterschätzung
Parameterschätzverfahren
Parametervariation
Parameterwert
parametrische Dämpfung
parametrische Erregung
parametrische Frequenzkonversion
parametrische Frequenzumsetzung
parametrische Optimierung
parametrische Programmierung
parametrische Pumpenenergie
parametrische Resonanz
parametrische Universalität
parametrische Wechselwirkung
parametrischer Elektronenstrahlverstärker
parametrischer Gewinn
parametrischer Rückwärtswellenverstärker
parametrischer Vervielfacher
parametrisches elektronisches Bauelement
parametrisches Modell
parametrisierte Operation
parametrisierter Operator
parasitäre
parasitäre
parasitäre Kapazität
parasitische Modulation
parasitische Selbstschwingungen
Paritätsbit
Paritätsfunktion
Paritätsfunktion
Paritätskontrolle
Paritätskontrolle
parallel circuit
parallel rectifier circuit
parallel combination of control loop elements
parallel interface
oscillating parallel circuit
parallel‐to‐serial conversion
parallel‐serial structure
parallel control
parallel structure
parallel search
parallel system
parallel transfer
parallel transmission of information
parallel register
paramagnetic system
parameter
parametric
parameter of hand operation
user program parameter
parameters of industrial robot
assembly system parameter
parameter image
parameter‐dependent instruction
parameter‐dependent robot instruction
parametric variation
parameter acceptance
parameter delimiter
parameter region
parametric domain
parameter determination
parameter sensitivity
parameter identification
parameter region
parametric domain
parametric equation
parameter limit
parametric estimation
parametric identification
parameter optimization
parameter optimization of IR control
boundary parameter value
parameter hierarchy
parametric space
parametric estimation
parametric identification
parametric estimation method
variation of parameters
parameter value
parametric damping
parametric excitation
parametric frequency conversion
parametric frequency conversion
parametric optimization
parametric programming
parametric pumping energy
parametric resonance
parametric generality
parametric interaction
electron‐beam parametric amplifier
parametric gain
backward‐wave parametric amplifier
parametric multiplier
parametric electronic component
parametric model
parametrized operation
parametrized operator
hunting
parasitic oscillations
parasitic capacitance
spurious modulation
parasitic autooscillations
parity bit
even function
parity function
odd‐even check
parity check
stran 201 od 326
EN ‐DE: slovar avtomatizacije in robotike Parolenverarbeitung
Parsevalsches Theorem
Partialbruchzerlegung
Partialdruck partial‐read pulse 470
Partialsystemmodell
Partialvolumen
partiell
partiell symmetrische Funktion
partielle (teilweise) Robotisierung
partielle Differentialgleichung
partikuläre Leitfähigkeit
partikuläre Lösung
partikuläres Integral
Partition
PASCAL‐Compiler
PASCAL‐Programm
passive Ausgleichseinrichtung
passive Ausgleichseinrichtung
passive optische Komponente
passive Schaltung
passiver Fügemechanismus
passiver Kreis
passiver Ultrarotentfernungsmesser
passives Bauelement
passives Bauelement
passives Glied
passives Glied
passives Infrarotsystem
passives optisches Element
Pausenzeichen‐Steuerung
P‐Bereich
P‐Bereich
PCM‐Übertragungssystem
PD‐Regler
PD‐Regler
PDT1 (Lead)‐Element (‐Regler)
Pedipulator
Pedipulatorsystem
Pegeleinstellung
Pegelfernanzeiger
Pegelfernanzeiger
pegelgeschalter
pegelgettriggert
Pegelmesser
Pegelmessung
Pegelprüfer
Pegelregelung
Pegelzeiger mit unmittelbarer Ablesung
Peirce‐Funktion
P‐Element
P‐Element
Pendeleinrichtung
Pendeleinrichtung (eines Schweißroboters)
pendelfreie Regelung
Pendelmanipulator
Pendelung
Pendelung
perfekt
Periode
Periode des Sinuskurvenabklingens
Periodendauermessung
periodisch
periodisch gedämpftes Element
periodische Dämpfung periodische Frequenzmodulation
periodische Funktion
periodische Geschwindigkeitsschwankung
periodische Große
periodische Intensitätsverteilung
periodische Lösung
periodischer Koeffizient
periodischer Taster
periodisches Element
periodisches Testsignal
peripher
periphere Einrichtungen für den Industrierobotereinsatz
parole processing
Parseval theorem
partial‐fraction expansion
partial pressure
partial system model
partial volume
part[ial]
partially symmetrical function
partial robotization
partial differential equation
particular conductivity
particular solution
particular integral
partition[ing]
PASCAL compiler
PASCAL program
passive compliance device
passive compliance device, PCD
passive optical component
passive circuit
passive joint mechanism
passive circuit
passive infrared rangefinder
passive element
passive component
passive element
passive component
passive infrared system
passive optical component
pause signal control
proportional band
proportional control zone
pulse‐code‐modulation transmission system
PD (proportional‐plus‐derivative)‐controller
proportional‐plus‐derivative controller
phase‐lead compensator
pedipulator, walking robot
pedipulator system
level setting
level teleindicator
remote level indicator
level‐triggered
level‐triggered
tank gauge
level measurement
level detector
level regulation
direct reading transmission measuring set
Peirce function
P (proportional)‐element
P element
oscillation installation (unit)
pendulum device
antihunting control
pendulum manipulator
hunting
parasitic oscillations
perfect
period
decay time of sinusoidal oscillation
cycle duration measurement
periodic, underdamped, 0 < D < 1
damped periodic element
underdamping periodic frequency modulation
periodic function
periodic velocity fluctuation
periodic quantity
periodic intensity distribution
periodic solution
periodic coefficient
impulse element
periodic element
periodic test signal
peripheral
peripheral equipment for application of industrial robots
stran 202 od 326
EN ‐DE: slovar avtomatizacije in robotike periphere Robotereinrichtung
periphere Steuerung
peripherer Prozessor
peripherer Werkstückspeicher
peripheres Verwaltungsprogramm
Peripherie
Peripherie eines Hybridrechners
Peripherie eines Roboterrechners
Peripherie für den Montageprozess
Peripheriegerätezuordnung
Peripherieprozessor
Peripherieschnittstellen‐ Anpassungsbaustein
Peripheriesteuerung
Peripheriesteuerungsbaustein
Peripherie‐Untersystem
permanente Daten
permanente Schaltung
permanenterregter Gleichstrommotor
Permanentspeicher
Permanentspeicher
Permeabilität
Personalminimum
Phantomschaltkreis
Phase
Phase periodischer Große
Phasen
Phasenabgleich
Phasenabgleichfehler
Phasenabgleichfehler
Phasenabgleichkondensator
Phasenanpassung
Phasenanpassungsbeziehung
phasenasynchrone Schnittstelle
Phasenbahn
Phasenbedingung
Phasenbrechzahl
Phasendetektor
Phasendetektor
Phasendiagramm
Phasendiskriminator
Phasendiskriminator
Phasendiskriminator
Phasenebene
Phaseneinstellung
Phaseneinstellungsregulierung
phasenempfindlicher Detektor
phasenempfindlicher Gleichrichter
phasenempfindlicher Nullanzeiger
phasenempfindliches Nachweisgerät
Phasenentzerrer phase
Phasenentzerrer phase
Phasenfehler
Phasenfolgeanzeiger
Phasengang
Phasengang
Phasengang
Phasengeschwindigkeit
Phasengleichheitsdetektion
Phasenimpulsmodulation
Phasenimpulsmodulation
Phasenkennlinie
Phasenkennlinie
Phasenkennlinie
Phasenkonstante
Phasenkopplung
Phasenkurve
Phasenlaufzeit
Phasen‐Minimum‐System
Phasenmitteilung
Phasenmodulation
Phasenmodulator
phasenmodulierte Trägerwelle f
phasenmodulierter Träger
phasenmoduliertes optisches Signal
Phasennacheilung
Phasennacheilung
peripheral robot equipment
peripheral control
peripheral processor
peripheral store, peripheral store of s
peripheral administrative program
periphery
periphery of hybrid computer
periphery of robot computer
assembly process periphery
peripheral device allocation
peripheral processor
peripheral interface adapter
peripheral control
peripheral controller
peripheral subsystem
permanent data
full‐time circuit
permanently excited d. c. motor, permanent excited direct cur
fixed memory
permanent memory
permeability
minimum of staff
phantom circuit
phase
periodic quantity phase
phase
phasing
misphasing
skew
phasing capacitor
phase matching
phase‐matching relation
phase‐asynchronous interface
phase path
root‐locus, phase condition
phase index
phase detector
phase discriminator
phase diagram
phase‐sensitive amplifier
phase detector
phase discriminator
phase plane
phasing
phasing adjustment
phase‐sensitive detector
phase‐sensitive rectifier
phase‐sensitive null indicator
phase‐sensitive detector
phase compensator
phase equalizer
phase[ing] error
phase‐sequence indicator
phase plot
phase characteristic
phase response
phase velocity
inphase amplitude detection
displacement modulation
phase‐pulse modulation
phase characteristic
phase locus
phase response
phase constant
phase lock
phase curve
phase delay
minimum phase‐shift system
phase averaging
phase modulation
phase modulator
phase‐modulated carrier
phase‐modulated carrier
phase‐modulated optical signal
phase lag
phaselag
stran 203 od 326
EN ‐DE: slovar avtomatizacije in robotike Phasennachlauf
Phasenportrait
Phasenrand
Phasenraum
Phasenrauschen
Phasenregelung
Phasenregelungsschema
Phasenreserve
Phasenschieber
Phasenschiebung
Phasenschiebung
Phasenschnittfrequenz
Phasenschnittkreisfrequenz
Phasenspektrum
Phasenstabilität
phasenstarr [synchronisiert]
Phasensynchronisierung
Phasensynchronisierung
Phasensynchronisierungsschleife
Phasentaktsignal
Phasenteiler
Phasentrajektorie
Phasentrennung
Phasenübereinstimmung
Phasenumkehrer
Phasenumkehrrelais
Phasenumkehrschaltung
Phasenumkehrung
Phasenumkehrung
Phasenumkehrverstärker
Phasenumtastung
Phasenunterspannungsrelais
Phasenverhältnis
Phasenverschiebung
Phasenverschiebungskette
Phasenverschiebungskreis
Phasenverzerrung
Phasenverzerrung
Phasenverzögerung
Phasenvoreilung
Phasenvoreilung
Phasenvoreilung
Phasenvoreilungsschaltung
Phasenvoreilungsstromkreis
Phasenvorhaltglied
Phasenwender
Phasenwinkel
Phasenwinkel in geschlossenem Kreis
Phasenwinkelanzeiger
Phasenwinkelort
Phasenzähler
phonemische Analyse
Phonmesser
Phonmesser
physikalische Adresse
physikalische Eigenheiten
physikalische Größe picoprocessor 482
physikalische Manipulatorgröße
physikalische Montageobjektdaten pl
physikalische Simulation
physikalisches Fotometer
physikalisches Modell
physikalisches Modell
physische Verbindung
physischer Einheitsblock
physischer Kanal
physisches Eingabe‐Ausgabe‐Steuersystem physique
Picoprogrammierung
Picoprozessor
Picosekunde
PID‐Regelung
PID‐Regelung
PID‐Regelung
PID‐Regler
PID‐Regler
phase lag
phase portrait
phase margin
phase space
phase noise
phase control
phase control circuit
phase margin
phase advancer
phase advancing
phase shift
phase cross‐over frequency
phase crossover angular frequency
phase spectrum
phase stability
phase‐locked
phase synchronization
phase lock
phase lock loop
phase timing signal
phase splitter
phase path
phase separation
phase coincidence
phase inverter
phase reversal relay
phase inverter circuit
reversal of phase
phase reversal
paraphase amplifier
phase manipulation
phase undervoltage relay
phase relationship
phase shift
phase‐shift circuit
phase‐shift circuit
phase distortion
delay distortion
phase delay
phase advance
phase lead
phaselead
phase‐lead circuit
phase‐lead circuit
phase‐lead network
phase inverter
phase angle
closed‐loop phase angle
phase indicator
phase angle locus
phase counter
phonemic analysis
decibelmeter
noise test set
physical address
physical properties
physical value
physical manipulator size
physical assembly object data
physical simulation
physical photometer
physical analog
physical model
physical connection
physical unit block
physical channel
physical input‐output control system
picoprogramming
picoprocessor
picosecond
derivative‐proportional‐integral control
proportional‐integral‐derivative control
proportional‐floating‐derivative control;
PID (proportional‐plus‐integral‐plus‐derivative)‐controller, three‐term controller
three‐term controller
stran 204 od 326
EN ‐DE: slovar avtomatizacije in robotike PID‐Regler
PID‐Regler
piezoelektrische Schwingung
piezoelektrischer Dehnungsmessstreifen
piezoelektrischer Druckmesser
piezoelektrischer Effekt
piezoelektrischer Lasermodulator
piezoelektrischer Sensor
piezoelektrischer Wandler
piezoelektrisches Bauteil
piezoelektrisches Manometer
piezoelektrisches Messgerät
piezooptisch
Piezowiderstandseffekt‐Messmethode
PI‐Glied
Pilotanlage
Pilotanlage
Piloteinsatz
Pilotfrequenzgenerator
Pilotstromkreis
Pilotsystem
Pipeline‐Arbeitsweise
Pipeline‐Architektur
Pirani‐Messgerät
PI‐Regelung
PI‐Regelung
PI‐Regelung
PI‐Regler
PI‐Regler
PI‐Regler
PI‐Regler
PI‐Regler
PI‐Regler
PI‐Zustandsregelung
Plan eines Aufgabenziels
Planungsgrundlage
Planungsmethode
Planungsmodelle
Planungsrechner
Planungsunterlagen
Plasma
Plasmadynamik
Plasmagenerator
Plasmaphasenschieber
plastisches Potentiometer
Plastizitätsmesser
Platinotron
Platinotron
Plattenbetriebssystem
Plattenbetriebssystem
Plattenkodierer
Plattenspeicher‐Steuergerät
Plattensystemsoftware
Platzbedarf eines Industrieroboters
Plotter
Plotter
Plotter
Plotterkonfiguration
plötzliche Änderung
Plussechskode
pneumatisch
pneumatisch betätigter Greifer
pneumatisch impulsgesteuerte Programmsteuerung
pneumatisch verzögerte Steuerung
pneumatische
pneumatische Analogie
pneumatische Brückenschaltung
pneumatische Dämpfung pneumatische Drossel
pneumatische Fernmesstechnik distance
pneumatische Fernsteuerung
pneumatische Fernübertragung
pneumatische Fernübertragung pneumatische Förderung pneumatische Hochdruckregelung
proportional‐integral‐derivative controller
PID‐controller;
piezoelectric vibration
piezoelectric strain gauge
piezoelectric pressure gauge
piezoelectric effect
piezoelectric laser modulator
piezoelectric sensor
piezoelectric transducer
piezoelectric device
piezoelectric pressure gauge
piezoelectric measuring instrument
piezo‐optic
piezoresistance effect measuring method
PI‐element
pilot plant
experimental unit
pilot run
pilot frequency generator
pilot circuit
pilot system
pipelining
pipelined architecture
Pirani gauge
proportional‐plus‐integral control
proportional‐plus‐reset control
PI‐control
PI (proportional‐plus‐integral)‐controller
PI (proportional‐plus‐integral)‐controller, two‐term controller
two‐term controller
proportional‐integral controller
PI‐controller
proportional‐floating
PI (proportional‐plus‐integral) control with state feedback
task target plan
planning documents
planning method
planning models
planning computer
planning documents
plasma
magneto‐fluid dynamics
plasma generator
plasma phase shifter
plastic potentiometer
plastometer
amplitron
platinotron
disk operating system
DOS
disk coder
disk controller
disk system software
robot floor space required, IR floor space required
plotter
graph plotter
curve plotter
plotter configuration
abrupt change
excess‐six‐code
air‐operated pneumatic‐operated gripper
pneumatic pulse‐controlled program control
pneumatically delayed control
pneumatic level control
pneumatic analogy
pneumatic bridge circuit
air damping pneumatic throttle
pneumatic remote measuring technique
pneumatic remote control
pneumatic remote transmission
air‐operated remote transmission air lift pneumatic high‐pressure control
stran 205 od 326
EN ‐DE: slovar avtomatizacije in robotike pneumatische Logikanlagen
pneumatische Logikelemente
pneumatische Niederdruckregelung
pneumatische Pegelregelung
pneumatische Regelung pneumatische Regelung pneumatische Robotersteuerung (IR‐Steuerung)
pneumatische Roboterversion (Roboterausführung)
pneumatische Schaltung
pneumatische Stelleinrichtung
pneumatische Steuerungstechnik
pneumatische Übertragungsleitung
pneumatische Wheatstonesche Brücke
pneumatische Zeitkonstante
pneumatischer Annäherungssensor
pneumatischer Antrieb
pneumatischer Antrieb
pneumatischer Beschickungsroboter
pneumatischer Digitalrechner pneumatischer Drehwinkelantrieb
pneumatischer Drehwinkelantrieb rotation
pneumatischer Drehwinkelmotor
pneumatischer Druckwächter pression
pneumatischer Effektor
pneumatischer Effektor
pneumatischer Einzweckregler spéciale
pneumatischer Förderer pneumatischer Geber
pneumatischer Geber (Sensor)
pneumatischer Greiferantrieb
pneumatischer Greiffinger
pneumatischer Handhabebaukasten
pneumatischer Handhabebaukasten pneumatique
pneumatischer Industrieroboterantrieb
pneumatischer Integrator
pneumatischer Kanal
pneumatischer Kreis
pneumatischer Manipulatorantrieb
pneumatischer Manipulatorantrieb pneumatique
pneumatischer Maßwandler
pneumatischer Mehrfunktionsgreifer
pneumatischer Membranservomechanismus
pneumatischer Messumformer
pneumatischer Mikroschalter
pneumatischer Miniroboter
pneumatischer Programmgeber
pneumatischer Rechenverstärker
pneumatischer Regler
pneumatischer Regler pneumatischer Regler pneumatischer Regler pneumatischer Roboter
pneumatischer Roboterantrieb
pneumatischer Roboterfinger
pneumatischer Robotersensor
pneumatischer Rotationsdruckluftmotor
pneumatischer Schalttisch
pneumatischer Schreiber
pneumatischer Signalumformer
pneumatischer Simulator
pneumatischer Stellantrieb
pneumatischer Steuerzylinder pneumatischer Teiler pneumatique
pneumatischer Temperaturregler
pneumatischer Verstärker pneumatischer Verstärker pneumatischer Vibrationsantrieb
pneumatischer Widerstand
pneumatisches Analogierechensystem
pneumatisches Analogmodell
pneumatisches Antriebssystem
pneumatisches Anzeigegerät
pneumatisches Element
pneumatisches Fernmesssystem pneumatisches Gerät
pneumatisches Glied
pneumatic logical installations
pneumatic logical elements
pneumatic low‐pressure control
pneumatic level control
air‐operated control
pneumatic control pneumatic robot control, pneumatic IR control
pneumatic robot version
pneumatic circuit
air actuator pneumatic control technique
pneumatic transmission line
pneumatic Wheatstone bridge
pneumatic time constant
pneumatic approximation sensor
air‐operated drive
pneumatic actuator pneumatic feeding robot
air‐operated digital computer pneumatic drive of rotation angle
pneumatic drive of rotation angle
pneumatic rotation angle motor
pneumatic pressure guard
air‐operated drive
pneumatic actuator pneumatic single‐purpose controller
air conveyor pneumatic sensor
pneumatic sensor
pneumatic gripper drive
pneumatic grip finger
pneumatic manipulation assembly unit
pneumatic manipulation assembly unit
pneumatic industrial robot drive
pneumatic integrator
pneumatic channel
pneumatic circuit
pneumatic manipulator drive
pneumatic manipulator drive
pneumatic dimensions tranducer
pneumatic multifunction gripper
pneumatic diaphragm servomotor
pneumatic measuring transducer
pneumatic microswitch
pneumatic minirobot
pneumatic program timer
pneumatic operational amplifier
pneumatic controller
air‐operated controller
pneumatically operated regulator
pneumatic controller
pneumatic robot
pneumatic robot drive
pneumatic robot finger
pneumatic robot sensor
pneumatic rotation air [pneumatic] motor
pneumatic switchboard
pneumatic recorder
pneumatic signal converter
pneumatic simulator
pneumatic setting drive
air‐operated power cylinder pneumatic divider
pneumatic temperature controller
air‐operated amplifier
pneumatic pneumatic vibrating drive
pneumatic resistance
pneumatic analog computing system
pneumatic analog model
pneumatic drive system
pneumatic indicator
pneumatic element
air‐operated telemetering system pneumatic equipment
air actuator stran 206 od 326
EN ‐DE: slovar avtomatizacije in robotike pneumatisches logisches Glied
air‐operated logical element pneumatisches Modell
pneumatic model
pneumatisches Regelsystem air‐operated control system
pneumatisches Regelsystem pneumatic control system
pneumatisches Signal
pneumatic signal
pneumatisches Stellglied
pneumatic setting vane
pneumatisches Steuerventil air pilot valve air‐operated logical element pneumatisches Verknüpfungselement
pneumatic‐hydraulic control system
pneumatisch‐hydraulische Steuerung
pneumatisch‐hydraulischer Antrieb
pneumatic‐hydraulic drive
pneumatisch‐hydraulischer Regler
pneumatic‐hydraulic controller
pneumoelektrisch
pneumoelectric
pneumohydraulisch
pneumohydraulic
pneumohydraulischer Roboterantrieb
hydro‐pneumatic robot drive
Pneumonik
pneumonics
Pneumoniksystem
pneumonic system
pneumonische Bauteile
pneumonic building block elements
Poissonsche Verteilung
Poisson's distribution
Polardiagramm
polar diagram
Polarisation
polarization
Polarisationsanalysator
polarization analyzer
Polarisationsdispersion
polarization dispersion
Polarisationseffekte
polarization effects
Polarisationsfilter
polarizing filter
polarisationsoptisches Verfahren
optical polarization method
Polarisationsschwund
fading by polarization
Polarisationsstabilität
polarization stability
polarisationsunabhängig
polarization‐independent
Polarisationsverhalten
polarization behaviour
Polarisationszustand
polarization state
Polarisator
polarizer
Polarisierbarkeit
polarizability
polarisieren
polarize v
polarisierendes Bauelement
polarizing component
polarisierte Strahlung
polarized radiation
polarisiertes Relais mit Neutralstellung
centre stable relay
Polaritätsdetektor
polarity detector
Polarkoordinaten
polar coordinates
Polarroboterarm
polar robot arm
Polarwinkel
polar angle
Polieren (durch Roboter)
polishing (by robot)
pole‐zero plot, pole‐zero diagram
Pol‐Nullstellenplan
Polrisationsrichtung
direction of polarization
pole
Polstelle
Polungsweiser
polarity detector
pole placement
Polvorgabe
Polynom
multinomial
Polynom
polynomial
Polynom‐Approximation
polynomial approximation
Polyoptimierung
polyoptimization
Popov line
Popow‐Gerade
Portalindustrieroboter
portal industrial robot
Portalmanipulator
portal manipulator
Portalmanipulatorprinzip
portal manipulator principle
portal process unit
Portalverfahrenseinheit
Portalwagen eines Manipulators
manipulator portal car
Position einer Greifeinheit
position of grip unit
Positioner
valve positioner
Positionierabweichungsausgleich
positioning deviation compensation
Positionierantrieb
positioning drive
positionierbar
positionable
positionierbare Achse
positionable shaft
positionierbarer Sollwert
positionable nominal value
Positionierfehler
positioning error
Positioniergenauigkeit
positioning exactitude
Positioniergenauigkeit
positioning accuracy
Positioniergenauigkeit
positioning exactitude, positioning accuracy
Positioniergenauigkeit feines Industrieroboters
robot positioning accuracy, industrial robot positioning accura
Positionierhilfen
aids of positioning
Positionierhilfen aids of positioning Positionierpunkte
points of positioning
Positionierregelungsgenauigkeit
positioning control accuracy
Positionierregelungsgenauigkeit t Regelungsgenauigkeit der Ppositioning control accuracy
Positioniersystem
positioning system
Positioniertoleranz eines Roboters
positioning tolerance of robot
Positionierung durch Hilfsroboter
positioning by auxiliary robot
stran 207 od 326
EN ‐DE: slovar avtomatizacije in robotike Positionierung eines Handhabungsobjekts
Positionierungenauigkeit
Positionierungssensor
Positionierungsservomechanismus
Positionierungssystem
Positionierungstechnik
Positionierungsungenauigkeit
Positionsabfragefrequenz (Abfragefrequenz) eines IR
positionsabhängiger Kode
Positionsabweichung feines Greifers
Positionsanzeige eines IR
Positionsdaten pl
Positionsdaten pl eines Manipulators
Positionsdaten pl eines Roboters
Positionserkennung
Positionsermittlung durch Potentiometer
Positionsermittlung durch Winkelkodierer
Positionsfehler
Positionsfehler
Positionsfolgessystem
Positionsfolgessystem
Positionskode
Positionskoordinaten
Positionsmechanismus
Positionsmechanismus
Positionsmesssystem
Positionsmessung
Positionsregelungsgenauigkeit
Positionssensor
Positionssicherung
Positionssteuerung
Positionssteuerung
Positionssteuerungssystem
positionsunabhängiger Kode
Positionsunsicherheit eines IR
Positionszeitpunkt
positiv (PO)
positiv definit
positive Bahnabweichung
positive Differenz
positive Kopplung
positive Logik
positive quadratische Form
positive Rückkopplung
positive Schaltungslogik
positiver Impuls
positiver Selbstausgleich
positives Niveau
positives Potential
positives Signal
positiv‐groß (PG)
positiv‐klein (PK)
Positivlogiksignal
positiv‐mittel (PM)
Postenzähler
Postulat
Postulat
Potential des Vektorfeldes
Potential[verteilungs]steuerung
Potentialanalogie
Potentialbild
Potentialdiagramm
Potentialfunktion
Potentialkorrektur
Potentialkurve
Potentialschwelle
Potentialsprung
Potentialtheorie
Potentialverlauf
Potentialverteilung
Potentialwall
potentielle Energie
Potentiometer
Potentiometer für Koordinatenwandlung
Potentiometer mit Kräfteausgleich
Potentiometerabgriff
positioning of handling object
positioning inaccuracy, inaccuracy of positioning
positioning sensor
position control servomechanism
positioning system
positioning technique
positioning inaccuracy, inaccuracy of positioning
position interrogation frequency of IR
position‐dependent code
deviation of gripper position
position indication of IR
position data
position data of manipulator
position data of robot
position identification, position perception (recognition)
determination of position by potentiometer
determination of position by angle encoder
position error
position[ing] error
kinetic control system
positional servosystem (US)
position code
position coordinates
position mechanism
positioner
position measuring system
position measurement
position control accuracy
position sensor
position protection, protection of position
position control
digital position control
position control system
position‐independent code
position uncertainty of IR
position instant, position moment
positive (P)
positive definite
positive path deviation
positive difference
positive coupling
positive logic
positive quadratic form
positive feedback
positive logic
positive pulse
positive self‐regulation
positive level
positive potential
positive signal
positive big (PB)
positive small (PS)
positive‐logic signal
positive medium (PM)
item counter
axiom
postulate
potential of vector field
potential distribution control
potential analogy
potential diagram
potential diagram
potential function
potential correction
potential‐energy curve
potential barrier
potential jump
potential theory
potential distribution
potential distribution
potential barrier
potential energy
potentiometer
resolver potentiometer
force‐balanced potentiometer
potentiometer pick‐off
stran 208 od 326
EN ‐DE: slovar avtomatizacije in robotike Potentiometermethode
Potentiometerregler
potentiometrisches Fehlermesssystem
Potentiostat
PPT1 (Lag)‐Element (‐Regler)
PPT1‐PDT2 Element
PPT1‐PDT2‐Regler
Präcompoundprozess
Prädikatenlogik
prädiktives Filter
prädiktives Relaissystem
Präionisation
Präionisation
praktischer Beharrungszustand
Prämisse
Präsenz
Präzision
Präzision
Präzision
Präzision
Präzisionsgerätetechnik
Präzisionsindustrieroboter
Präzisionsindustrierobotertechnik
Präzisions‐IR
Präzisionsroboter
Präzisionsrobotertechnik
Präzisionsrobotertechnik
Präzisionsschweißautomat
Präzisionssteuerung
Präzisionstechnik
Präzisionswälzlager
Prediktornetzwerk
predizierendes Netzwerk
Preemphase
P‐Regelung
P‐Regelung
P‐Regelung
P‐Regler
P‐Regler
P‐Regler
P‐Regler
P‐Regler
P‐Regler mit Störgrößenausschaltung
preisgünstiger Sensortyp
Pressen von Einzelteilen
Pressluftanlage
Pressluftanschluss für Roboter
Pressverbindung
Primärdaten pl
Primärdaten pl
Primärelement
primärer Fühler
primäres Regelelement
Primärparameter
Primärprozess
Primärregelung
Primärserienauslöser
Primärspeicher
Primärspeicher
Primärvorgang
Printer
Prinzip der adaptiven Zeitkonstante
Prinzip der Gruppenrangordnung
Prinzip des Argumentes
Prinzip gleichzeitig ablaufender Operationen
Prinzip gleichzeitig ablaufender Operationen
Prinzipschaltbild
Prinzipschaltbild
Prinzipschaltung
Prinzipschaltung
Prinzipschema
Prinzipschema
Prinzipzeichnung
Prinzipzeichnung
Prioritätengruppe
Prioritätsanzeiger
potentiometer method
potentiometer controller
potentiometric error measuring system
potentiostat
phase‐lag compensator
lag‐lead compensator
lag‐lead compensator
pre‐equilibrium process
predicate logic
predicting filter
prediction relay control system
auto‐ionization
preionization
practical steady state
premise
presence
accuracy
exactness
exactitude
precision
precision device engineering
precision robot, precision industrial robot
precision Industrial robot technique, precision industry roboti
precision robot, precision industrial robot
precision robot, precision industrial robot
precision robotics
precision robotics (robots technique)
automatic precision welding equipment
precision control
precision engineering
precision antifriction bearing
predictor network
predictor network
pre‐emphasis
P control
proportional control
P‐control
P controller
proportional controller
proportional [action] controller
Pcontroller
throttling controller
proportional controller with disturbancevariable compensatio
cheap sensor type, inexpensive sensor type
press working of one‐off parts
compressed‐air equipment
compressed‐air connection for robot
presspng] fastening
primary data
original data
primary cell
primary detector
primary control element
primary parameter
primary process
primary regulation
direct series trip
primary memory
primary store
primary process
printer
principle of adaptive time constant
control hierarchy principe
argument principle
principle of simultaneous operations
concept of simultaneous operations
schematic circuit
schematic diagram
schematic circuit
schematic diagram
principle scheme
principle drawing
principle scheme
principle drawing
priority group
priority indicateur
stran 209 od 326
EN ‐DE: slovar avtomatizacije in robotike Prioritätsgrad
Prioritätsinterruptsteuerung
Prioritätskontrolle
Prioritätsordnung
Prioritätsprogramm
Prioritätssteuerung
Prioritätsstromkreis priority control 502
Prioritätsstruktur
Prioritätsstufe
Prioritätsverarbeitung
Prioritätszuteilung
Prismateil
prismatisches Greiforgan
prismatisches Objekt
probabilistisch
probabilistische Logik
probabilistischer Automat
Probe
Probebetrieb
Probebetrieb
Probelauf
Probenraum
Probeproduktion
Problem der Operationsforschung
Problem der Quantisierung
Problemalgorithmus
Problembearbeitungsprozess
Problembeschreibung
Problembestimmung
Problemdefinition
Probleme der Robotertechnik
Problemeinstellung
Problemloser (Roboterprogramm)
Problemlösungsprozess
problemorientierte Geometriesprache
problemorientierte Programmiersprache
problemorientierte Roboter‐Programmiersprache
problemorientierte Steuerung
problemorientierte Werkstückbeschreibung
problemorientierte Werkstückbeschreibung
problemorientiertes Programm
problemorientiertes Softwarepaket
problemorientiertes Systemunterlagenpaket
Problemprogramm
Problemzustand
Processsteuersystem
Produktenentwurf
Produktentwurf
Produktionsausrüstung
Produktionsautomatisierung
Produktionsintegration
Produktionskontrollsystem
produktionsorientiertes Roboterprogramm
Produktionsplanung
Produktionsplanung
Produktionsprozesskontrolle
Produktionsrate
Produktionsrhythmus
Produktionsroboter
Produktionssteuerungsplan
Produktionsstichprobe
Produktionssystem
Produktionsüberwachung
Produktivitätssteigerung
Produktlinie
Produktmontage mittels Industrieroboters
produzierender Prozess
produzierte Montageeinheit
Profoldispersionskoeffizient
Prognosearbeit
Prognosearbeit
Prognosearbeit
Programm
Programm des bedingten Übergangs
Programm eines Universalrechners Programm für Industrieroboter
priority grading
priority interrupt control
priority check
order of priority
priority program
priority control
priority circuit
priority structure
priority grading
priority processing
priority dispatching
prism part
prismatic grip organ
prismatic object
probabilistic
probabilistic logics
probabilistic automaton
sample
test run
trial run
trial run
sample space
trial production
operations research problem
quantization problem
problem algorithm
problem preparation process
problem description
problem definition
problem definition
robotic problems
set‐up of problem
problem solver (robot program)
problem preparation process
problem‐oriented geometry language
problem‐oriented language
problem‐oriented robot programming language
problem‐oriented control
problem‐oriented description
problem‐oriented work piece description
problem‐oriented program
problem‐oriented software package
problem‐oriented software package
problem program
problem state
process control system
product design
product design
production equipment
production automation
integration into production
production control system
production‐oriented robot program
product scheduling
production scheduling, product scheduling
production process control
production rate
rhythm of production
production robot
production control scheme
productive sampling test
production system
production supervision
increased productivity
product line
robot product assembly
producer process
produced assembly unit
profile dispersion parameter
prediction
prognosis
prognostication
program
branching program
universal computer program robot program, industrial robot program
stran 210 od 326
EN ‐DE: slovar avtomatizacije in robotike Programm zur Analyse von Schaltungen
Programm zur automatisierten Datenverarbeitung
Programm zur Filtersynthese
Programm zur Simulation hybrider Schaltungen
programmabhängig
programmabhängiger Betrieb
programmabhängiger Fehler
Programmablauf
Programmablauf
Programmablauf
Programmablaufänderung
Programmablaufnachbildung
Programmablaufplan
Programmablaufplan programme
Programmablaufsteuerung
Programmablaufverzweigung
Programmalgorithmus
Programmanalysator
Programmanalysebericht
Programmanforderung
Programmanpassung
Programmanweisung
Programmaufbau
Programmausführung
Programmausführungskommando
Programmbeschreibung
Programmbetrieb eines Manipulators
Programmbibliothek
Programmdaten pl (eines Roboterprogramms)
Programmende
Programmentwicklungssystem
Programmfehler programme
Programmfehler programme
Programmfehlerermittlung
Programmfernsteuerung
Programmfernsteuerung
Programmfolge
Programmfunktion
Programmgeber
Programmgeber
Programmgenerator
Programmgenerierung
programmgesteuert
programmgesteuert
programmgesteuerte Datenverarbeitungsanlage f
programmgesteuerter Ablauf
programmgesteuerter Automat
programmgesteuerter Bohrroboter (für Leiterplatten)
programmgesteuerter Einschienenmanipulator
programmgesteuerter Makroprozessor programme
programmgesteuerter Manipulator
programmgesteuertes Gerät
programmgesteuertes Schaltsystem programme
programmgesteuertes Vorrangunterbrechungssystem
Programmgrobstruktur
Programmidentifikation
Programmidentifizierer
Programmier[ungs]problem
Programmieranleitung
Programmierarbeitsplatz
programmierbare
programmierbare Anzeige
programmierbare Beschickungseinrichtung
programmierbare fluidische Steuerung
programmierbare Fördereinrichtung
programmierbare Handhabeeinrichtung
programmierbare Handhabungsgeräte ohne Logikfunktionen
programmierbare Interruptsteuereinheit
programmierbare Kommunikationsleitung
programmierbare Lageregelung
programmierbare Logik
programmierbare Montagemaschinenkonfiguration
programmierbare Roboterkontrolle
programmierbare Schaltung
programmierbare Schnittstellenanpassung
programmierbare Sensorsteuerung
circuit analysis program
automatic data processing program, ADPP
filter synthesis program
hybrid program
program‐dependent
program‐dependent operating
program‐dependent error
computer operation
program proceeding, program flow
program flow
dynamic sequential control
program simulation
program flowchart
program flow chart
program flow control
branch of program flow
program algorithm
program analyzer
program analysis report
program request
adaptation of program
program statement
program structure
program execution
program execution instruction
program description
program operation of manipulator
program library
program data (of robot program)
program end
program development system
program error
program fault
program error detection
remote program control
programmed telemetry control
program sequence
program function
program controling element
programmer
program generator
program generation
program‐controlled
software‐controlled
program‐controlled data processing system
program‐controlled sequence
program‐controlled automaton
program‐controlled drill robot (for printed‐circuit boards)
program‐controlled monorail manipulator
program‐controlled macroprocessor
program‐controlled manipulator
program‐controlled device
program‐controlled switching system
program‐controlled priority interrupt system
program coarse structure
program identification
program identifier
programming problem
programming instruction
programming workplace
programmable interrupt controller
programmable display
programmable loading device
programmable fluidic control
programmable conveyor device
programmable handling device
programmable manipulation devices without logic functions
programmable interrupt controller
programmable communication line
programmable regulation of position
programmable logic
programmable assembly machine configuration
programmable robot checking
programmable logic
programmable interface adapter
programmable sensor control
stran 211 od 326
EN ‐DE: slovar avtomatizacije in robotike programmierbare Sortiereinrichtung
programmierbare Steuerung
programmierbarer Armbewegungsablauf
programmierbarer Automat (für Roboter)
programmierbarer Industrieautomat
programmierbarer Industrieroboter (Roboter)
programmierbarer Interface‐Adapter
programmierbarer Manipulator
programmierbarer Miniautomat
programmierbarer Multiplexer
programmierbarer Peripherieschnittstellenbaustein
programmierbarer Punkt
programmierbarer Roboterarm
programmierbarer Sensorroboter
programmierbares Greifertastorgan
programmierbares Handhabemittel
programmierbares Kommunikationsinterface
programmierbares Montagesystem
programmierbares Steuerungssystem (für Roboter)
Programmiereigenschaft
Programmiereigenschaft feines IR
Programmiereinheit
programmieren
Programmieren in natürlicher Sprache
Programmieren von Industrierobotern
Programmierer von Industrierobotern
Programmiererleichterung
Programmierfehler
Programmiergerät
Programmiergestell
Programmierhandbuch
Programmierhilfen
Programmierkonsole
Programmierphase
Programmiersprache
Programmiersprache f"für numerische Steuerung
Programmiersprache mit hohem Niveau
Programmiersprachenfamilie
Programmierstrategie
Programmiersystem
programmierte Aufgabenzuordnung
programmierte Beschleunigung
programmierte Betriebsart
programmierte Bewegungsposition
programmierte Bewegungssequenz
programmierte Fehleranzeige
programmierte Fernsteuerung
programmierte Fernsteuerung
programmierte Sicherheitsgruppe
programmierte Soll‐Bahn
programmierte Sperre
programmierte Toleranzprüfung program memory 512
programmierte Verriegelung
Programmiertechnik
Programmiertechnologie
programmierter Bewegungsraum
programmierter Bewegungsschritt
programmierter Datenaustausch
programmierter Geschwindgkeitssollwert
programmierter Grafikprozessor
programmierter Industrieroboter
programmierter Roboterbefehl
programmierter Roboterbewegungsablauf
programmiertes Lernen
programmiertes Werkzeugmaschinensystem
Programmierung
Programmierung auf Modulbasis
Programmierung grafischer Geräte
Programmierung komplexer Montageroboter
Programmierung von Bewegungspunkten
Programmierung von Roboterproblemen
Programmierungskode
Programmierungsoperatormethode
Programmierungssprache für Roboter
Programmierverfahren
Programmierwerkzeug
programmable sorting device
programmable control
programmable arm movement running
programmable automaton (for robot)
programmable industrial automaton
programmable industrial robot, programmable robot
programmable interface adapter
programmable manipulator
programmable mini‐automaton
programmable multiplexer
programmable peripheral interface
programmable spot, programmable point
programmable robot lever
programmable sensory robot
programmable gripper touching organ
programmable handling mean
programmable communication iterface
programmable assembly system
programmable control system (for robots)
programming property
robot programming property
programming unit
program v
programming in natural language
programming of industrial robots
robot programmer, industrial robot programmer
programming ease
programming error
programming device
programming rack
programming handbook
software
programming console
programming phase
programming language
automatically programmed tool language, APT, programming high‐level programming language
programming language family
programming strategy
programming system
programmed task coordination
timed acceleration
programmed operation mode
programmed movement position
programmed movement sequence
programmed error indication
remote program control
programmed telemetry control
programmed action safety assembly
programmed nominal path
programmed interlock
programmed tolerance check[ing]
programmed interlock
programming technique
programming technology
programmed motion room
programmed movement step
programmed data change
programmed speed nominal value
programmed graphic processor
programmed industrial robot
programmed robot instruction
programmed sequence of robot movements
programmed learning
programmed machine tool system
programming
modular programming
programming of graphic devices
programming of complex assembly robots
programming of movement points
programming of robot problems
programming code
operational programming method
robot programming language
programming method
programming tool
stran 212 od 326
EN ‐DE: slovar avtomatizacije in robotike Programmimpuls
Programminterpreter
Programmkapazität
Programmkennzeichner
Programmkompatibilität
Programmkonzept
Programmkorrektur (eines IR‐Programms)
Programmkreis
Programmlauf eines Roboters
Programmlenkung
Programmodifikation
Programmpaket eines Roboters
Programmposition
Programmpositionszahl
Programmprüfung programme
Programmregelung
Programmregelung
Programmregelungssystem
Programmregler
Programmregler
Programmregler
Programmreproduktionsabweichung
Programmsatz
Programmschaltelement
Programmschalter
Programmschritt eines Roboters
Programmschrittzahl
Programmschutz eines Roboters
Programmsimulation
Programmspeicher
Programmspeicher
Programmspeicherung für einen Industrieroboter
Programmsprache
Programmstart
Programmstatement
Programmsteuerbefehl
Programmsteuerbyte
Programmsteuereinheit
Programmsteuereinrichtung mit Drucktasten
Programmsteuergerät
Programmsteuerung
Programmsteuerung
Programmsteuerung mit Koordinatografen
Programmsteuerung von technologischen Prozessen
Programmsteuerungsart Programmsteuerwerk
Programmstrategie
Programmstruktur
Programmsystem
Programmsystemstruktur
Programmtafel zur Verschlüsselung
programmtechnische Lösung
Programmtext
Programmtextangabe
Programmträger
Programmübersetzung
Programmumsetzungseffektivität/
Programmunterbrechung
Programmvariable
Programmverträglichkeit
Programmverzweigung
Programmverzweigungsoperation
progressive Wirkung
Projektierung
Projektierung
Projektierung
Projektierung
Projektierungsmethode
Projektierungsmodell
Projektionsanzeige
Projektionsroboter
Projektplanungsmethode
Projektunterlagen
prompte Kritikalität
prompte Kritikalität
prompte Kritizität
program pulse
program interpreter. interpreter of robot program
program capacity
program identifier
program compatibility
program concept
program correcting (of IR program)
program circle
program run of robot
preset guidance
modification of program
program pack of robot
program position
program position number
program testing
program control
time‐cycle control
program control system
program controller
time‐cycle controller
time‐schedule controller (US)
deviation of program reproduction
sentence
sequence control element
sequence controller
robot program step, program step of robot
program step number
program protection of robot
program simulation
program memory
program storage
robot program storage, 1R program storage
programming language
program start
program statement
program control instruction
program control byte
program control unit
keyboard programming unit
program control gear
program control
time‐cycle control
program control device with coordinatographs
program control of technological processes
type of program control program control unit
program strategy
program structure
program system
software architecture
program table for coding
program‐technical solution
program text
program text specification
program carrier
program translation
program conversion efficiency
program interrupt
program variable
program compatibility
program branching
program branching operation
progressive action
projecting
engineering
planning
designing
projecting method
projecting model
projection display
projection robot
method for project planning
project documents
prompt criticality
prompt critical state
prompt criticality
stran 213 od 326
EN ‐DE: slovar avtomatizacije in robotike prompte Kritizität
prompter Reaktivitätssprung
prompter Sprung
promptkritischer Zustand
promptkritischer Zustand
Proportion
Proportion
proportional
proportional wirkender Regler
proportional wirkender Regler
proportional wirkender Regler
Proportionalbeiwert
Proportionalbeiwert
Proportionalbeiwert
Proportionalbereich
Proportionalbereich
proportional‐derivative Einwirkung
Proportional‐Differential‐Regler
proportionale Rückkopplung
proportionale Rückkopplung
proportionale Schmalbandregelung
proportionale Verstärkung
Proportionaleinwirkung
Proportionaleinwirkung
proportionaler Bereich
proportionaler Berichtigungsfaktor
proportionaler Zähler
proportionales Band
proportionales Verhalten
proportionales Verhalten
proportionales Verhalten
Proportional‐Integral‐Derivativ‐Regelung
Proportional‐Integral‐Derivativ‐Regelung
Proportional‐Integral‐Derivativ‐Regler
Proportional‐Integral‐Derivativ‐Regler
Proportional‐Integral‐Differential‐ Regelung
Proportional‐Integral‐Regelung
Proportional‐Integral‐Regelung
Proportional‐Integral‐Regelung
Proportional‐Integral‐Regler
Proportional‐Integral‐Regler
Proportional‐Integral‐Regler
Proportionalität
Proportionalitätsfaktor
Proportionalitätsnavigation
Proportionalkomponente
Proportionalregelung
Proportionalregelung
Proportionalregelung
Proportionalregelungsgrenzen
Proportionalteiler
Proportionalverhalten
Proportionalverstärker
Proportionalzählrohrspektrometer
proportionell
prothetischer Manipulator
Prototyp
Prototypsystem
Prozedur
prozedurorientierte Programmiersprache
Prozedurvereinbarung
Prozentvergleichsschutz
Prozess
Prozeß
Prozess vom Markowschen Typ Markov
Prozessalgorithmisation
Prozessalgorithmus
Prozessanalyse
Prozessausgabe
Prozessausnutzungsfaktor
Prozessautomatisierung
Prozessdaten pl
Prozessdatenadapter
Prozessdatenanschlusseinheit
Prozessdaten‐Steuereinheit
Prozessdatenübertragungseinrichtung
prompt critical state
prompt [reactivity] jump
prompt [reactivity] jump
prompt criticality
prompt critical state
ratio
proportion
proportional
proportional [action] controller
Pcontroller
throttling controller
dc gain
proportional constant
proportional gain
proportional band
proportional control zone
proportional‐rate action
proportional‐plus‐derivative controller
proportional feedback
rigid feedback
narrow‐band proportional control
proportional gain
proportional action
proportional input
throttling zone
proportional correction factor
proportional counter
throttling zone
proportional action
proportional behaviour
proportional input
proportional‐integral‐derivative control
proportional‐floating‐derivative control;
proportional‐integral‐derivative controller
PID‐controller;
derivative‐proportional‐integral control
proportional‐plus‐integral control
proportional‐plus‐reset control
PI‐control
proportional‐integral controller
PI‐controller
proportional‐floating
proportionality
coefficient of proportionality
proportional navigation
proportional component
proportional control
throttling control
P‐control
proportional control limits
proportional divider
proportional action
linear amplifier
proportional counter spectrometer
proportional
prothetic manipulator
prototype
prototyping system
procedure
procedure‐oriented language
procedure declaration
percentage differential protection
process
stochastic process
Markovian‐type process
process algorithmization
process algorithm
process analysis
process output
process utilization factor
process automation
process data
data adapter unit
data adapter unit
process data control unit
process communication system
stran 214 od 326
EN ‐DE: slovar avtomatizacije in robotike Prozessdatenverarbeitung
Prozessdatenverarbeitungssystem
Prozesseingabe
Prozesseinheit
Prozesseinrichtung
Prozesseinrichtung
Prozessentwicklung
Prozessfernsteuerung prozessflexible Industrierobotertechnik (Robotertechnik)
prozessflexibler Industrieroboter/n
prozessflexibles Montagesystem mit Robotern
Prozessfolge
prozessgekoppelt
prozessgekoppelte Datenerfassung
prozessgekoppelte Datenerfassung
prozessgekoppelte Datenverarbeitung
prozessgesteuerter Manipulatorarbeitsplatz
Prozesshardware
Prozesshardware
Prozessidentifikation
Prozessinformationen
Prozessinformationssystem
Prozessinformationssystemplanung
Prozessintensivierung
Prozesskennlinie
Prozessknoten
Prozesskommunikation
Prozesskontrolle bei Manipulation mechanischer Teile
Prozesskonvergenz
Prozesslösung
Prozessmodellsteuerung
Prozessniveau
Prozessniveau
Prozessniveau
Prozessor
Prozessor
Prozessor
Prozessor für Vorverarbeitung
Prozessorarchitektur
prozessorgesteuerte Logikanalyse
prozessorgesteuerte Vermittlungsstelle processeur
Prozessorleistung
Prozessormodul
Prozessorregister
Prozessorschnittstelle
Prozessortakt
Prozessorunterbrechung
Prozessorverbindungsprogramm
Prozessorzyklus
Prozessregelung
Prozessschritt
Prozesssensor
prozessspezifische Industrierobotertechnik (IR‐Technik)
prozessspezifischer Montageroboter
Prozessstabilisierung
Prozesssteuersystem
Prozesssteuerung
Prozesssteuerung process 504
Prozesssteuerungsanalyse
Prozessstörung
Prozessüberwachung
Prozessüberwachung
Prozesszyklusregler
Prüf bit
Prüf Operationsdatei
Prüfablauf
Prüfablaufüberwacher
Prüfalgorithmus
Prüfalgorithmus
Prüfanzeiger
Prüfaufgabe
Prüfautomat
Prüfautomatennetz
Prüfbedingung
Prüfbedingungen
Prüfbit
process data treatment
process data processing system
process input
process unit
process hardware
process hardware, process device
process development
process remote control
process‐flexible [industrial] robots technique, process‐flexible
process‐flexible {industrial] robot
robot process flexible assembly system
sequence of processes
online
online data acquisition
online data collection
online data processing
process‐controlled manipulator workplace
process hardware
process hardware, process device
process identification
process data
process information system
planning of process information system
process intensification
process characteristic
process node
process communication
process control at manipulation of mechanical parts
process convergence
process solution
process model control
activity level
level of activity
level of process
processor, processing unit, PU
processor
processing unit
processor for pretreatment
processor architecture
processor‐controlled logic analysis
processor‐controlled exchange
processor power
processor module
processor register
processor interface
processor clock
processor interrupt
processor junction program
processor cycle
process control
processing step
process sensor
process specific industrial robots technique
process specific mounting robot
process stabilization
process control system
process control
proceeding control
process control analysis
process disturbance
process supervision
processing monitoring
process cycle controller
check bit, CB
checking operation file
test process
test monitor
check algorithm, checking algorithm
check[ing] algorithm
check indicator
check problem
automatic tester
automatic tester network
test condition
test requirements
check bit
stran 215 od 326
EN ‐DE: slovar avtomatizacije in robotike Prüfbit
Prüfbit
Prüfdaten pi
Prüfdaten pl
Prüfeinheit
Prüfeinrichtung
prüfen
prüfen
Prüfer
Prüfer
Prüffeldrechner
Prüffolge
Prüffolge
Prüffolgenerzeugung
Prüfgerät
Prüfgerät
Prüfinformation
Prüfinformation
Prüfkode
Prüfkode
Prüflauf
Prüfmaschine
Prüfmethode
Prüfmodulation
Prüfperiode
Prüfplatz
Prüfplatz
Prüfprogramm
Prüfprogramm eines Industrieroboters
Prüfprogrammbeginn
Prüfprogrammbeginn
Prüfprogrammende
Prüfprogrammende
Prüfprogrammfehler
Prüfprogrammfehler
Prüfprogrammzeit
Prüfprogrammzeit
Prüfprozess
Prüfpunktanalyse
Prüfselbsthalteschaltung
Prüfsender
Prüfsignal
Prüfspannung
Prüfspannung
Prüfstation
Prüfstopp
Prüfsystem
Prüftisch m
Prüftisch m
Prüftisch m
Prüftisch m
Prüfung der Werkzeugqualität
Prüfung durch Rückübertragung
Prüfung durch Rückübertragung
Prüfung innerhalb einer Schaltung
Prüfverfahren
Prüfverfahren
Prüfverfahren
Prüfvorgang
Prüfvorgang
Prüfwähler
Prüfwerkzeuge
Prüfzeichen
Prüfzeit
Prüfziffernsystem
Pseudobefehl
Pseudobefehl
Pseudobefehl
pseudoharmonische Schwingung
Pseudoinverse
Pseudoinverse
Pseudokode
Pseudokode
Pseudokode
Pseudokodesystem
pseudolinear
parity bit
test bit
checking data
checking data
checking unit
checking equipment
monitor v
verify v
testing instrument
check instrument
test panel computer
checking sequence
test sequence
test pattern generation
testing instrument
check instrument
check[ing] information
checking information
error‐detecting code
check code
check run
test machine
test method
check modulation
test period
test place
test assembly
checking program
checking program of robot, checking program of industrial rob
check program beginning
test program beginning
check program end
test program end
test program error
check program error
check program time
test program time
test process
sampling analysis
test latch
signal generator
test signal
test tension
test voltage
checking station
check stop
checking system
instrument table
test stand
test board
test table
tool quality checking
echo checking
echo testing
in‐circuit check
checking procedure
test procedure
testing technique
operation of testing
test operation
test selector
test[ing] tools
test pattern
test period
check digit system
pseudoinstruction
abstract code
pseudo‐code
pseudoharmonic oscillation
Moore‐Penrose pseudoinverse
pseudoinverse
abstract code
conditional code
pseudo‐code
pseudo‐code system
pseudolinear
stran 216 od 326
EN ‐DE: slovar avtomatizacije in robotike pseudolineares System
pseudometrischer Raum
Pseudooperation
Pseudoprogramm
Pseudorechner
Pseudoskalar
pseudoskalare Große
pseudoskalare Kopplung
pseudovektorielle Bindung
Pseudovektorkopplung
Pseudozufallsfolge
Pseudozufallszahlen
PT1‐Element
PT2‐Element
PT2‐Element
PT2‐Element (mit D < 1
PT2‐Element (mitD > 1
PTP‐Steuerung
PU
Puffer
Puffer
Puffer
Puffer für vorausgeholte Informationen
Pufferbaustein
Pufferfunktion
Pufferkreis
Puffermodul
Pufferregister einer Robotersteuerung
Pufferspeicher
Pufferspeicher
Pufferspeicher
Pufferspeicher
Pufferspeicher einer Robotersteuerung
Puffersteuerwort
Pufferstufe
Pufferstufe
Pufferstufe einer Robotersteuerung
Pufferverstärker
Pulsation
Pulsation
Pulsation
Pulsationsinstabilität
Pulsationskoeffizient
Pulsekodemodulationsübertragungssystem
Pulsen
Pulsen
Pulsen
Pulsfrequenzmodulation
pulsierende Spannung
Pulslängenmodulation
Pulslängenmodulation
Pult
Pumpen
Pumpenanlage
Pumpimpuls
Punkt stabilen Gleichgewichtes
Punktabtastsystem
punktbeschreibendes Element
Punktfür‐ Punkt‐Diagrammaufzeichnung
punktgesteuerter Roboterarm (Industrieroboterarm)
Punkt‐Punkt‐Steuerung
Punktschweißen
Punktschweißmanipulator
Punktschweißroboter
Punktschweißzange
Punktschweißzangenöffnen r
Punktschweißzangenschließen
Punktsteuerung
Punktsteuerung Punktsteuerung
Punktsteuerung eines Manipulators
Punkttransformation
punktweise Annäherung
Punkt‐zu‐Punkt‐Steuerung
Putzen von Gussstücken
P‐Verhalten
pseudolinear system
pseudometric space
pseudooperation
pseudoprogram
abstract computer
pseudoscalar quantity
pseudoscalar quantity
pseudoscalar coupling
pseudovector coupling
pseudovector coupling
pseudorandom sequence
pseudorandom numbers
first order lag element
second order lag element
second‐order system
underdamped system
overdamped system
point‐to‐point control, PTP control
processor, processing unit, PU
buffer memory
buffer storage
buffer store
prefetch buffer
buffer module
buffer function
buffer circuit
buffer module
buffer register of robot control
buffer
buffer memory
buffer storage
buffer store
buffer memory of robot control
buffer control word, BCW
buffer cascade
buffer stage
buffer stage of robot control
buffer amplifier
beat[ing]
pulsing
pulsation
pulsation instability
pulsation coefficient
pulse‐code‐modulation transmission system
beat[ing]
pulsing
pulsation
pulse‐frequency modulation
pulsating voltage
impulse ratio modulation
pulse width modulation
console
pump[ing]
pumping plant
pump pulse
stable equilibrium point
point‐to‐point scanning system
point‐descriptive element
point‐to‐point mapping graph
spot‐controlled robot arm, point‐controlled industrial robot ar
point‐to‐point control, PTP control
spot welding
spot welding manipulator
spot welding robot
portable spot‐welding gun
spot welding tong opening
spot welding tong closing
coordinate setting
manipulator point control
point‐to‐point control, PTP control
manipulator point control
point transformation
point approximation
point‐to‐point control
cleaning of castings
P action
stran 217 od 326
EN ‐DE: slovar avtomatizacije in robotike P‐Verhalten
proportional action
Pyrometer mit konstanter Brennweite
fixed focus pyrometer
PZ‐Regler
proportional controller with disturbancevariable compensatio
qasistationäres Verhalten
quasi‐stationary behaviour
Q‐Messer
Q‐meter
Quadrantenschaltung
heterostatic circuit
quadratisch
quadratic
quadratische Fehlerfläche
quadratic error area
quadratische Matrix
square matrix
quadratische Modulation
quadrature modulation
Quadratische Regelfläche
integral of squared error (1SE)
quadratische Regelfläche
integral of squared error (ISE)
quadratischer Mittelwert
root‐mean square
quadratisches Integralkriterium
integral square estimation
quadratisches Kriterium
quadratic criterion
quadratisches Mittelwertkriterium
mean square estimation
Quadraturoszillator
quadrature oscillator
qualification testing
Qualifikationsprüfung
qualitative Analyse
qualitative analysis
Qualitätskontrolle
quality checking
Qualitätslenkung
quality direction
quality engineering
Qualitätstechnik
quanteln
quantize v
Quantelung
quantification
Quantenbedingung
quantum condition
Quantendetektor
quantum detector
quantum electronics
Quantenelektronik
quantum frequency conversion
Quantenfrequenzumsetzung
Quantengrenze
quantum limit
Quantenniveau
quantum level
Quantenoptikgenerator
quantum optical generator
Quantenrauschen
quantum noise
Quantensystem
quantum system
Quantentheorie
quantum theory
Quantenverstärker
quantum amplifier
Quantenwirkungsgrad
quantum efficiency
quantisieren
quantize v
quantisiertes Signal
quantized signal
Quantisierung
quantification
Quantisierungsfehler quantification
quantizing error
Quantisierungsgeräusch n
quantizing distortion
Quantisierungsgeräusch n
quantizing noise
Quantisierungsgeräusch n
quantization distortion
Quantisierungsgeräusch n
quantization noise
Quantisierungskodierer
quantizing coder
quantization step
Quantisierungsschritt
quantizing distortion
Quantisierungsverzerrung
quantizing noise
Quantisierungsverzerrung
Quantisierungsverzerrung
quantization distortion
quantization noise
Quantisierungsverzerrung
quantitative Analyse
quantitative analysis
quantitative Gasdruckmessung
quantitative measurement of gas pressure
quantitatives Modell
quantitative model
quasi‐abgeglichene Brücke
quasi‐balanced bridge
quasi‐associated
quasiassoziiert
quasiassoziierter Modus
quasi‐associated mode
Quasiautomat
quasi‐automaton
quasiharmonische Schwingung
quasi‐harmonic oscillation
quasiharmonisches System
quasi‐harmonic system
quasikritische Dämpfung
quasi‐critical damping
quasilineares System
quasi‐linear system
Quasilinearisierung
quasi‐linearization
Quasimaschinenstruktur
quasi‐machine structure
quasimonochromatischer Laser
nearly single‐frequency laser
quasinatürliche Sprache
quasi‐natural language
quasiparallele Programmausführung
quasi‐parallel program execution
quasiparallele Programmausführung {Ausführung von Progra quasi‐parallel program execution
quasiperiodisches Verhalten
almost periodic behaviour, quasi‐periodic behaviour
quasiperiodisches Verhalten
almost periodic behaviour
quasiperiodisches Verhalten
quasi‐periodic behaviour
quasistabil
quasi‐stable
quasistationär
quasi‐stationary
quasistatisch
quasi‐static
Quelladresse
source address
Quelladresse feines IR‐Programms
source address of IR‐program
Quelle für Lese‐Schreibstrom
read‐write current source
stran 218 od 326
EN ‐DE: slovar avtomatizacije in robotike Quelle kleiner Leistung
Quelle verschiedener Strahlungsarten
Quellenkonfiguration
Quellenmodul
Quellenprozess
Quelllochband
Quelloperand
Quellprogramm
Quellprogrammeditor
Quellprogrammlänge
Quellsprache
Quellwiderstand
Querbezugsliste
Querdehnungszahl
Querprüfung
Querprüfung über Sicherungszeichen
Querredundanzprüfung
Querrichtungsempfindlichkeit
Querschnitt
Querstabilität
Quirlen
Quittungszeichen
Quotientenmesser
R622
Radar
Radarbefehlsstelle
Radardaten pl
Radarecho
Radarecho
Radarfrequenz
Radarreflektor
radiale Armbewegung
radioaktives Warngerät
Radioautografie
Radioautografie
Radioautografie
Radioautografie
Radioautogramm
Radioautogramm
Radioautogramm
Radioautogramm
radioelektrischer Sensor
radioelektrisches Fernsteuerungssystem
Radioelektronik
Radioisotopenmessmethode
Radiometermanometer
radiometrischer Analysator
radiometrisches Dichtemessverfahren
Radioortungsgerät
Radiospektroskopie
Rahmenschlußschutz
Ramansche Spektrometrie
Rampenantwort
rampenförmiges Signal
Rampenfunktion
Rampensignal
Randbedingungen
Randelement
Randintegral
Randmaximum
Randminimum
Randstabilität
Randwertproblem
Randwertproblem
Randwertschaltung
Rang einer Matrix
Rangordnung
rationale ganzzahlige Funktion
rationales numerisches System
Rationalisierungsaufwand
Rationalisierungseffekt
Rationalisierungsgrad
Rationalisierungsinvestition
Rationalisierungskonzeption
Rationalisierungsmittel
Rationalisierungsmittelkonstruktion
low‐power source
multiple source
source configuration
source module
producer process
source punched tape
source operand
source program
source program editor
source program length
source language
source impedance
cross reference table
Poisson's ratio
vertical check
vertical redundancy check
vertical redundancy check
cross sensitivity
cross section
lateral stability
conical scanning
acknowledge[ment] signal
ratiometer
thrust movement of robot
radar
radar command post
radar data
radar echo
blip
radar frequency
radar reflector
radial lever movement
radioactive warning device
autoradiogram
autoradiograph
radioautograph
radioautogram
autoradiogram
autoradiograph
radioautograph
radioautogram
radioelectric sensor
king class
radioelectronics
radioisotopic measuring method
vacuum radiometer gauge
radiometric analyzer
radiometric method of density measuring
radio‐direction finder
radiospectroscopy
frame leakage protection
Raman spectrometry
tamp response
ramp signal
tamp function
linear rising signal
boundary conditions
boundary element
circulation integral
boundary maximum
boundary minimum
marginal stability
boundary equation
boundary value problem
clamping circuit
rank of matrix
hierarchy
rational integral function
rational numerical system
rationalization costs
rationalization effect
degree of rationalization
rationalization investment
program of rationalization
means of rationalization
construction of means of rationalization
stran 219 od 326
EN ‐DE: slovar avtomatizacije in robotike rationelle Kombination
Rauchgasprüfer
Raum der Steuerwirkungen
Raumbahn
Raumbahnart
raumfestes Koordinatensystem
Raumkraft
Raumkurve
Raumkurvenapproximation
Raumkurvendefinition
räumliche Armbewegung
räumliche Bewegung des Objekts
räumliche Greiferbewegung
räumliche Kurbelschleife
räumliche Roboterarmbewegung
räumliche Zuordnung
räumlicher Mechanismus
räumliches Koordinatensystem
Raumpunkt
Raumpunktfolge
raumsparende Ausführung
raumsparende Ausführung
Raumüberwachungsgerät
Raum‐Zeit‐Ausbeute
raumzentriert
Rauschanteil
rauscharmer parametrischer Verstärker
rauscharmer Verstärker
Rauschbegrenzer
rauschbegrenzt
rauschbehaftet
Rauscheigenschaften
Rauscheinmischung
Rauschen
rauschen
rauschend
Rauschersatzschaltbild
Rauschersatzschaltung
Rauschfilter
rauschfrei
rauschfrei
rauschfreier optimaler Regler
Rauschgenerator
Rauschgrenze
Rauschimpuls
Rauschkompensation
Rauschleistung
Rauschmesser
Rauschmesser
Rauschmessgerät
Rauschmessgerät
Rauschmessgerät
Rauschpegel
Rauschpegel
Rauschpegel eines Stromkreises
Rauschspektrum
Rauschunempfindlichkeit
Rauschverhältnis
Rauschverhältnis
Rauschverminderung
RC‐Generator
Reaktanz
Reaktanzspannungsabfall
Reaktanz‐Verzögerungslinie
Reaktionskraft
Reaktionskraft (bei automatischer Montage)
Reaktionsmoment
Reaktionsmoment (bei automatischer Montage)
reaktionsschneller Regelungsalgorithmus
Reaktionsträger
Reaktionszeit
Reaktionszeit
Reaktionszeit eines IR
Reaktor mit idealer Vermischung
Reaktordynamik
Reaktormodellierung
rational combination
flue‐gas analyzer
space of control actions
space path
kind of space path
space‐fixed coordinate system
body force
space curve
approximation of space curve
definition of space curve, definition of robot space curve
spatial arm movement, spatial robot arm motion
spatial movement of object, spatial motion of object
spatial movement of gripper
spatial Scotch yoke
spatial arm movement, spatial robot arm motion
spatial coordination
spatial mechanism
spatial coordinate system
space point
sequence of space points
compact construction
compact design
area monitor
space‐time yeld
body‐centered
noise component
low‐noise parametric amplifier
low‐noise amplifier
noise limiter
noise‐limited
noisy
noise properties
noise interference
noise
noise v
noisy
noise equivalent circuit
noise equivalent circuit
noise suppressor
noise‐free
noiseless
noise‐free optimal regulator
noise generator
noise threshold
noise impulse
noise compensation
noise power
decibelmeter
noise test set
noise measuring instrument
noise meter
noise test set
noise level
noise ratio
circuit noise level
noise spectrum
noise immunity
noise level
noise ratio
noise reduction
capacitance‐resistance oscillator
reactance
reactance drop
inductance‐capacitance delay line
reaction force (on automatic assembly)
reaction force (on automatic assembly)
reaction moment (on automatic assembly)
reaction moment (on automatic assembly)
fast response regulation algorithm
carrier of reaction
reaction time
time of response
reaction time of IR
perfectly mixed reactor
reactor dynamics
reactor modelling
stran 220 od 326
EN ‐DE: slovar avtomatizacije in robotike Reaktorregelung
Realautomat
Realdiagramm
reale aktuelle Arbeitsplatzposition
reale Roboterbewegung
reale Roboterumwelt
reale Umwelt eines Industrieroboters
realer Prozess
reales Gas
reales Gas
realisierbares System
Realisierbarkeitsbedingungen
realisierter Fehler
realisierter Versuch sauf bau
realisierter Versuchsaufbau
Realisierung einer Roboterlösung
Realisierung eines digitalen Systems
Realisierungsbasis
realistische Wiedergabe
Realstruktur
Realteil
Real‐Time‐Datenübertragungssteuerung
Realwert
Realwert
Realwert
Realzeituhr
rech er unterstütztes Entwerfen und Fertigen
Rechenanlage
Rechenanlage
Rechenanlage
Rechenanlage
Rechenaufgabe
Rechenautomatentechnik
Rechenautomatentechniker
Rechenelement
Rechenergebnis eines Roboterprogramms
Rechenfrequenz
Rechenfunktion
Rechengenauigkeit
Rechengeschwindigkeit
Rechengeschwindigkeit
Rechengesetz
Rechenhilfsmittel
Rechenhilfsmittel
Rechenintervall
Rechenmaschine f
Rechenmaschine f
Rechenmaschine f
Rechenmaschine f
Rechenmaschinenergebnis
Rechenmathematik
Rechenoperation
Rechenoperation
Rechenprogramm
Rechenprogramm für Satzbau‐Analyse
Rechenprozess
Rechenprozess
Rechenprüfung
Rechenprüfung
Rechenregister
Rechenregister
Rechentakt
Rechenvorgang
Rechenvorgang
Rechenwerk
Rechenwerk
Rechenzeit
Rechenzeit
Rechenzeit
Rechenzeitminimierung
Rechenzentrale
Rechenzentrale
Rechenzentrum
Rechenzentrum
Rechner eines Industrieroboters
Rechner für Diagnose
reactor control
real automaton
real diagram
real actual workplace position
real robot movement
real robot environment
real robot environment
actual cycle
actual gas
real gas
feasible system
feasibility conditions
conscious error
realized experimental arrangement
realized experimental arrangement
realization of robot solution
digital system realization
base of realization (theory of automata)
realistic reproduction
real structure
real part
real‐time data transmission control
actual value
real value
desired value
real‐time clock
computer augmented design and manufacturing, CAD CAM, co
computer
computing machine
calculating machine
calculator
computing problem
computing automaton technique
computer engineer
computing element
computing result of robot program
calculating frequency
calculating function
computing accuracy
computing speed
computing velocity
computing law
computation aids
computations means
computing interval
computer
computing machine
calculating machine
calculator
computer result
calculus mathematics
calculating operation
arithmetical operation
computing program
computer program for structural analysis
computational process
computing process
arithmetical check[ing]
mathematical check[ing]
arithmetic register
calculating register
computing interval
computational process
computing process
arithmetic‐logic unit
ALU
computer time
computing time
machine time
computing‐time minimization
data processing centre
computing centre
data processing centre
computing centre
robot calculator, industrial robot calculator
computer for diagnosis
stran 221 od 326
EN ‐DE: slovar avtomatizacije in robotike Rechner für industrielle Verarbeitung
computer for industrial processing
Rechner für Roboteroptimierung
computer of robot optimization
computer for testing
Rechner für Testung
computer for machine tool control
Rechner für Werkzeugmaschinensteuerung
Rechner in biomedizinischer Forschung
computer in biomedical research
Rechner mit festem Programm
fixed‐program computer
Rechneradressenbus
computer address bus
Rechneranalyse
computer analysis
Rechneranwendung
computer application
Rechnerarchitektur
computer architecture
Rechnerbauelement
computer component
Rechnerbefehl
computer instruction
rechnerbestückt
computerized
rechnerbestückter Messplatz
computerized measuring device, computerized test rack
rechnerbestückter Messplatz
computerized measuring device
rechnerbestückter Messplatz
computerized test rack
rechnerbestückter Prüfautomat
computerized automatic tester
Rechnerblockdiagramm
computer block diagram
Rechnerblockschaltbild n
computer block diagram
Rechnerdaten pl eines Industrieroboters
computer data of [industrial] robot
Rechnerdrucker
computer printer
Rechnerentwerfer
computer designer
Rechnerergänzungsspeicher
computer backing store
Rechnerergebnis
computer result
rechnererstellte Originalschablone
computer‐generated artwork
rechnererzeugte Struktur
computer‐produced structure
Rechnergebiet
computer field
computerized
rechnergeführt
computer‐guided image identification
rechnergeführte Bilderkennung
computer‐guided numerical control
rechnergeführte numerische Steuerung
rechnergeführte Robotik
computer‐guided robotics
Computer managed instruction, CM!
rechnergeführte Unterweisung
rechnergeführter Messplatz
computerized measuring assembly
rechnergenerierte Information
computer‐generated information
rechnergeneriertes Roboterablaufprogramm
computer‐generated robot operating schedule
rechnergesteuerte Anzeige
computer‐controlled display
rechnergesteuerte Anzeige
computer‐controlled display, CCD
rechnergesteuerte digitale Steuerung
computer‐controlled digital control
rechnergesteuerte Koordinatentransformation
computer‐controlled transformation of coordinates
rechnergesteuerte Montage
computer‐controlled assembly
rechnergesteuerte Robotermontage
computer‐controlled robot assembly
rechnergesteuerte Sichtkontrolle
computer‐controlled visual checking
computer‐controlled unmanned factory
rechnergesteuerte unbemannte Fabrik
rechnergesteuerter Antrieb
computer‐controlled drive
rechnergesteuerter Fertigungsbereich
computer‐controlled production region
rechnergesteuerter Manipulator
computer‐controlled manipulator
rechnergesteuerter Prüfautomat
computer‐controlled automatic tester
rechnergesteuerter Roboter
computer‐controlled robot
rechnergesteuerter Sehvorgang
computer‐controlled visual process
rechnergesteuerter Zuschnittsroboter
computer‐controlled cut robot
rechnergesteuertes Fehlersuchen
computer‐controlled error seek
computer‐controlled measuring device
rechnergesteuertes Messgerät
rechnergesteuertes System für Sehvorgänge
computer‐controHed system for visual processes
rechnergesteuertes System für Sehvorgänge
computer‐controlled system for visual processes
rechnergesteuertes Verteilungszentrum
computer‐controlled distribution centre
computer‐aided presentation
rechnergestützte Darstellung
rechnergestützte Enwurfsmittel computer‐aided design librarcomputer‐aided design facilities
computer‐aided manufacturing, CAM
rechnergestützte Fertigung
computer micrographics
rechnergestützte Mikrografik
rechnergestützte Programmierung
computer‐aided programming
rechnergestützte Programmierung
computerassisted programming
computer‐aided quality direction
rechnergestützte Qualitätslenkung
computer‐aided control data generation
rechnergestützte Steuerdatenerzeugung
rechnergestützte Textverarbeitung ordinateur
computer‐aided text processing
computer‐aided investigation
rechnergestützte Untersuchung
computer‐aided system design
rechnergestützter Systementwurf
rechnergestütztes Lernen
computer‐assisted learning, CAL
rechnergestütztes Lernen computer‐controlled manipulator computer‐assisted learning
rechnergestütztes Logik‐Design
automatic logic design
rechnergestütztes Skizzieren und Entwerfen
computer‐aided drafting and design, CAD, computer‐aided des
rechnergestütztes strukturelles Detaillieren calculatrice
computer‐aided structural detailing
rechnergestütztes Zeichnen
computer‐aided drawing
Rechnergleichung
machine equation
Rechnergleichung
computer equation
Rechnergrafik
computer graphics
Rechnergruppe
computer group
stran 222 od 326
EN ‐DE: slovar avtomatizacije in robotike Rechnerindexregister
Rechnerindikator
Rechnerinstallation
Rechnerinterface
rechnerinterne Beschreibung
rechnerinterne Darstellung
rechnerinterne Darstellung
rechnerinterne kodierte Beschreibung
rechnerinterne Schablone
rechnerinternes digitales Abbild (Bild)
rechnerischer Grundteil
Rechnerkapazität
Rechnerkonfiguration
rechnerkontrollierte Lieferung
rechnerkontrollierte Zulieferung
rechnerkontrollierte Zulieferung {Lieferung)
rechnerkontrollierter Lagerbestand
Rechnerkontrollzustand
Rechnerkonzept
Rechnerleistung
Rechnerleistungsfähigkeit
Rechnerliteratur
Rechnerlogik
Rechnermerkmal
Rechnermerkmal
Rechnermethode
Rechnermodell
Rechnermodule
Rechnernetzwerk
rechnerorientierter Algorithmus
Rechnerperiode
Rechnerperipherie
Rechnerprogrammierungssystem
Rechnerprüfprogramm
Rechnerschnittstellenadapter
Rechnersimulation digitaler Systeme
Rechnersimulierung
Rechnerspeichertrommel
Rechnersprache
Rechnersteuerung
Rechnersteuerung Rechnersteuerung eines Manipulatorarbeitsplatzes
Rechnersteuerung eines Manipulators
Rechnersteuerung feines Manipulatorarbeitsplatzes
Rechnerstruktur
Rechnersystemaufbau
Rechnersystemstruktur
Rechnersystemstruktur
Rechnertechnologie
Rechnerterminal
Rechnertest
Rechner‐Übertragung
rechnerunterstützte Fertigung
rechnerunterstützte Montageeinrichtung
rechnerunterstützte Programmierung
rechnerunterstützte Robotermontage
rechnerunterstützte Selektion
rechnerunterstützte Signalauswertung
rechnerunterstützte Verfahrenserkennung
rechnerunterstützter Entwurf
rechnerunterstütztes Entwerfen und Fertigen
rechnerunterstütztes Entwerfen und Fertigen
rechnerunterstütztes Entwerfen und Fertigen
rechnerunterstütztes Ingenieurwesen
rechnerunterstütztes Konstruieren
Rechnerverfahren
Rechnerwirkzeit
Rechnerwort
Rechnerzeit
Rechnung
Rechnung
Rechnung von Differenzen
rechte s‐Halbebene
rechteckige Hystereseschleife
rechteckige Hystereseschleife
rechteckige Impulsmodulation
computer index register
computer indicator
computer installation
computer interface
computer‐intern description
computer‐intern representation
machine representation
computer‐intern coded description
computer‐intern model
computer‐intern digital image, computer‐internal digital imag
arithmetic[al] element
computer capacity
computer configuration
computer‐checked supplying
computer‐checked supplying
computer‐checked supplying
computer‐checked stock
computer checking state
concept of computer
computer performance
computer capacity
computer literature
computer logic
computer feature
feature of the computer
computer method
computer model
computer modules
computer network
computer‐oriented algorithm
machine cycle
computer peripherals
computer programming system
computer test routine
computer interface adapter
computer simulation of digital systems
computer simulation
computer memory drum
machine language
computer control
manipulator computer control
computer control of manipulator workplace
manipulator computer control
computer control of manipulator workplace
computer structure
construction of computer system
structure of computer system
computer system structure
computer technology
computer terminal
computer check
computer transfer
computer‐assisted manufacturing
computer‐assisted assembly device
computer‐assisted programming
computer‐assisted robot mounting, computer‐assisted robot a
computer‐assisted selection
computer‐assisted signal evaluation
computer‐aided process identification
computer‐aided design, CAD, computer‐aided conception
computer augmented design and manufacturing
CAD/CAM
computeraided
computer‐aided engineering
computer‐aided drafting and design, CAD, computer‐aided des
computer method
machine‐available time
machine word
computer time
calculation
computation
calculus of differences
right half s‐plane (RHP)
rectangular hysteresis loop
square hysteresis loop
square‐wave modulation
stran 223 od 326
EN ‐DE: slovar avtomatizacije in robotike Rechteckimpuls
Rechteckimpuls
Rechteckmatrix
rechteckmoduliert
Rechteckwellenform
rechteckwellenmoduliert
Rechts‐Max‐Methode
rechtwinklige Verteilung
Redigiereinrichtung
Reduktion
redundante Bahnstruktur
redundante Schaltung
redundanter Modul
redundantes System
Redundanz
Redundanzbaustein
Redundanzbeseitigung
Redundanzprüfung
reduzibel
reduzierte Frequenz
reduzierte Gleichung
reduzierter Fehler
reduzierter Roboterberechnungsaufwand
reelle Frequenzcharakteristik
reelle Veränderliche
reelles Element
Referenzbild
Referenzdaten pl
Referenzgröße
Referenzkoordinatensystem
Referenzpunkt eines Roboters
Referenzspannung
Referenzwert
Reflexionsnormaleinstellung
Reflexschaltung
Reflexschaltung
Reflexsensor
Reflexverstärker
refraktometrische Analyse
Refresh‐Periode
Refresh‐Schaltung
Refresh‐Steuerung
Refresh‐Zyklus
Regel
Regel
Regelabstand
Regelabweichung
Regelabweichung
Regelabweichungssignal
Regelaktion
Regelalgorithmus
Regelalgorithmus
Regelanlage
Regelanlage mit schmaler Unempfindlichkeitszone
Regelantrieb
Regelband
Regelband
Regelband
regelbar
regelbare Drosselspule
regelbare Größe
regelbare Induktivität
regelbare Verstärkung
regelbarer Antrieb eines Montageroboters
regelbarer Autotransformator
regelbarer Kondensator
regelbares Dämpfungsglied
regelbares Dämpfungsglied
regelbares Dämpfungsglied
Regelbarkeit
Regelbarkeit
regelbasierte Schlussfolgerung
Regelbasis
Regelbefehl
Regelbefehl
Regelbereich
orthogonal pulse
rectangular pulse
rectangular matrix
rectangular modulated
rectangular waveform
rectangular modulated
last of maxima (LOM) defuzzification
rectangular distribution
editing equipment
reduction
redundant path structure
redundant circuit
redundant module
redundant system
redundancy
redundant module
redundancy elimination
redundancy check
reducible
reduced frequency
depressed equation
reduced error
reduced robot calculation expense
real frequency characteristic
real variable
real element
reference image
reference data
reference value
reference coordinate system
robot reference point
reference voltage
reference value
adjustable reference mismatch
double amplification circuit
reflex circuit
reflex sensor
reflex amplifier
refractometric analysis
refresh period
refresh circuit
refresh control
refresh cycle
control
rule
control interval
control deviation
control error
control error signal
regulating action
control algorithm
regulation algorithm, regulating algorithm
control installation
control installation with narrow dead zone
control drive
zone of action
control band
regulation band
controllable
variable inductor
regulating quantity
continuously adjustable inductivity
adjustable gain
adjustable drive of assembly robot
variable autotransformer
variable capacitor
adjustable attenuator, variolosser
adjustable attenuator
variolosser
controllability
readjustability
rule‐based inference
rule‐base
control instruction
forward signal
control band
stran 224 od 326
EN ‐DE: slovar avtomatizacije in robotike Regelbereich
Regelbereich
Regelbereich
Regelbereich
Regelbereich
Regelbus
Regeldauer
Regeldifferenz
Regeldrossel
Regeleinrichtung
Regeleinrichtung
Regeleinrichtung
Regeleinrichtung mit nachgebender Rückführung
Regeleinrichtung mit nachgebender Rückführung
Regelelement
Regelfaktor
Regelfläche
Regelfläche
Regelfühlglied
Regelfunktion
Regelgarnitur
Regelgenauigkeit
Regelgenauigkeit
Regelgenauigkeit
Regelgenauigkeit im Beharrungszustand
Regelgenauigkeit im Beharrungszustand
Regelgeschwindigkeit
Regelgeschwindigkeit
Regelgeschwindigkeit
Regelgeschwindigkeit
Regelgeschwindigkeit
Regelgeschwindigkeit
Regelgeschwindigkeit
Regelglied
Regelgrenzen
Regelgröße
Regelgröße
Regelgröße
Regelgröße einer Regelstrecke
Regelgrößenbereich
Regelgruppe
Regelgüte
Regelgüte
Regelgüteverbesserung
Regelgüteverbesserung
Regelknopf
Regelkondensator
Regelkraftwerk
Regelkreis
Regelkreis
Regelkreis eines Vakuummanometres Regelkreis mit nichtrationaler Übertragungsfunktion
Regelkreis mit Übertragungsverzögerung
Regelkreis mit veränderlicher Verstärkung
Regelkreis mit vorgeschiebener Überschwingweite
Regelkreiselement
Regelkreisglied
regellos
regellose Füllung
regellose Funktion
regelloser Teil der Funktion
regelmäßige Logikschaltungsstruktur
regelmäßige Zellenstruktur
Regelmedium
regeln
Regeln mit ODER‐Verknüpfung
Regeln mit UND‐Verknüpfung
regelnde Maschine
Regelobjekt
Regelobjekt
Regelschaltung
Regelschleife
Regelschwankung
Regelschwankung
Regelsignal
Regelsignal
control range
operating range
control area
control domain
regulation band
control bus
control time
control error
regulating inductor
control equipment
control assembly
controlling system
elastic feedback controller
variable feedback controller
control element
control action coefficient
control area
control domain
control sensitive element
control function
control set
accuracy of control
accuracy of regulation
regulation precision
steady state control accuracy
steady‐state control accuracy
control rate
controlrate
correction rate
regulation speed, control speed
adjusting speed
regulation speed
control speed
function element of controller
control limits
controlled parameter
controlled value
controlled variable
controlled variable of controlled system
controlled value range
control assembly
control effectiveness
control performance
improvement of control quality
improved precision
control key
adjusting capacitor
controlling power station
control loop
control system
vacuum gauge control circuit control system with nonrational transfer function
control circuit with transfer lag
control circuit with variable amplification
control circuit with prescribed overshoot
loop element
loop element
random
random filling
random function
irregular part of the function
regular logic
regular cell structure
control agent
control v
disjunctive rules
conjunctive rules
controlling machine
controlled device
controlled member
regulating circuit
control loop
hunting
parasitic oscillations
command signal
control signal
stran 225 od 326
EN ‐DE: slovar avtomatizacije in robotike Regelstabeichung
Regelstrecke
Regelstrecke
Regelstrecke
Regelstrecke eines Manipulators
Regelstrecke mit Totzeit
Regelstrecke ohne Ausgleich
Regelstreckenanalyse
Regelstreckencharakteristik
Regelstreckencharakteristik
Regelstreckendämpfung
Regelstreckenkennlinie
Regelsystem
Regelsystem eines Industrieroboters
Regelsystem eines Industrieroboters
Regelsystemanalysator
Regelsystemkomponente
Regeltätigkeit
Regelung
Regelung
Regelung
Regelung
Regelung
Regelung Regelungdurch das Robotersteuerungssystem
Regelungdurch visuelle Überwachung
Regelung des Greifereinsatzes
Regelung des Rückkopplungssystems
Regelung durch Absorption
Regelung durch Frequenzänderung
Regelung durch Spannungsänderung
Regelung durch visuelle Überwachung
Regelung einer Bahnabweichung
Regelung gemäß zweiter Ableitung
Regelung im vermaschten Regelkreis
Regelung kleiner Durchflussmengen
Regelung kontinuierlicher Prozesse
Regelung mit Beobachter
Regelung mit festem Sollwert
Regelung mit festem Sollwert
Regelung mit geschlossenem Regelkreis
Regelung mit geschlossenem Regelkreis
Regelung mit geschlossenem Zyklus
Regelung mit geschlossenem Zyklus
Regelung mit Reglerverstärkung
Regelung mit Störgrößenaufschaltung
Regelung mit Störgrößenaufschaltung
Regelung mit stufenlos einstellbaren Getrieben
Regelungs‐ und Steuerungstechnik
Regelungsalgorithmus
Regelungsfolge
Regelungsgenauigkeit
Regelungsgenauigkeit
Regelungsgenauigkeit Regelungsgeschwindigkeit
Regelungsgeschwindigkeit
Regelungsgeschwindigkeit
Regelungsgeschwindigkeit
Regelungsgesetz
Regelungsintervall
Regelungskoeffizient
Regelungsnormalform
Regelungspegel
Regelungsprozess
Regelungssabilität
Regelungsstatik
Regelungsstruktur
Regelungsstufe
Regelungssystem
Regelungssystem
Regelungssystem
Regelungssystem
Regelungssystem mit direkter Gegenkopplung
Regelungssystem mit Hilfsenergie
Regelungssystem mit Hilfsenergie
Regelungssystem mit Totzeit
control rod calibration
controlled system
plant
plant (US)
controlled system of manipulator
controlled system with transportation lag
astatic controlled system
plant identification
controlled plant characteristic
plant characteristic
plant attenuation
plant characteristic
closed‐loop control system
robot regulating system, industrial robot regulating system
[industrial] robot regulating system
control system analyzer
control system component
regulating action
automatic control
closed‐loop control
control
automatic regulation
self‐regulation
control of metal transfer
regulation by robot control system
regulation by visual supervision
regulation of gripper use
control of feedback system
absorption control
variable‐frequency control
variable‐voltage control
regulation by visual supervision
path deviation regulation
second derivative control
multicircuit control
control of small flows
continuous process control
observer based control
fixed set point regulation
regulation with fixed set point
closed‐cycle control
closed‐loop control
closed‐cycle control
closed‐loop control
servo‐operated control
feed forward control
feedf orward control
control by means of infinitely variable gears
automatics
regulation algorithm, regulating algorithm
control sequence
accuracy of regulation, regulation precision, control accuracy
control accuracy
positioning control accuracy
regulation speed, control speed
adjusting speed
regulation speed
control speed
control law
control interval
control coefficient
controllable canonical form
control level
regulation process
control stability
control statics
regulation structure
control step
auto feedback control system
automatic feedback control system, control system
feedback control system
control system
unity‐feedback control system
indirect control system
system with power amplification
control system with time delay
stran 226 od 326
EN ‐DE: slovar avtomatizacije in robotike Regelungssystem ohne Hilfsenergie
Regelungssystementwurf
Regelungstechnik
Regelungstechnik
Regelungstechnik
Regelungstechnologie für fR
Regelungstheorie
Regelungstheorie
Regelungstheorie
Regelungsverhalten
Regelungsvorgang
Regelungswirkung
Regelvariable
Regelvariable
Regelventil Regelventil Regelventil Regelventil für kleine Durchflussmengen
Regelverfahren
Regelverfahren
Regelverhalten
Regelverlauf
Regelvorgang
Regelwarte
Regelwiderstand
Regelwirkung
Regelwirkung
Regelwirkung mit teilweise unterdrücktem Bereich
Regelzeit
Regelzyklus
regenerativer Impulsgenerator
Regenerator
Regenerator
Regenerator
regenerieren
regenerieren
Regenerierung
Regenerierungszeit
Register
Registerbank
Registerbefehl
Registerdirektadressierung
Registerindirektadressierung
Registeroperationsbefehl
Registerpaaradresse
Registersatz
Registerspeicher
Registerspeicher
Registerspeicher
Registerstruktur
Registrator stetiger Daten
Registrierelement
registrierender Beschleunigungsmesser
registrierender Dichtemesser
registrierender Doppelbereich‐ Durchflussmesser
registrierender Gasanalysator
registrierender Pegelanzeiger
registrierender Schwärzungsmesser
registrierendes Densitometer
registrierendes Element eines Galvanometers
registrierendes Mikrodensitometer
registrierendes Niederdruckdurchflussmesser
registrierendes Spektralfotometer
Registrierfrequenzmesser
Registriergerät
Registriergerät
Registrierinstrument
Registriermechanismus
Registriermessgerät
Registriermessgerät
Registrierpotentiometer
Registrierregler
Registriersatz
registrierter Wert
Registrierzählinstrument
Registrierzählinstrument
direct control system
control design
control engineering
control system technology
control technique
robot regulating technology, IR regulating technology
automatic control theory
control theory
theory of servomechanism
control action, controller action
regulation process
control action, controller action
command variable
control variable
air throttle
governor valve
regulating valve
control valve for small flows
control method
regulation process, regulating process
controller action
control performance
control action
control centre
regulating resistor
controller action
control action
offset characteristic
control time
control cycle
regenerative pulse generator
regenerative repeater
intermediate repeater
regenerator
reclaim v
regenerate v
regeneration
recovery time
register
register bank
register instruction
register direct addressing
register indirect addressing
register instruction
register pair address
register record
register memory, register store
register memory
register store
register structure
analog data recorder
recording element
recording acceloremeter
recording densitometer
double‐range recording flowmeter
recording gas analyzer
recording level gauge
recording microdensitometer
recording densitometer
galvanometer recorder
recording microdensitometer
low‐pressure recording flowmeter
recording spectrophotometer
recording frequency meter
autographic recording apparatus
chart recorder
chart recorder
registering mechanism
automatic recorder
recording meter
recording potentiometer
recorder controller
recording unit
recorded value
automatic recorder
recording meter
stran 227 od 326
EN ‐DE: slovar avtomatizacije in robotike Regler
Regler
Regler
Regler
Regler
Regler
Regler
Regler für Fernheizungsanlage distance
Regler mit bestmöglicher Ausregelung
Regler mit Hilfsenergie
Regler mit Hilfsenergie
Regler mit mehrfachem Eingang
Regler mit starrer Rückführung
Regler mit stetigem Prüfsignal
Regler mit Vorhalt
Regler mit Vorhalt
Regler mit Vorhalt
Regler ohne Hilfsenergie
Regler ohne Hilfsenergie
Regler zur Ventilstellung
Reglerbaueinheit
Reglerfunktion
Reglerspeisung
Reglerstrecke
Reglersystem
Reglerübertragungsfunktion
Reglerwiderstand
Reglerwirkung
Regression
Regressionsanalyse
Regressionskoeffizient
regulär
reguläre Logik
reguläre Zellenstruktur
regulärer Teil der Funktion
reguläres Element
regulierbare Skaleneinteilung
Regulierbefehl
Reguliertransformator
Reibschweißen mittels Roboter
Reibungsdämpfung
Reibungskoeffizient
Reihenaufstellung von Robotern
Reihenbetrieb
Reihendivergenz
Reihenfolge
Reihenfolge
Reihenfolgemodell
Reihenfolgemodell
reihengeschaltete Drehzahlsteuerung
reihengeschaltetes Korrekturglied
Reihenkaskadenwirkung
Reihenkonvergenz
Reihenparallelregelung
Reihenparallelschaltung
Reihenparallelschaltung mit Brückenschaltung
Reihenparallelsystem
Reihenprüfung
Reihenresonanz
Reihenrobotermontage
Reihenschaltung
Reihenschaltung
Reihenschluss‐Gleichstrommikromotor
Reihenverfahren
reine Laufzeit
reine Laufzeit
reine Trägheitsführung
reine Verzögerung
reine Verzögerung
reißbrettorientierte Korrektur
reißbrettorientierter Arbeitsplatz
Rekombination
Rekombinationskoeffizient
Rekombinationsmechanismus
Rekombinationsmodell
Rekombinationsspektrum
auto controller
automatic controller
compensator
controller
governor
control device
control unit
long‐distance heating installation controller
minimum error controller
indirect action controller
relay‐operated controller
multiinput controller
rigid feedback controller
continuous test signal controller
rate action controller
differential controller
D‐controller
direct acting controller
direct operating controller
valve positioner
packaged control unit
controller action
regulator supply
regulator distance
controller system
controller transfer function
controller resistance
controller action
regression
regression analysis
regression coefficient
regular
regular logic
regular cell structure
regular part of the function
regular element
adjustable scale
adjustment instruction
regulating transformer
friction welding with robot
frictional damping
friction coefficient
series positioning of robots, series arrangement of robots
batch operation
divergence of series
chain (of action)
sequence
scheduling model
sequencing model
concatenation speed control
sequential correcting element
series cascade action
convergence of series
series‐parallel control
series‐parallel circuit
bridge transition
series‐parallel system
batch testing
series resonance
series robot mounting, series robot assembly
cascade connection
series connection
series‐DC‐micro motor
batch process
pure time delay
real dead time
all‐inertial guidance
pure time delay
real dead time
drawing board‐oriented correction
drawing board‐oriented workplace
recombination
recombination coefficient
recombination mechanism
recombination model
recombination spectrum
stran 228 od 326
EN ‐DE: slovar avtomatizacije in robotike Rekursion
Rekursionsformel
Rekursionsfunktion
Rekursionsrelation
Rekursionsverfahren
rekursiv
rekursive Struktur
rekursiver Selbstaufruf
rekursives Filter
rekursives Verfahren
Relais für bestimmte
Relais mit stabiler Mittelstellung
Relais mit zwei festen Lagen
Relaisbahnsteuerung eines Roboters
Relaischarakteristik
Relaisfernmesssystem
Relaisgerätanordnung
Relaisgruppe
Relaiskennlinie
Relaiskennlinie mit Unempfindlichkeitszone
Relaiskettenstrukturformel
Relaiskettensystem
Relaiskompensation
Relaiskontakt
Relaiskreisbetriebszustand
Relaismatrize
Relaisnichtlinearität
Relaisregelkreis
Relaisregelung
Relaisregelung
Relaisregelung
Relaisregelung
Relaisregelung
Relaisregler
Relaisrückgangsfaktor
Relaissatz
Relaisschalterservomechanismus
Relaisschaltung
Relaisschütz
Relaisschutzkanal
Relaisstelle
Relaissteuerung
Relaissystem
Relaissystemanordnung
Relaisunterbrecher
Relaiswählkreis
Relaiswirkung
Relation
Relation
Relation zwischen scharfen Mengen
relationaler Fuzzy‐Regler
relationaler Fuzzy‐Regler
Relativadresse
relative Abweichung der Stellgröße
relative Adresse
relative Amplitude
relative Breite
relative Dämpfung
relative Dielektrizitätskonstante
relative Empfindlichkeit
relative Häufigkeit
relative mittlere Rauschamplitude
relative Regelabweichung
relative Stabilität
relative Streufunktion
relative Streuung
relative Winkelbeschleunigung
relative Winkelgeschwindigkeit
relativer Fehler
relativer harmonischer Anteil
relativer Kode
relativer Parameter
relativer Proportionalitätsbereich
relativer Regelbereich
relatives Maximum
relatives Minimum
recursion
recursion formula
recursive function
recurrence relation
recursive procedure
recursive
recursive structure
recursive self‐call
recursive filter
recursive procedure
definite time‐lag relay
centre stable relay
bang‐bang relay
relay path control of robot
relay characteristic
relay telemetering system
relay device structure
relay group
relay characteristic
relay characteristic with dead zone
relay circuit structural formula
relay chain system
relay compensation
relay contact
operating state of relay circuit
relay matrix
relay non‐linearity
relay servomechanism
relay control
relay servomechanism
bang‐bang control
two‐stage control
two‐step control
relay controller
relay reset coefficient
relay group
contactor servomechanism
relay network
relay fitted contactor
relay protection channel
repeater station
relay control
relay system
relay system structure
relay interrupter
relay selecting circuit
relay action
relation
relation[ship]
binary relation
Mamdani controller
MAMDANI‐controller
relative address
relative deviation of manipulated variable
relative address
relative amplitude
relative duration
relative damping
relative permittivity
relative sensibility
relative frequency
normalized root‐mean square value
relative deviation of controlled variable
relative stability
relative scattering function
relative scatter intensity
relative angle acceleration
relative angle speed
relative error
relative harmonic cotent
relative code
relative parameter
relative proportional band
relative proportional band
relative maximum
relative minimum
stran 229 od 326
EN ‐DE: slovar avtomatizacije in robotike relatives Programmieren
relatives System
Relativgeschwindigkeitsabfall
Relaxationsgenerator
Relaxationsgenerator
Relaxationskreis
Relaxationsschwingungen
Relaxationsspektrum
Relaxationszeit
Remanenz
Reparaturfähigkeit
Reparaturroboter
Repetierbarkeit
Repetierbarkeit
Repetierbarkeit
repräsentativer Parameter
Reproduktion einer Bewegungsbahn
reproduzierbar
Reproduzierbarkeit
Reproduzierbarkeit
Reproduzierbarkeit
Re‐produzierbarkeit eines Roboters
Reproduzierbarkeitsgrad
Reserveausstattung
Reservebetrieb
Reserveeinheit
Reservekanal
Reservekühlsystem
Reserve‐Notkühlsystem
Reserveregelung
Reserveschutz
Reserveschutz
Reservesystem
Reservesystem
Reservezuschaltung
Reservezuschaltung
residente Systemunterlagen
Residuenmethode
Residuentheorie
Resolver
Resolverpotentiometer
Resonanz
Resonanz ### Charakteristik
Resonanz mit Hysterese
Resonanzbreite
Resonanzfrequenz
Resonanzfrequenzmesser
Resonanzkreisfrequenz
Resonanzkreisfrequenz
Resonanzkurve
Resonanzmessverfahren
Resonanznebenschluß
Resonanzschaltung
Resonanzverstärker
Resonanzverstärker
Resonanzwert des Amplitudengangs (PT2‐Element)
Ressource
Ressourcensteuerung
Ressourcen‐Zuordnungsprozessor
retardiertes Argument
Reversibilität
Reversibilitätsgrad
Reversiersteuerung
reziproke Übertragungsfunktion
rezpiroke
Richtigkeit
Richtigstellung
Richtmoment
Richtrelais
Richtung'der Montagebewegung
richtungsabhängige Leitfähigkeit
richtungsabhängiges Arbeiten
Richtungsdiagramm
Richtungsrelais
richtungsunempfindliches Relais
Riemann‐integrierbar
relative programming
relative system
relative speed drop
relaxation [pulse] generator
relaxation [pulse] oscillator
relaxation circuit
relaxation oscillations
relaxation spectrum
relaxation time
remanence
maintainability
repair robot
repeatability, reproducibility
reproducibility
repeatability
representative parameter
reproduction of movement track
reproducible
reproducibility
repeatability, reproducibility
repeatability
repeatability of robot, reproducibility of robot
reproducibility degree
backup equipment
standby mode
standby unit
spare channel
standby emergency cooling system standby emergency cooling system emergency control
back‐up protection
reserve protection
backup system
standby system
standby connection
back‐up connection
resident software
method of residues
calculus of residues
resolver
resolver potentiometer
resonant
jump resonance
jump resonance
sharpness of resonance
resonant frequency
resonance frequency meter
angular resonant frequency
resonant angular frequency
resonance curve
resonance measuring method
resonant shunt
resonance circuit
resonance amplifier
tuned amplifier
resonant peak magnitude
resource
resource control
resource allocation processor
retarded argument
reversibility
reversibility degree
reversible control
inverse transfer function
inverse transfer function
validity
corrective action
restoring torque
directional relay
assembly movement direction
asymmetrical conductivity
directional operation
directional diagram
directional relay
non‐directional relay
Riemann integrable
stran 230 od 326
EN ‐DE: slovar avtomatizacije in robotike Riemannsches Integral
Riemann integral
Ringraumströmung
annular flow
Ringströmung
annular flow
Ringtransformator
doughnut‐type transformer
Ritzsche Methode
Rayleigh‐Ritz method
Ritz‐Verfahren
Rayleigh‐Ritz method
Robocarrier
robocarrier, surface‐mobile robot
Robofahrzeug
robot vehicle
Roboter
[industrial] robot
Roboter
robot, industrial robot, IR
Roboter (Industrieroboter) mit fünf Freiheitsgraden
robot with five degrees of freedom, industrial robot with five d
Roboter außer Betrieb
robot out of operation
Roboter für Behälterauswahl
bin‐picking robot
Roboter für die Montage von Bauteilen
robot for assembly of components
Roboter für die Schwerindustrie
robot for heavy industry
Roboter für explosionsgefährdete Räume
robot for explosion endangered rooms
Roboter für EX‐Räume
robot for explosion endangered rooms
Roboter für Falzpresse
robot for shaving press
Roboter für Hilfsoperationen robot for auxiliary operations
Roboter für intelligentes Schweißen
robot for intelligent welding
Roboter für Kupplungsmontage
coupling assembly robot
Roboter für nukleare Probleme
robot for nuclear problems
Roboter für Sandstrahlbearbeitungen
robot for sand‐blasting
Roboter für Unterwasserarbeiten
underwater robot
Roboter für Verdrahtungsprüfungen
robot for wiring tests
Roboter Herstellung
manufacture of robot, production of industrial robot
Roboter in Betrieb
robot in operation, robot working
Roboter mit acht Werkzeugwechseln
robot with eight tool changes
Roboter mit amerikanischen Normen
robot with American standard
Roboter mit Bahnsteuerung
robot with path control
Roboter mit Erkennungsorgan
robot with perception part
Roboter mit europäischen Normen
robot with European standards
Roboter mit fotoelektrischem Sensor
robot with photoelectric sensor
Roboter mit gleichen Funktionen
robots with equal functions
Roboter mit großer Operationszahl
many‐operations robot
Roboter mit hoher Geschwindigkeit
high‐speed robot
Roboter mit künstlicher Intelligenz
robot with artificial intelligence
Roboter mit mechanischen Unterbaugruppen
robot with mechanic subassemblies
Roboter mit Netzwerksteuerungssystem
robot with network control system
Roboter mit numerischer Struktur
robot with numerical structure
Roboter mit Positionssteuerungssystem
robot with position control system
Roboter mit Punkt‐zu‐Punkt‐Steuerung
robot with point‐to‐point control
Roboter mit sechs Achsen
six‐axis robot
Roboter mit sechs Werkzeugen
robot with six tools
Roboter mit Standardelementen (standardisierten Bauelemenrobot with standard elements
Roboter mit Tastsinn
robot with tactile sense
Roboter mit verbesserter Präzision
robot with improved precision
Roboter mit vier Achsen
robot with four axles
Roboter mit vier Freiheitsgraden
robot with four degrees of freedom
Roboter mit Wahrnehmung
robot with tactile sense
Roboter mit Wahrnehmungssystem
robot with perception system
Roboter mit Zentraleinheit
robot with central processing unit
Roboter Wirkglied
effector
Roboter zur Säuberung von Bauteilen
parts cleaning robot
Roboter)
first development project (for manipulators, robots)
Roboter‐2‐Achse
Z‐axis of [industrial] robot
Roboterabbau
demounting of robot, dismounting of robots
Roboterabfrageeinrichtung
robot interrogation unit
roboterabhängig
robot‐dependent
roboterabhängige Komponente
component dependent on robot
roboterabhängige Positioniergenauigkeit
robot‐dependent positioning exactitude
roboterabhängiges Reglersystem
control system dependent on robot
roboterabhängiges Stellglied
final control element dependent on robot
Roboterablauf Programmierung
trace programming of IR
Roboterablaufprogramm
robot sequence program
Roboterabmessungen
robot dimensions
Roboterabnahmeprüfung
robot acceptance checking
Roboterabschaltkreis
disconnection circuit of robot
Roboterabschaltvorrichtung
switching‐off equipment of robot
Roboterabsolutposition f. Absolutposition feines Roboters
absolute position of robot
Roboterachsantrieb
axis drive of industrial robot, robot axis drive
Roboterachse
robot axis
Roboterachskombinationen
robot axis combinations, axis combinations of industrial robot
Roboterachsregelung
robot axis regulation
Roboteraktion
robot action
Roboteraktionsplan
robots operation plan
stran 231 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboteraktionssystem
robot action system
Roboteraktor
actuator of robot
Roboteraktuator
actuator of robot
Roboteralgorithmus
robot algorithm
Roboteranalyseprogramm
robot analysis program
Roboteranforderung
robot demand
Roboteranlage
robot equipment
Roboteranordnung
robot arrangement, industrial robot arrangement
Roboteranordnungsvariante
robot arrangement variant
Roboteranpassung
robot adaptation
Roboteranschaffungskosten pi
robot prime cost
Roboteranschauungsmodell
robot demonstration model
Roboteranschluss
robot connection, IR connection
Roboteranschlusswert
robot connection value
Roboterantrieb
[industrial] robot drive
Roboterantrieb
robot drive, industrial robot drive
Roboterantrieb mit einstellbarer Geschwindigkeit
robot drive with adjustable speed
Roboterantriebsart
robot kind of drive, IR kind of drive
Roboterantriebsbeschleunigung
acceleration of robot drive
Roboterantriebsbewegung
robot drive movement
Roboterantriebsdynamik
drive dynamics of robot
Roboterantriebsgeschwindigkeit
speed of robot drive
Roboterantriebskosten pl
costs of robot drive
Roboterantriebsmasse
robot drive mass
Roboterantriebsmoment
robot drive moment
Roboterantriebsweg
path of robot drive
Roboterantriebswerte
drive data of robot, drive data of industrial robot
Roboterantriebswirkungsgrad
robot drive efficiency
Roboteranwender
robot user, industrial robot user
Roboteranwendung
robot use, robot application
Roboteranwendungsgebiet
field of application for robots
Roboterarbeitsgeschwindigkeit
robot working speed
Roboterarbeitsorganisation
robot operating schedule
Roboterarbeitsplatz
robot workplace
Roboterarbeitsprogramm working program of robot
Roboterarbeitspunkt
robot working point
Roboterarbeitsraum
robot working room
Roboterarbeitsseite
robot operating side
Roboterarbeitstrajektorie
robot working trajectory
Roboterarbeitswiderstand
dynamic resistance of a robot
Roboterarm
robot arm, arm of robot, robot lever
Roboterarm mit automatischer Verschlusseinrichtung
robot arm with automatic shutter
Roboterarmaturen
robot fittings
Roboterarmbewegung
robot arm movement, robot lever movement
Roboterarmbewegungen
robot arm movements ac‐
Roboterarmdrehgelenk
robot lever swivel joint
Roboterarmelastizität r*
robot arm elasticity
Roboterarmelement
robot arm element
Roboterarmfühler
robot arm sensor
Roboterarmgenauigkeit L Genauigkeit eines Roboterarms
robot arm precision
Roboterarmmontage f. Montage mittels Roboterarms
robot arm assembly
Roboterarmposition t
position of robot arm (lever), position of industrial robot arm Roboterarmpositionierung
robot arm positioning
Roboterarmprogrammierung
robot arm programming
Roboterarmstellung
position of robot arm (lever), position of industrial robot arm Roboterarmverschiebung
robot arm shifting, arm shifting] of robot
Roboteraufbau
robot assembly
Roboteraufgabenbeschreibung
robot task description
Roboteraufgabenbeschreibung i Aufgabenbeschreibung für ei robot task description
Roboterauge
robot eye
Roboterausgabeeinrichtung
robot output device
Roboterausgabekanal
robot output channel, IR output channel
Roboterauslastung
robot utilization, industrial robot utilization
Roboterausrüstung
robots equipment, equipment of robots
Roboterausstattung
robots equipment, equipment of robots
Roboterauswahlkriterien
choice criterions for robots
Roboterautisierung
robot automation
Roboterautomatisierung
robot automation
Roboterbahn
robot path
Roboterbahndefinition
definition of robot path
Roboterbahnelemente
path elements of industrial robot
Roboterbahnfehler
path error of IR
Roboterbahnkoordinate
coordinate of robot path
Roboterbahnoptimierung
robot path optimization
Roboterbahnposition
path position of [industrial] robot, path position of IR
Roboterbahnprogramm
path program of IR
stran 232 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboterbahnrechner
robot path computer
Roboterbahnsegmente
robot path segments
Roboterbahnsteuerung
path control of [industrial] robot, path control of IR
Roboterbasis
robot base, IR base
Roboterbasisstruktur basic structure of robot
Roboterbau m. Industrieroboterbau
manufacture of robot, production of industrial robot
Roboterbauelement
robot component
Roboterbaugruppenmontage
robot assembly mounting
Roboterbaukasten
robot building‐block, industrial robot assembly unit
Roboterbaukasten zur Montagerealisierung
robot assembly unit for assembly realization, industrial robot Roboterbaukastensystem
robot building‐block system
Roboterbaukastensystem robots
robot building‐block system
Roboterbaustein
robot component
Roboterbeanspruchung
load of robot, robot stress
Roboterbedienelement
operator element of robot
Roboterbedienkomfort
operator comfort of robot
Roboterbedienprogramm
robot service program
Roboterbedienung
robot operator attenuation
Roboterbedienungsfeld
robot control panel, robot patch panel
Roboterbedienungsseite
robot operating side
Roboterbefehl
robot command, industrial robot command
Roboterberechnungsaufwand
robot calculation expense
Roboterbereich
robot range
Roboterberührungssensor
robot contact sensor, IR contact sensor
Roboterbeschichten
robot coating, coating by robot
Roboterbeschleunigung
robot acceleration
Roboterbeschleunigungsbetrag
robot acceleration value
Roboterbeschleunigungsphase
acceleration phase of robot
Roboterbeschleunigungswert
robot acceleration value
Roboterbestandteil
robot component
Roboterbestimmung
robot definition, robot designation
roboterbestückte Fertigungszelle
manufacturing cell equipped with robot
Roboterbetriebsanleitung
operating instruction for robot
Roboterbetriebsbedingungen
robot operating conditions
Roboterbetriebskosten pl
operating costs of robot
Roboterbetriebskosten pl
operating data of robots
Roboterbetriebsschalter
operating switch of robot
Roboterbetriebssicherheit
operation safety of industrial robot, reliability in service of ind
Roboterbetriebsspannung
operating voltage of robot
Roboterbetriebsverhalten
robot operation performance
Roboterbewegung
robot movement, robot motion
Roboterbewegung von Werkzeugmaschine zu Werkzeugmasc robot movement from machine tool to machine tool
Roboterbewegung von Werkzeugmaschine zum Lager
robot movement from machine tool to store
Roboterbewegungsablauf
sequence of robot movements
Roboterbewegungsbahn
robot movement path, robot trajectory, industrial robot trajec
Roboterbewegungsbefehl
robot movement instruction
Roboterbewegungsgleichung
robot movement equation, robot motion equation
Roboterbewegungskontrolle
robot movement checking, robot motion checking
Roboterbewegungsoptimierung
robot movement optimization
Roboterbewegungsprogrammierung
robot movement programming
Roboterbewegungsschritt
robot movement step, industrial robot movement step
Roboterbewegungsstopp
robot movement stop
Roboterbewegungsstufe
movement stage of robot
Roboterbewegungszyklus
movement cycle of IR, robot movement cycle
Roboterbild
robot image
Roboterbildinformation
robot image information
Roboter‐Bio‐Hand
bio‐hand of IR, robot bio‐hand
Roboterblockdiagramm
block diagram of robot
Roboterbohrmontage
robot drill assembly
Roboterbunker
bunker of robot, robot bunker
Roboterbussteuerung
robot bus control, IR bus control
Roboterdämpfer
robot antivibrator
Roboterdatei
robot file
Roboterdaten
robot parameters, robot data, data of industrial robot
Roboterdatenspeicher
memory for robot data
Roboterdatenspeicherung
robot data storage
Roboterdatentransport
robot data transport
Roboterdefektanalyse
robot defect analysis
Roboterdefektauswirkung
robot defect effect
Roboterdefinition r
robot definition, robot designation
Roboterdemontage
demounting of robot, dismounting of robots
Roboterdiagnose
robot diagnostic
Roboterdiagnosehilfen diagnostic aids of robot
Roboterdiagnosesystem
diagnostic system of robot
Roboterdialog
robot dialogue
Roboterdialogprogrammierung
conversational programming of industrial robot, dialogue prog
stran 233 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboterdiskette
Roboterdisplay
Roboterdreheinheit
Roboterdrehgelenk
Roboterdrehgelenkachse
Roboterdrehständer
Roboterdruckluftleitung
Roboterduplexbetrieb
Roboterdurchlaufzeit
Roboterdynamik
Robotereaktionsgeschwindigkeit
Robotereffektor
Robotereffektorkoordinaten
Robotereffektormagazin
Robotereigenfrequenz
Robotereinbeziehung
Robotereinbeziehung
Robotereinbeziehung
Robotereinbeziehung
Robotereinbeziehung
Robotereingabeeinrichtung
Robotereingangsleistung
Robotereinheit
Robotereinrichtung
Robotereinsatz
Robotereinsatz
Robotereinsatz
Robotereinsatz
Robotereinsatz
Robotereinsatz
Robotereinsatzbedingung
Robotereinsatzbereich
Robotereinsatzcharakteristik
Robotereinsatzkomponente
Robotereinsatzorganisation
Robotereinsatztechnik
Robotereinsatzvariante
Robotereinsatzvorbereitung
Robotereinteilung
Robotereinzelmaschine
Roboterelektronik
Roboterelement
Roboter‐Endeinrichtung
Roboterendkörper
Roboterendschalter
Roboterentfernungsbestimmung
Roboterentgraten
Roboterentwicklung
Roboterentwicklungsplan
Roboterentwicklungsprojekt
Roboterentwicklungsstufe
Roboterentwurf
Robotererkennungseinrichtung
Robotererkennungsproblem
Robotererkennungssoftware
Robotererkennungssystem
Roboterersatzteil
Roboterfähigkeit
Roboterfahrzeug
Roboterfamilie
Roboterfarberkennung
Roboterfehler
Roboterfehleranzeige
Roboterfehlerbeseitigung
Roboterfehlerdiagramm
Roboterfehlererkennung
Roboterfehlermeldung
Roboterfehlerrate
Roboterfehlerschutz
Roboterfehlersignal
Roboterfeinbewegung
Roboterfeinpositionierung
Roboterfertigmontage
Roboterfertigungsablauf
Roboterfertigungsprogramm
Roboterfertigungsstückzahl
robot diskette
robot display
robot rotation unit
rotation joint of robot
swivel joint axis of robot
rotating support of robot
robot compressed air line
robot duplex operation
robot turnaround time
robot dynamics
action speed of robot, robot action speed
robot effector, effector of Industrial robot
robot effector coordinates
effector magazine of robot
natural frequency of robot
robot operation, industrial robot operation, application of rob
applications of robots
industrial robot operation
robot operation
use of robots
robot input device
input power of robot
robot unit
robot equipment
applications of robots
robot operation, industrial robot operation, application of rob
robots application, industrial robots application
industrial robot operation
robot operation
use of robots
robot application condition
robot use region, use region of industrial robot
robot application characteristic
robot application component
robot operating schedule
robot application technique
robot application variant
preparation of robot use
robot classification
robot single machine
robot electronics, industrial robot electronics
robot element
robot final installation
final body of robot
limit switch of robot
robot distance identification
robot deburring, deburring by robot
robot development
robots development plan
robots development project
robot development stage
robot design, robot [hardware] construction
robot identification device
robot identification problem
robot identification software
robot identification system, IR identification system
robot spare part
capability of robot
robot vehicle
family of robots
robot colour identification
robot fault
robot error indication, fault indication of robot
robot error deletion
robot faults diagram
robot error detection, fault detection of robot
robot error message
robot error rate, fault rate of robot
robot error protection
robot error signal, industrial robot error signal
fine motion (movement) of robot
fine positioning of robot, fine positioning of industrial robot
end assembly by means of the industrial robot
robot manufacturing sequence, manufacturing sequence by m
robot manufacturing program
production rate (of robot)
stran 234 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboterfinger
robot finger
Roboterfingergelenkzahl
number of robot finger joints
Roboterfingersystem
robot finger system
Roboterfirma
company of robots
Roboterflexibilität i IR‐Flexibilität
robot flexibility, IR flexibility
Roboterflexibilitätsgrad
degree of robot flexibility
Roboterfolgeprogrammierung
robot sequential programming
Roboterfolgesteuerung
robot sequential control
Roboterfolgezustand
robot sequence state
Roboterform
robot form
Roboterformerkennung
robot form identification
Roboterforschung
robot research, industrial robot research
Roboterforschungslabor
robot research workshop
Roboterfreiheitsgrad
freedom degree of robot, freedom degree of industrial robot
Roboterfrontplatte
robot front panel
Roboterfügen
robot jointing
Roboterfügeoperation
robot Jointing operation, IR jointing operation
Roboterfügevorgang
jointing process of [industrial] robot
Roboterfühler
robot arm sensor
Roboterführung
robot guide
Roboterfunktion
robot function
Roboterfunktionskriterien
robots functional criteria
Roboterfunktionsmöglichkeit
robot operating possibility
Roboterg reif kraft
robot grip power, grip power of industrial robot
robotergebundene Einrichtung
robot‐attached device, industrial robot‐attached device
robotergebundenes Werkzeug
robot‐attached tool, industrial robot attached tool
robotergeführte Spritzpistole
robot‐guided spray gun
robotergeführter Greifer
robot‐guided gripper
Robotergehäuse
robot case
Robotergelenk
robot joint
Robotergelenkbewegung
robot joint movement
Robotergelenkeinheit
robot joint unit, IR joint unit
Robotergelenkkoordinate
robot joint coordinate
Robotergelenkspiel
robot joint clearance
Robotergelenkwinkel
joint angle of robot
Robotergenauigkeit
accuracy of robot, robot precision
Robotergeneration
robot generation, industrial robot generation
Robotergeometrie
robot geometry
Robotergerätefehler
robot device error
robotergerechte Fügeflächengestaltung
modelling of joint surface suitable to robot
robotergerechte Informationsmenge
information quantity suitable to robot
robotergerechte Konstruktion
construction suitable to robot
robotergerechte Lösung
solution according to robot
robotergerechte Produktion
production suitable to robot
robotergerechte Schweißkonstruktion
robot‐like welding construction
robotergerechter Entwicklungsprozess
development process suitable to robot
robotergerechtes Konstruieren
construction suitable to robot
robotergerechtes Verbindungselement
linkage element according to robot
Robotergesamtsystem
total system of robot
Robotergeschwindigkeit t IR‐Geschwindigkeit
robot speed, industrial robot speed
Robotergestaltung
robot portrait
Robotergestell
robot frame
Robotergestellelement
robot frame element, frame element of industrial robot
Robotergestellsystematik
robot frame systematics
robotergesteuerter Prozess
robot‐controlled process
robotergestützte automatische Montage
robot‐aided automatic assembly
Robotergetriebe
robot gear
Robotergetriebeplan
robot gear plan
Robotergewicht
robot weight
Robotergewichtsdaten pi
robot weight data
Robotergleitgelenk
sliding joint of robot
Robotergravitationskraft
gravitational force of robot
Robotergreifer
robot gripper, industrial robot gripper
Robotergreiferführung
robot gripper guide, industrial robot gripper guide
Robotergreiferhandform
shape of robot gripper hand
Robotergreiferorientierung
gripper orientation of robot
Robotergreifersystem
robot gripper system
Robotergreifertyp
robot gripper type, industrial robot gripper type
Robotergreifkontrolle
grip checking of robot
Robotergreiforgan
robot grip organ
Robotergreifsystem
robot grip system
Robotergrobbewegung fr Grobbewegung eines Montagerobot gross motion of robot, gross movement of assembly robot
Robotergrobposition
coarse position of robot, coarse position of industrial robot
Robotergrundbauelemente
robot basic elements
Robotergrundbaugruppe
robot basic unit
Robotergrundbewegung
robot base movement
stran 235 od 326
EN ‐DE: slovar avtomatizacije in robotike Robotergrundplatte
robot base plate
Robotergrundstruktur
basic structure of robot
Roboterhaltevorrichtung
robot support, support of industrial robot
Roboterhaltezange
robot gripping pliers
Roboterhand
robot hand
Roboterhand mit drei Freiheitsgraden
robot hand with three degrees of freedom
Roboterhand mit elastischen Fingern
robot hand with elastic fingers
Roboterhandantrieb
hand drive of robot
Roboterhandfinger
finger of robot hand
Roboterhandgelenk
hand Joint of [industrial] robot
robot handling time, handling time of IR
Roboterhandhabezeit f. Handhabezeit feines IR
Roboterhandhabungsprozess
robot handling process
Roboterhandprothese
robot hand prosthesis
Roboterhardware
robot hardware, IR hardware
Roboterhardwarekonstruktion
robot design, robot [hardware] construction
Roboterhardwarelösung
[industrial] robot hardware solution
Roboterhardwarelösung
robot hardware solution, industrial robot hardware solution
Roboterhardwarestruktur
robot hardware structure
Roboterhauptachse
principal axis of robot
Roboterhauptbaugruppe
robot main group of parts, industrial robot main group of part
Roboterhaupttechnologien
main robots technologies, main technologies of robots
Roboterhersteller
producer of robots
Roboterherstellungsprogramm
robot manufacturing program
Roboterherstellungswerk
producer of robots
Roboterhintergrundrechner
robot background computer
Roboterhubeinheit
robot stroke unit
Roboterindustrie
industry of robots
Roboterinformation
robot information
Roboterinformationsaufnahme
robot information recording
Roboterinformationselektronik
robot information electronics
Roboterinformationsfluss
robot information flux, industrial robot information flux
Roboterinformationsverarbeitung
robot information processing
Roboterinformationsverarbeitung
robot information processing, IR information processing
Roboterinitiator (Positionsgeber)
robot cam (position indicator)
Roboterinspektionssystem
robot inspection system
Roboterinstallation
robot installation, industrial robot installation
Roboterinstallationsrentabilität
profitability of robots installation
Roboterinstruktion
robot instruction
Roboterintegration
robot integration
roboterintegrierte technologische Einheit
robot‐integrated technological unit
roboterintegriertes Bearbeitungssystem
robot‐integrated treatment system
roboterintegriertes Montagesystem
robot‐integrated assembly system
Roboterintelligenz
robot intelligence
roboterinterner Temperaturregler
robot‐intern temperature regulator
roboterinternes Messgerät
measuring device inserted into robot
roboterisierte (durch Roboter ausgeführte) Arbeitsgänge
operations executed by robots
roboterisiertes Formelement
roboterized form element
Roboterisierung
robotization
Roboteristerung
robotization
Roboterkartensteuerung
card for robot control
Roboterkassetteneinrichtung
device of robot cassette
Roboterkategorie
robot category
Roboterkategorienbestimmung
designation of robot category
Roboterkennwerte
robot parameters, robot data, data of industrial robot
Roboterkennzeichnung
robot marking, industrial robot marking
Roboterkinematik
robot kinematics
roboterkinematisches Problem
robot‐kinematic problem
Roboterklassifikation
robot classification
Roboterklassifizierung
robot classification
Roboterknickarmbewegung
buckling arm movement of robot
Roboterkollisionsbedingung
robot collision condition
Roboterkollisionsraum
collision room of robot, robot collision room
Roboterkollisionsschutz
robot collision protection, industrial robot collision protection
Roboterkombination
combination of robots
Roboterkomplexibilität
robot complexibility, IR complexibiiity
Roboterkonfiguration
robot configuration
Roboterkonstruktion
robot construction, industrial robot construction
Roboterkonstruktion
robot design, robot [hardware] construction
Roboterkonstruktion mit mikrorechnerunterstütztem reißbrerobot construction with microcomputer‐aided and drawingbo
Roboterkonstruktionsbüro
engineering office for robots
Roboterkontrolle
robot checking], industrial robot check[ing]
Roboterkontrollschirm
checking screen of industrial robot, check screen of industrial Roboterkontrollsteuerungssystem
robot checking control system
Roboterkontrollsystem
checking system of robot, check system of robot
Roboterkoordinaten
robot coordinates, industrial robot coordinates
Roboterkoordinatenachse
robot axis of coordinates
stran 236 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboterkoordinatenberechnung
Roboterkoordinatentransformation
Roboterkopplung
Roboterkorrekturdaten pl
Roboterkraft
Roboterkraftbestimmung
Roboterkraftmessdose
Roboterkraftsensor
Roboterkundendienst
Roboterlage
Roboterlageerkennung
Roboterlagerung
Roboterlayout
Roboterlebensdauer
Roboterleistung
Roboterleistungsaufnahme
Roboterleistungselektronik
Roboterleistungsfluss
Roboterlösung
Robotermagazin
Robotermakrobewegung
Robotermarkt
Roboter‐Maschinen‐System
Roboter‐Maschinen‐Zusammenarbeit
Robotermaterial
Robotermatrizenauswertung
Robotermechanik
Robotermehrzweckgreifer
Robotermerkmal
Robotermesseinrichtung
Robotermessposition
Robotermesswert
Robotermikroprozessor
Robotermikroprozessorsteuerung
Robotermikrorechner
Robotermodell
Robotermodellierung
Robotermodernisierung
Robotermodul
Robotermodulbaustein
Robotermonitor
Robotermontage
Robotermontage
Robotermontage einer Baugruppe
Robotermontageablauf
Robotermontagearbeitsplatz
Robotermontagebahn
Robotermontagebewegung
Robotermontageebene
Robotermontagefähigkeit
robotermontagegerechte Darstellung
robotermontagegerechte Information
robotermontagegerechte Produktionskonstruktion
robotermontagegerechte Strategie
robotermontagegerechtes Bauelement
robotermontagegerechtes Fügen
Robotermontagegraph
Robotermontagekonzept
Robotermontagekosten pl
Robotermontageoperation
Robotermontageorganisation i
robotermontageorientierte Bewertung
Robotermontageplanung
Robotermontageproblem
Robotermontageprozess
Robotermontagerichtung t Richtung einer Robotermontage
Robotermontagestation
Robotermontagesystem
Robotermontageversuch
Robotermontagezeit
Robotermontagezustand
Robotermontagezyklus
robotermontangegerechter Standard
Robotermonteur
robotermontierte Lichtmaschine
robotermontierte Maschine
robot coordinates calculation
robot coordinates transformation
robot coupling
robot correction data
robot force
robot force identification
robot force measuring gage
force sensor of industrial robot
robot servicing, robot maintenance, IR servicing, robots servic
robot position
robot position identification, robot position distinguishing
support of robot
layout of an industrial robot
life of robot
robot performance, robot power
power input of robot
robot power electronics
robot power flux, industrial robot power flux
robot solution
robot magazine, magazine of industrial robot
robot macro‐movement, macro‐movement of industrial robot
robot market, industrial robot market, IR market
robot‐machine system
robot‐machine cooperation
robot material
matrix evaluation of robot
robot mechanics
general‐purpose gripper of robot
robot feature
robot measuring device
measuring position of robot
robot measuring value
microprocessor of [industrial] robot
microprocessor control of industrial robot
robot microcomputer
robot model
robot modeling
modernization of robots
module of robot
robot module element
monitor of robot
robot mounting, robot assemblage, industrial robot mounting,
robot assembly
robot assembly mounting
robot assembly sequence, mounting sequence by means of the
montage station of robot, working station of robot
robot assembly path
robot mounting motion, industrial robot mounting motion
plane of robot assembly
capacity of robot assembly
representation suitable to robot assembly
information suitable to robot
production construction suitable to robot assembly
strategy suitable to robot assembly
component suitable to robot assembly
jointing suitable to robot assembly
robot montage graph
robot assembly draft
robot assembly costs
robot assemblage operation, IR assemblage operation
robot assembly organization
valuation oriented on robot assembly
robot mounting planning, robot assembly planning
assembly problem of [industrial] robot
robot assembly process
robot assembly direction
robot assembly station
robot assembly system
robot assembly test, industrial assembly test
time of robot assembly
assembly state of [industrial] robot
robot assembly cycle, industrial robot mounting cycle
standard suitable to robot assembly
robot fitter
robot‐assembled dynamo
robot‐assembled machine
stran 237 od 326
EN ‐DE: slovar avtomatizacije in robotike robotermontierte Scheibe
robotermontierte Verschraubung
robotermontierte Welle
robotermontierter Kühlschrank
robotermontierter Motor
robotermontierter Staubsauger
robotermontiertes Fahrzeug
robotermontiertes Gehäuse
robotermontiertes Kugellager
Robotermotor
Robotermustererkennung
Robotermusterfunktion
Roboternachlaufsystem
Roboternäherungssensor
Roboternebenstation
Roboternietung
Roboternocken
Roboter‐Not‐Aus‐Taster
Roboternotschalter
Roboternutzen
Roboternutzungsfaktor
Roboterobjekt
Roboterobjekterfassung
Roboterobjekterkennung
Roboterobjektmasse
Roboterobjektspeicher
Roboteroperationsgenauigkeit
Roboteroperationsgeschwindigkeit
Roboter‐Operationskette
Roboteroperationskriterien
Roboteroperator
Roboteroperatorenfolge
Roboteroptimierung
Roboteroptimierungsrechner
Roboterordnungseinrichtung
Roboterorientierung
Roboterorientierungskode
Roboterpalette
Roboterparameter
Roboterpatent
Roboterperipherie
Roboterpilotanlage
Roboterplatzbedarf
Roboter‐Playback
Roboterporträt
Roboterposition
Roboterpositioniereinrichtung
Roboterpositionierfehler
Roboterpositioniergenauigkeit
Roboterpositionierung
Roboterpositionierungssystem
Roboterpositionierzeit
Roboterpositionsabweichung
Roboterpositionsanzeige
Roboterpositionsdaten pl
Roboterprobebewegung
Roboterprobebewegung r*
Roboterproblem
Roboterproblemprogrammierung
Roboterproblemtechnik
Roboterproduktionskosten pi
Roboterproduktivität
Roboterproduktmontage
Roboterproduzent
Roboterprogramm
Roboterprogrammänderung
Roboterprogrammausgabe
Roboterprogrammgenerierung
Roboterprogrammiereigenschaft
Roboterprogrammierer
Roboterprogrammierlauf
Roboterprogrammiersystem
Roboterprogrammierung
Roboterprogrammierung in natürlicher Sprache
Roboterprogrammierungsfehler
Roboterprogrammierungsmethode
robot‐assembled disk
robot‐assembled screw cap
robot‐assembled shaft
robot‐assembled refrigerator
robot‐assembled motor
robot‐assembled vacuum cleaner
robot‐assembled vehicle
robot‐assembled housing
robot‐assembled ball bearing
robot motor
robot master identification
robot pattern function
robot follow‐up system
robot proximity sensor
slave station of robot, robot slave station
robot riveting, riveting by means of the industrial robot
robot cam (position indicator)
off‐emergency of industrial robot
emergency switch (of industrial robot)
robots gain
working factor of industrial robot
robot object
robot object registration
robot object recognition
robot object mass, industrial robot object mass
robot object memory
operation accuracy of robot
operation speed of robot
robot operation chain, IR‐operation chain
robot operational criteria
robot operator
robot operator sequence, operator sequence of industrial robo
robot optimization
computer of robot optimization
robot order device
robot orientation
robot orientation code
pallet of robot
robot parameters, robot data, data of industrial robot
robot patent
robot periphery, IR periphery
robot pilot plant
robot floor space required, IR floor space required
robot play‐back
robot portrait
robot position
robot positioning device, industrial robot positioning device
robot positioning error
robot positioning accuracy, industrial robot positioning accura
robot positioning
robot positioning system
robot positioning time
robot position deviation
position indication of IR
position data of robot
robot testing movement
robot testing movement
robot problem
programming of robot problems
robot problem technique
robot manufacturing costs
productivity of robots, efficiency of robots
robot product assembly
producer of robots
robot program, industrial robot program
modification of robot program
robot program output
robot program generation
robot programming property
robot programmer, industrial robot programmer
robot programming pass
robot programming system
robot programming
robot programming in natural language
robot programming fault
robot programming method
stran 238 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboterprogrammierungsproblem
Roboterprogrammierungssprache
Roboterprogrammkode
Roboterprogrammkodierung
Roboterprogrammkompatibilität
Roboterprogrammoperator
Roboterprogrammpaket
Roboterprogrammschritt
Roboterprogrammspeicherung
Roboterprogrammsteuerung
Roboterprogrammsteuerungssystem
Roboterprogrammsteuerungssystem robot
Roboterprogrammsystem
roboterprozessflexible Lösung
roboterprozessflexible Montage
roboterprozessflexibler Automat
roboterprozessflexibles Montagesystem
roboterprozessflexibles System
Roboterprozessinformation
Roboterprozessinformation
Roboterprozessor
Roboterprozessrechner
Roboterprüfeinrichtung
Roboterprüfprogramm
Roboterpunktsteuerung
Roboterraum
Roboterraumbahn
Roboterraumkurve
Roboterreaktionsfähigkeit
Roboterrechner
Roboterrechnerarchitektur f
Roboterrechnerdaten pl
Roboterrechneroperation
Roboterrechnerperipherie
Roboterrechnersteuerung
Roboterrechnersystem
Roboterreferenzpunkt
Roboterregel System
Roboterregelabweichung Roboterregelalgorithmus
Roboterregelsystem
Roboterregelung
Roboterregelungstechnologie
Roboterregelungstechnologie
Roboterregler
Roboterregler
Roboterreglersystem
Roboterreibungskräfte
Roboterrentabilitätsproblem
Roboterreparatur
Roboterrepetierbarkeit
Roboterresolver
Roboterrotationsachse
Robotersatznummer
Roboterschaltbrett
Roboterschaltelement
Roboterschaltinformation
Roboterschaltschrank
Roboterschalttafel
Roboterschleifen
Roboterschlitten
Roboterschnittstelle
Roboterschraubendreher
Roboterschraubverbindung
Roboterschrittmotor
Roboterschubbewegung
Roboterschubgelenk
Roboterschultergelenk
Roboterschweißbrenner
Roboterschweißen
Roboterschwenkeinheit
Robotersensor
Robotersensordaten pl
Robotersensorik
Robotersensorinformation
Robotersensorsteuerung
robot programming problem
robot programming language
robot program code
robot program coding
compatibility of robot program
robot program operator
program pack of robot
robot program step, program step of robot
robot program storage, 1R program storage
robot program control
robot program control system
robot program control system
robot program system, industrial robot program system
process‐flexible solution by robots
process‐flexible assemblage by robots
process‐flexible automaton by robots
robot process flexible assembly system
process‐flexible system by robots
robot process information
robot process information, IR process information
robot processor
robot process computer
robot test equipment
checking program of robot, checking program of industrial rob
point‐to‐point control of robot
robot space
robot space path
robot space curve
robot reactivity
robot calculator, industrial robot calculator
architecture of robot computer
computer data of [industrial] robot
operation of robot computer
periphery of robot computer
robot computer control
robot computer system
robot reference point
robot regulating system, industrial robot regulating system
robot control deviation robot regulating algorithm
[industrial] robot regulating system
robot regulation
robot regulating technology
robot regulating technology, IR regulating technology
[industrial] robot regulator
robot regulator, industrial robot regulator
robot control system
frictional forces of robot
problem of robots profitability
robot repair
repeatability of robot, reproducibility of robot
robot resolver
rotation axis of [industrial] robot
robot record number
robot control panel
robot switching element
robot switching information
robot control cabinet
robot control panel
robot grinding, grinding by robot
robot sled, robot carriage
robot interface
robot screw driver
robot screwed connection
robot stepping motor
robot sliding movement, thrust movement of robot
sliding joint of robot
shoulder joint of robot
welding torch of robot
welding by means of robot, welding by using of robot, robot w
robot swivel unit
robot sensor, industrial robot sensor
sensor data of [industrial] robot
robot sensorics
information of robot sensor
robot sensor control
stran 239 od 326
EN ‐DE: slovar avtomatizacije in robotike Robotersensorsystem
Roboterservice
Roboterservoregler
Robotersicherheitsraum
Robotersichtsteuerung
Robotersichtsystem
Robotersignal
Robotersoftware
Robotersoftwarestruktur
Robotersoftwarezentrum
Robotersoli wert
Robotersollposition
Roboterspachsyntax
Roboterspanneinrichtung
Roboterspannelemente
Roboterspeicher
Roboterspeicher
Roboterspeicher
Roboterspeichereinrichtung
Roboterspeicherplatz
Roboterspeicherstation
Roboterspeichertest
Roboterspezialwerkzeug
roboterspezifische Anweisung
roboterspezifische Sprache
roboterspezifischer Antrieb
roboterspezifischer Befehl
Robotersprachprozedur
Robotersprachsemantik
Roboterspritzkabine
Roboterspritzkopf
Roboterstandard
Roboterstandardbahn
Roboterstandort
Roboterstapelung
Roboterstapelverfahren
Roboterstartposition
Roboter‐Start‐Stopp‐Taster
Roboterstation
Roboterstellglieder npt
Roboterstellsignal
Robotersteuer kreis
Robotersteueraggregat
Robotersteueralgorithmus
Robotersteuerband
Robotersteuerdiskette
Robotersteuereinheit
Robotersteuereinheit
Robotersteuereinheit
Robotersteuerelektronik
Robotersteuerfunktion
Robotersteuergerät
Robotersteuergerät
Robotersteuergerät
Robotersteuerimpuls
Robotersteuerinformation
Robotersteuerknüppel
Robotersteuerkraft
Robotersteuerprogramm
Robotersteuersignal
Robotersteuersprache
Robotersteuertastatur
Robotersteuerumfang
Robotersteuerung
Robotersteuerung
Robotersteuerung mittels programmierbarer Automaten
Robotersteuerung mittels programmierbarer Automaten
Robotersteuerung mittels Steuerknüppels
Robotersteuerungsart
Robotersteuerungseingabe
Robotersteuerungsfunktion
Robotersteuerungsgehäuse
Robotersteuerungskorrektur
Robotersteuerungsoperation
Robotersteuerungsstrategiealgorithmus
Robotersteuerungssystem
robot sensor system
robot servicing, robot maintenance, IR servicing, robots servic
robot servo regulator
safety room of robot, robot safety room
robot vision control
robot visual system
robot signal, signal of industrial robot
robot software, IR software
robot software structure
robot software centre
robot nominal value
nominal position of robot
robot language syntax
robot clamping device
robot chucking elements
robot memory, robot store, IR memory, IR store
robot memory
robot store
robot storage device, industrial robot storage device
robot memory place
robot memory station, industrial robot memory station
storage test of robot
robot special tool
robot‐specific instruction
robot‐specific language
robot‐specific drive
robot‐specific instruction
robot language procedure
robot language semantics
robot spray chamber
extruder head of industrial robot
robot standard
robot standard path
location of robot, place (position) of robot
robot blocking
robot stack process
start position of robot
start‐stop probe of (industrial] robot
robot station, industrial robot station
robot final control elements
robot actuating signal
robot control circuit
robot control aggregate
robot control algorithm
control tape of [industrial robot
control diskette for robots
robot control unit, control unit of industrial robot
robot control unit
control unit of industrial robot
electronics of robot control
robot control function, IR control function
robot control unit, control unit of industrial robot
robot control unit
control unit of industrial robot
robot control impulsion
robot control information
control column of robot
robot control force
robot control program
robot control signal
robot command language, IR command language
robot control keyboard
robot control circumference
robot control
robot control, industrial robot control
robot control by means of programmable
robot control by means of programmable automatons
actuating rod for robot control, robot control by means of the control kind of industrial robot
robot control input
robot control function, IR control function
robot control case
robot control correction
robot control operation, control operation of IR
algorithm of robot control strategy
control system for robots
stran 240 od 326
EN ‐DE: slovar avtomatizacije in robotike Robotersteuerungstechnologien
Roboterstiftmontage
Roboterstillstandszeit
Roboterstromversorgung
Roboterstruktur
Roboterstrukturgewicht
Roboterstudie
Roboterstudie
Roboterstufe
Robotersuchposition
Robotersuchzeit
Robotersyntheseprogramm
Robotersystem zum Stofftransport
Roboterszene
Robotertaktsignal IR‐Taktsignal
Robotertaktzeit
Robotertechnik
Robotertechnik
Robotertechnik
Robotertechniker
robotertechnischer Komplex
Robotertechnologie
Roboterteilmontage
Roboterteilsystem
Robotertemperaturbestimmung
Robotertest
Robotertisch
Robotertisch m. Tisch eines Industrieroboters
Roboterträger
Roboter‐träger
Robotertragfähigkeit
Roboterträgheitsmatrix
Robotertrajektorie
Robotertrajektorie
Robotertrajektorieplanung
Robotertranslationsachse
Robotertyp
Robotertypenzahl
Roboterübernahmepunkt
Roboterübertragungselement
Roboterüberwachung
Roboterüberwachungssystem
Roboterumgebung
Roboterumprogrammierung
Roboterumwelt
Roboterumweltdaten pl
roboterunabhängige Komponente
Roboteruniversalprogrammierer
Roboterunterarm
Roboteruntermontage
roboterunterstützte Montageeinrichtung
Roboteruntersuchung
Robotervariante
Roboterverbindungsglieder
Roboterverfügbarkeit
Roboterverhalten
Roboterverschraubung
Roboterversuch
Roboterverteilung
Roboterwachstumsrate
Roboterwagen
Roboterwandbefestigung
Roboterwartung
Roboterweginformation
Roboterwegmesssystem
Roboterweltkoordinaten
Roboter‐Weltkoordinatentransformation
Roboterwerkzeug
Roboterwertetabelle
Roboterwinkelgeschwindigkeit
Roboterwirkleistungsrelais ft
Roboterwirkzone
Roboter‐X‐Achse
Roboter‐Y‐Achse
Roboterzählertest
Roboterzentrifugalkraft
control technologies for robots
robot pin assembly (mounting)
robot idle time
robot power supply
robot structure, industrial robot structure
robot structure weight
robot study
robot study, industrial robot study
stage of robot
robot search position, search position of IR
search time of robot
robot synthesis program
robot system for cloth (fabric) transport
robot scene, scene of industrial robot
robot cycle signal, industrial robot cycle signal
robot cyclic time, cyclic time of IR
robotics, industrial robot[s] technique
robotics
industrial robot[s] technique
robot technician
robot‐technical complex
robot technology
robot submounting
partial system of robot, partial system of industrial robot, robo
robot temperature identification
robot test
robot table, industrial robot table
robot table, industrial robot table
robot support, support of industrial robot
robot support, support of industrial robot
robot load‐carrying capacity, industrial robot load‐carrying ca
inertia matrix of robot
robot trajectory
robot movement path, robot trajectory, industrial robot trajec
robot trajectory planning
translation axis of [industrial] robot
robot type, industrial robot type
robot type number, type number of robot
robot transfer point
robot transmission element
robot supervision
robot supervision system
robot environment
robot reprogramming, industrial robot reprogramming
robot environment
environment data of robot
robot‐independent component
universal programmer for robots
forearm of robot, robot fore‐
robot submounting
robot‐assisted assembly device
robot investigation
robot variant
robot connecting joints
availability of industrial robot
robot performance
robot bolting, industrial robot bolting
robot test
repartition of robots
robot rate of growth
robot vehicle
wall mounting of robot
robot servicing, robot maintenance, IR servicing, robots servic
robot path information
robot path measuring system, industrial robot path measuring
robot world coordinates
transformation of robot world coordinates
robot tool, industrial robot tool
robot value table
angular velocity of robot
active power relay of robot
active region of robot
X‐axis of [industrial] robot
Y‐axis of [industrial] robot
counter test of robot
centrifugal force of robot
stran 241 od 326
EN ‐DE: slovar avtomatizacije in robotike Roboterzentrum
Roboterziel zustand
Roboterzielposition
Roboterzubringereinrichtung
Roboterzuführung
Roboterzusatz Prozessor
Roboterzusatzfunktion
Roboterzustand
Roboterzustandsraum
Roboterzustandssignal
Roboterzuteileinrichtung
Roboterzuverlässigkeit
Roboterzwischen punkte
Roboterzyklus
Robotik
Robotik
Robotik
Robotikprobleme
Robotiksystem
robotisierte Handhabung
robotisierte Montage
robotisierte Qualitätskontrolle
robotisierte Speicherung
robotisierter Zusammenbau
robotisiertes Kontrollsystem
robotisiertes Montagesystem
Robotisierung
Robotisierung von Arbeitsplätzen
Robotisierung von Farbgebungen
Robuste Regelung
Röhrenarm
Rohrleitungsdurchflussmesser
Rohrleitungssystem
Rollen eines Softgreifers
Rollenführung
Rollenführung feines Greifers
Röntgenbeugungs‐Phasenanalyse
Röntgenstrahlenbeugung
Röntgenstrahlenfluoreszenzspektrometer
Röntgenstrahlkontrolle
Rotationsachse
Rotationsachse eines Greifers
Rotationsachse feines Industrieroboters
Rotationsdruckluftmotor
Rotationseinheit
Rotationsgeschwindigkeit eines Roboters
Rotationssensor
rotationssymmetrisches Werkstück
Rotationsteil
Rotationsviskosimeter
Rotationszentrum
rotatorische Backenbewegung
rotatorische Greiferbewegung
rotatorische Robotergrundbewegung (IR‐Grundbewegung)
rotatorischer Antrieb eines Manipulators
rotatorischer Greifer
rotatorischer Greiferantrieb
rotatorischer Inkrementalgeber
rotatorischer Manipulatorantrieb
rotatorischer Positionierantrieb
rotierender Effektor
ROUTH‐Kriterium
Routhsche Ungleichung
Routhsches Kriterium
ROUTH‐Tafel
Routinekontrolle
Routineoperation
Routineoperationen
Rück[kopplungs]kanal
Rückanzeige
Rückführgröße
Rückführgröße
Rückführübertragungsfunktion
Rückführübertragungsfunktion
Rückführung
Rückführung
robot centre, industrial robot centre
robot target state
target position of robot
robot feed device, industrial robot feed device
robot feeding, industrial robot feeding
companion processor of robot, auxiliary processor of robot
robot additional function
robot state
robot state space
state signal of robot
robot distribution device
robot reliability
intermediate points of robot
robot cycle, IR cycle
robotics, industrial robot[s] technique
robotics
industrial robot[s] technique
robotic problems
robotic system
robotized handling
robotized assemblage
robotized quality checking
robotized storage
robotized assemblage
robotized checking system
robotized assemblage system
robotization
robotization of workplaces
robotization of paintings
robust control system
tube arm
pipeline flowmeter
pipeline system
Soft gripper rolls, rolls of soft gripper
roll guide
roll guide of gripper, gripper roll guide
X‐ray diffraction phase analysis
diffraction of X‐rays
X‐ray fluorescence spectrometer
X‐ray control
rotation axis
gripper rotation axis
rotation axis of [industrial] robot
rotation air motor, rotation pneumatic motor
rotation unit
rotation speed of robot
rotation sensor
rotationally symmetrical rotation part
rotational viscosimeter
rotation centre
rotatoric jaw movement
rotatoric gripper movement
rotatoric base movement of [industrial] robot
rotatoric manipulator drive
rotatoric gripper
rotatoric gripper drive
rotatoric incremental sensor
rotatoric manipulator drive
rotatoric positioning drive
rotary actuator
ROUTH's stability criterion
Routh inequality
Routh criterion
ROUTH array
routine control
routine operation
non‐productive operations
feedback channel
back indication
feedback variable
variable feedback
inverse transfer function
return transfer function
feedback
back‐coupling
stran 242 od 326
EN ‐DE: slovar avtomatizacije in robotike Rückführung
Rückführung des pneumatischen Antriebes
Rückführungselemente
Rückführungskoeffizient
rückführungsloses Steuersystem Rückführungsschaltung
Rückführungsschleife
Rückführungsschleife
Rückführungsschleife (einer Robotersteuerung)
Rückgang
Rückgang
Rückgang
Rückgang
rückgängig erstellen
rückgängig machen
rückgängige Wirkungen Rückgangswert
rückgeführtes Signal
rückgekoppelter Impulsgenerator
rückgekoppeltes Schieberegister
rückgestreute Leistung
rückgestreutes Signal
Rückkehr
Rückkehrzeichen
rückkoppelnd
Rückkopplung
Rückkopplung
Rückkopplung
Rückkopplungsbedingung
Rückkopplungsbegrenzer
Rückkopplungscharakteristik
Rückkopplungsdetektor
Rückkopplungseinstellung
Rückkopplungskondensator
Rückkopplungsleitung
Rückkopplungsregelung
Rückkopplungsregler
Rückkopplungsregleranlage
Rückkopplungsschaltung
Rückkopplungssensor
Rückkopplungsspannungsverhältnis
rückkopplungsstabilisierter Gleichrichter
rückkopplungsstabilisierter Verstärker
Rückkopplungssteuerungssystem
Rückkopplungsverstärker
Rückkopplungsverzerrung
Rückkopplungsverzögerung feedback limiter 270
Rückkoppungseffekt
Rücklauf
Rücklauf
Rücklauf
Rücklauf
Rücklaufimpulse
Rücklaufrichtung
Rücklaufübertrag
Rückleistungsrelais
Rückmeldebefähigung
Rückmeldebefähigung
Rückmeldepriorität
Rückmeldung eines Roboterbefehls
Rückmeldungssteuerung
Ruckmesser
Rückschlagventil
Rückschlagventil
Rückschreibimpuls
Rücksetzanweisung
Rücksetzzeichen
Rücksprung
Rückstellautomat
Rückstellimpuls
Rückstellkonstante
Rückstellkreis
Rückstellmoment
Rückstellung
Rückstellung von Hand
Rückstellvorgang
inverse coupling
pneumatic drive feedback
feedback elements
feedback factor
unmonitored control system closed‐loop circuit
control loop
feedback loop
feedback loop (of robot control)
back stroke
reversed motion
return trace
reverse run
undo v undo v undoing actions resetting value
feedback signal
regenerative pulse generator
feedback shift register
backscattered power
backscattering signal
return
backspace character, BS
regenerative
back‐coupling
feedback
inverse coupling
back‐coupling condition
feedback limiter
backward transfer characteristic
regenerative detector
feedback adjustment
feedback capacitor
back‐coupling connection
feedback control
feedback controller
feedback control system
feedback circuit
feedback sensor
feedback voltage ratio
feedback‐regulated rectifier
feedback‐stabilized amplifier
feedback control system
regenerative amplifier
distortion due to feedback
feedback lag
back‐coupling effect
back stroke
reversed motion
return trace
reverse run
flyback pulses
reverse direction
end‐around carry
reverse‐power relay
acknowledge enable
acknowledge enable, ACE
acknowledgement priority
answerback of robot instruction
acknowledge control, ACC
jerkmeter
non‐return flap
non‐return valve
half‐write pulse
backspace statement
backspace character, BS
return
push‐down automaton
reset pulse
control constant
reset circuit
restoring torque
reset[ing]
manual reset adjustment
recovery procedure
stran 243 od 326
EN ‐DE: slovar avtomatizacije in robotike Rückstreuanalyse
Rückstreumesseinrichtung im Zeitbereich
Rückstreumessung
Rückstreusignal
Rückstreuung
Rückstreuungscharakteristik
Rückstreuungsverlauf
Rückstreuvorgang
Rückstrom
Rückstrom
Rückstromprinzip
Rückstromprinzip
Rücktrieb
Rückvermischungsreaktor
rückwärtige Differenzen
Rückwärtsdifferenz
rückwärtsgenommene Differenzen
Rückwirkungsfreiheit
Rückwirkungsfreiheit
Rückwirkungskapazität
Rufadresse
Ruf‐Antwort‐System
Rufaufzeichnung
Rufbefehl (eines Roboterprogramms)
Rufsignal
Rufverteiler
Ruhebelastung Ruhebereich
Ruhedruck
Ruhekontakt
Ruhekontakt
Ruhekontakt
Ruhekontakt
Ruhekontakt
Ruhekontakt
Ruhekontakt
Ruhelage
Ruhephase des Robotersteuerungssystems
Ruhephase eines Manipulatorsystems
Ruhephase eines Manipulatory stems
Ruhephase eines Roboters
Ruhestellung
Ruhestrom
Ruhestromauslöser
Ruhestromschaltung
Ruheträgermodulation
Ruhewert
Ruhezustand
Rundtischantrieb
Rundtischlagerung
Rundungsfehler
Rundungsmessgerät
RUNGE‐KUTTA‐Verfahren
Sägezahnstromgenerator
Sägezahnumwandler
Saitengeber
Saitengeber
Sammelaufzeichnung
Sammelektrode
Sammelektrode
Sammelganggeschwindigkeit
Sammelruf
Sammelschaltung
Samplingkreis
Samplingoszillograf
Samplingsynchronisation
Sandstrahlen (von Werkstücken)
Satch‐Betrieb
Sattelpunkt
Sättigung
Sättigung
Sättigungsbereich
Sättigungsbereich
Sättigungsdrossel
Sättigungsgrad
Sättigungsinchtlinearität
backscattering analysis
time‐domain backscatter[ing] measuring set
backscattering measurement
backscattering signal
backscatter[ing]
backscattering response
backscattering response
backscattering process
back flow
reverse current
back‐current principle
countercurrent principle
back drive
backmix reactor
backward differences
backward difference
backward differences
absence of feedback
absence of interaction
feedback collector capacitance
call address
call‐reply system
call recording
call instruction (of robot program)
call signal
call distributor
static load[ing] non‐operation region
stagnation pressure
back contact
normal contact
rest contact
break contact
normally closed contact
normally open contact
resting contact
equilibrium point
dwell phase of robot control system
dwell phase of manipulator system
dwell phase of manipulator system
rest phase of robot, dwell phase of robot
rest position
quiescent current
rest‐current release
circuit‐opening connection
quiescent‐carrier modulation
quiescent value
quiescent state
circular table drive, rotary attachment feed gear
circular table bearing
rounding error
roundness measuring instrument
Runge‐Kutta method
saw‐tooth current generator
saw‐tooth converter
stringed transducer
vibrating wire gauge
gather write
collecting electrode
collector electrode
accumulating speed
all‐number calling, ANC
collecting circuit
sampling circuit
sampling oscillograph
sampling synchronization
sandblasting (of s)
batch mode
saddle point
saturating nonlinearity
saturation
zone of saturation
saturation zone
saturation reactor
degree of saturation
saturation non‐linearity
stran 244 od 326
EN ‐DE: slovar avtomatizacije in robotike Sättigungspegel
Sättigungsprozess
Sättigungszone
Sättigungszone
Sättigungszustand
saturiert
saturiert
Satz über die Linearität
Satzband
Satzbetrieb
Satznummereines IR‐Programms
Satzverarbeitung
Satzverarbeitungszeit
Satzverfahren
Saugergreifeinheit
Sauggreifeinheit
Sauggreifer
Saugkopf
Saugkopfmanipulator
Säuremesser
Scanner
Scanner
schadhafter Modul
Schadraumregelung
Schallanregung
Schallbrechung
Schalldispersion
Schalldruckverfahren
Schallimpedanzmessung
Schallinformation
Schallsensor
Schallsignal sonore
Schallsignal sonore
Schallwellenwiderstandsmessung
Schaltalgebra
Schaltalgebra Schaltanordnung
Schaltcharakteristik Schalteinrichtung Schalteinrichtung Schaltelement
Schaltelement
Schaltelement
Schaltelement eines Steuerungssystems
Schaltelement eines Steuerungssystems Schalter
Schalter
Schalter mit selbsttätiger Wiedereinschaltung
Schalteranordnung
Schaltfehlerschutz
Schaltfolge
Schaltfrequenz
Schaltfrequenz Schaltfunktion
Schaltfunktion
Schaltgerät
Schaltgerät
Schaltgeschwindigkeit
Schaltgeschwindigkeit
Schaltgeschwindigkeit
Schaltgeschwindigkeit von Transistoren
Schaltimpuls Schaltinformation Schaltkoeffizient Schaltkreis
Schaltkreis
Schaltkreis
Schaltkreis für direkten Speicherzugriff
Schaltkreisanalysator
Schaltkreise für die Zeichenerkennung
Schaltkreisentwicklung
Schaltkreisentwurf
Schaltkreisfehler Schaltkreisgeschwindigkeit
Schaltkreislogik des Rechners
Schaltkreisrauschmesser
saturation level
saturation process
zone of saturation
saturation zone
saturation state
saturated
saturating
linearity theorem
connective
batch operation
record number of IR‐program
record processing
record processing time
batch process
suction grip unit
suction grip unit
suction gripper
suction head
suction head manipulator
acidimeter
scanner
scanning unit
faulty module
noxious clearance regulation
acoustic excitation
acoustic refraction
acoustic dispersion
sound pressure method
acoustic impedance measurement
sound information
sound sensor
audio signal
sound signal
acoustic impedance measurement
crisp logic
switching algebra order of switching
switching characteristic switchgear
switching equipment circuit element
switching element
network element
switching element of control system
switching element of control system cut‐off
cut‐off switch
automatic reclosing circuit‐breaker
switch arrangement
protective device to prevent switching errors
sequence of switches
switching frequency
switching frequency binary function
logic function
switchgear
switching equipment circuit speed
operation speed
switching speed
switching speed of transistors switching pulse switching information switching coefficient switching circuit circuit
connection diagram circuit
switching circuit for direct memory access, DMA switching cir
circuit analyzer
character recognition circuits
circuit development
design of switching circuits
switching circuit failure circuit speed
logic of the computer
circuit noise meter
stran 245 od 326
EN ‐DE: slovar avtomatizacije in robotike Schaltkreistester
Schaltkriterium
Schaltleistung eines Ausschalters
Schaltlogik Schaltmittel
Schaltplan
Schaltpunkt Schaltpunkt commutation
Schaltreihenfolge
Schaltrichtungsbedingung
Schaltschwelle Schaltsignal
Schaltstelle
Schalttafel
Schalttafel
Schalttafel
Schalttafel
Schalttafel für Glühlampensignalanlage
Schalttafeldiagramm
Schalttechnik Schalttechnologie Schalttransistor Schaltuhr
Schaltung
Schaltung
Schaltung für automatische Vorspannung
Schaltung mit Doppelverstärkung
Schaltung mit Doppelverstärkung
Schaltung mit geschlossener Schleife
Schaltungs‐ und Programmtechnik
Schaltungsabwandlung
Schaltungsanalyse
Schaltungsanalyseprogramm
Schaltungsanforderungen
Schaltungsdiagramm
Schaltungsentwicklung
Schaltungsentwurfstechnik
schaltungsinnerer Emulator
schaltungsintern
schaltungsinterne Emulation
schaltungsinterne Prüfung
Schaltungskapazität
Schaltungskenngröße
Schaltungsknotenpunkt
Schaltungskomplexität
Schaltungslogik
Schaltungsmodifizierung
Schaltungsmodul
Schaltungsoptimierung
Schaltungsparameter
Schaltungssimulation
Schaltungstechnik
Schaltungszuverlässigkeit
Schaltverzug des Leistungsschalters
Schaltwarte
Schaltweg
Schaltzyklus scharf
scharf gebündelter Strahl
scharfe Ausgangsgröße
scharfe Eingangsgröße
scharfe Logik
scharfe Menge
scharfe Relation (Beziehung)
scharfer Impuls
scharfer Wert
Schätzwert
Schautafel
Scheibenspeicher
Scheinadresse
Scheinberührungsfläche
Scheinwert
Scheinwiderstand
Scheinwiderstandsanpassung
Scheitelfaktor
Scheitelfaktor
circuit tester
trigger criterion
breaking capacity of a circuit‐breaker
switching logic circuit mean
connection diagram
switching point level change value
order of switching
direction switching condition
switching threshold switching signal circuit point
panel
control board
control panel
switch board
lamp signalling switchboard
plugging chart
switching technique switch technology (for computer devices)
switching transistor clock relay
circuit
connection diagram circuit
auto‐bias circuit
double amplification circuit
reflex circuit
closed‐loop circuit
circuit and program technique
circuit modification
worst‐case circuit analysis
circuit analysis program
circuit requirements
connection diagram
circuit development
circuit design technique
in‐circuit emulator
in‐circuit
in‐circuit emulation
in‐circuit check
circuit capacity
circuit characteristic
circuit node
circuit complexity
circuit logic
circuit modification
circuit module
circuit optimization
circuit parameter
circuit simulation
circuitry
circuit reliability
operation delay of a circuit‐breaker
control room
contact travel
switching cycle crisp
sharp beam
crisp output
crisp input
crisp logic
crisp set
crisp relation
sharp pulse
crisp value
estimated value
graph chart
slice memory
dummy address
apparent contact surface
apparent value
impedance
impedance matching
crest factor
peak factor
stran 246 od 326
EN ‐DE: slovar avtomatizacije in robotike Scheitelpunkt
Scheitelspannung
Scheitelwert
Scheitelwert
Scheitelwert des
Scheitelwert einer Wechselgröße
schematisches Modell
Schenkel einer Zangengreifeinheit
Scherensensor
Scherenzange
Schichtdickenmesser
schieben
Schieben
Schieberegister
Schiebetischantrieb
Schiebetischpalette
Schiebung der Zangengreifeinheit
Schiebung eines Greiforgans
schiedsrichtern
Schirmfaktor
Schlagen
Schlagen
Schlagen
schlecht ausgerichtete Verbindung
Schleifbearbeitung mit Roboter
Schleife
Schleifen durch Roboter
Schleifenaufbau
Schleifenindex
Schleifennetz
Schleifenregel
Schleifenstruktur
Schleifensystem
Schleifenwiderstand
Schleifenzerlegung
Schleifroboter
Schleuderwirkung
Schleuderwirkung
schließen
schließen
Schließen des Greiforgans
Schließen eines Greifers (Roboterbefehl)
Schließgeschwindigkeit (eines Greifers)
Schließkontakt
Schließkraft
Schließrelais
Schließungsimpuls
Schließungsstromstoß
Schließzeit
Schlittenbewegung
Schlittenbezugspunkt
Schlupfregler
Schlupfsteuerung mit logischem Schaltelement
Schlüsselermittlereinheit
Schlüsselermittlereinheit
schlüsselfertiges System Schlussfolgerung
Schlussfolgerungsverfahren
Schlußgleichung
Schlüssler
Schlüssler
Schlüssler
Schlußzeichenrelais conversation
Schmalband‐Breitband‐Pegelmesser
Schmalbandfrequenzbereich
Schmalbandregler
Schmalbandsignal
Schmalbandverstärker
schmale Streifengeometrie
schmaler Torimpuls
Schmallinienemission
Schmalwinkelkoordinator
Schmeizsicherung
Schmidtsches Orthonormalisierungsverfahren
Schmiedemanipulator
Schnappbetätigung
peak point
peak voltage
crest value
peak value
peak making current
amplitude of an alternating quantity
schematic model
thigh of a pincer grip unit
shearing sensor
shear tongs
coat thickness gauge
shift v
shift[ing]
shift register
receding table drive
receding table pallet
displacement of pincers
displacement of grip organ
arbitrate v
screen factor
beat[ing]
pulsing
pulsation
misaligned joint
grinding operation with robot
loop[ed] circuit
robot grinding, grinding by robot
loop structure
cycle index
loop network
loop rule
loop structure
loop dialling system
loop resistance
loop resolution
grinding robot
centrifugal efficiency
centrifugal force
close v
bar v
closing of grip organ
gripper termination, gripper closing (robot command)
closing speed (of gripper)
make contact
closing force
closing relay
make impulse
make impulse
closing time
slide movement
slide reference point
slip regulator
slip control with logical control element
code generating unit
code investigation unit
turnkey system conclusion
inference
closing equation
coder
encoder
code equipment
clearing relay
narrow‐wide band level indicateur
narrow‐band frequency range
narrow‐band controller
narrow‐band signal
narrow‐band amplifier
narrow‐stripe geometry
narrow gate pulse
narrow line emission
narrow‐angle coordinator
safety fuse
Schmidt orthonormalization
form manipulator
snap actuation
stran 247 od 326
EN ‐DE: slovar avtomatizacije in robotike Schnappeinschaltung
Schnappkontakte
Schnappschalter
Schnappschalter
Schnappschalter
Schnappwirkung
Schneckenmanipulator
Schneckenradantrieb
Schneidenankerrelais
Schneideroboter
schnell veränderliche Variable
schnellansprechender Laserstrahlenempfänger
schnellansprechendes Relais
Schnellauslöser
schnelle Auslösung
schnelle Datenübertragung
schnelle Datenübertragung
schnelle Datenübertragung
schnelle Positionierung
schnelle Roboterachsregelung
schnelle Verzögerung
Schnelleinschaltung
schneller Durchflussmesser
schneller Koinzidenzkreis
schneller Zeracker
schnelles Ansprechen von Fernsteuerungssystemen
schnelles Inversionssystem
schnelles Positionierungssystem
schnelles Signal
Schnellfilter
Schnellfolgesystem
Schnellhalt
Schnellhalt
Schnellkontakt
Schnellpositioniersystem
Schnellrechner
Schnellregelung
Schnellregler
Schnellregler
Schnellroboter
Schnellschütz
Schnellschütz
Schnellsteuerung
schnellwirkende Steuerung
schnellwirkender Koinzidenzkreis
schnellwirkender Regler
schnellwirkender Regler
schnellwirkendes Relais
Schnellwirkung
Schnellzerhacker
Schnittbild
Schnittbildoptimierung
Schnittfrequenz
Schnittfrequenz
Schnittpunkt
Schnittpunkt
Schnittstelle
Schnittstelle zwischen Roboter und Objekt
Schnittstellenbausatz
Schnittstellenbaustein
Schnittstellengestaltung
Schnittstellenkanal
Schnittstellenkenndaten pl
Schnittstellen‐Logikschaltung
Schnittstellenmodul
Schnittstellenschaltung
Schnittstellenstandard
Schnittstellen‐Steuerbaustein
Schnittstellensteuerung
Schnittstellentechnik
Schnittzahlminimierung
Schraubachse
Schraubbewegung eines Roboterantriebs
schrauben (durch Roboter)
Schraubendreher eines Roboters
Schraubenfügen
snap closing
snap‐action contacts
quick‐action switch
snap‐action switch
snap‐switch
snap action
worm manipulator
worm‐wheel drive
knife‐edge relay
cutting robot
high‐frequency variable
fast response laser receiver
fast‐acting relay
instantaneous electromagnetic release
quick release
fast data transmission
high‐data rate
high‐speed data transmission
quick positioning
quick robot axis regulation
rapid deceleration
quick‐make
fast response flowmeter
fast coincidence circuit
fast chopper
high‐speed response of remote control systems
rapid inversion system
quick positioning system
fast signal
rapid filter
high‐speed servomechanism
fast stop
rapid stop
instantaneous contact
quick positioning system
high‐speed computer
high‐speed control
quick‐acting regulator
high‐speed action controller
quick robot
high‐speed contactor
high‐breakingcapacity contactor
high‐speed control
rapid‐action control
fast coincidence circuit
quick‐acting regulator
high‐speed action controller
fast‐acting relay
snap action
fast chopper
split image
split‐image optimization
cut‐off frequency
critical frequency
intercept point
cross point
interface
interface between robot and object
interfacing kit
interface module
construction of cutting site
interface channel
interfacing characteristics
interface logic
interface module
interface circuit
interface standard
interface controller
interface control
interfacing technique
minimization of tear variables
screwed axis
screwed motion of robot drive
screw to (by robot)
robot screw driver
screw jointing
stran 248 od 326
EN ‐DE: slovar avtomatizacije in robotike Schraubenlinienabtastung
Schraubenverbindung
Schraubung eines Greiforgans
schreibender Impulszähler
schreibendes Maximumwerk
Schreiber
Schreib‐Freigabesignal
Schreibimpuls
Schreiboperation
Schreibsteuerung
Schreibtaktimpuls
Schreibwerk
schreitender Roboter
Schreitroboter
Schriftzeichenerkennung
Schriftzeichenunterscheidung
Schritt Schrittbetrieb
Schrittbetrieb
Schrittfür‐ Schritt‐Steuerung
Schrittfür‐ Schritt‐Steuerung
Schritt‐für‐Schritt‐System Schrittkorrektur einer Robotersteuerung
Schrittmacher
Schrittmotor
Schrittmotor
Schrittmotor
Schrittregelung
Schrittregelung
Schrittregler
Schrittschaltoperation Schrittschaltwerk
Schrittwähler für selbsttätige Operationen
schrittweise Addition
schrittweise Integration
schrittweise Operation
schrittweise Operation
schrittweiser Vorschub
Schrittweitenparameter
Schrittwiederanlauf
Schrittwirkung Schubachse feines IR
Schubbewegung eines Robotergreifers
Schubbewegung in Richtung der u‐Achse
Schubbewegung in Richtung der v‐Achse
Schubgelenk einer Zangengreifeinheit
Schubweg eines Greiferarms
schubweise Verarbeitung
schubweise Versorgung
Schüttfaktor
Schütz
Schutz bei Einphasenerdschluß
Schütz mit Relais
Schutz von Gleichstromfernleitungen
Schutzeinrichtung
Schutzeinrichtung
Schutzeinrichtungsbetätigung
Schutzfunktion
Schutzgaskontaktschütz
Schutzhandlung
Schutzprüfung
Schutzsystem
Schutzsystem
Schutzvorrichtung
Schutzwiderstand
schwache Kopplung
schwache Kopplung
Schwächungsgrad
Schwächungsgrad
schwankendes Signal
Schwankung einer Funktion
Schwankungen der Messgeräteanzeigen
schwarzer Kasten
Schwarz‐Weiß‐Sensor
Schwebekörperdurchflussmesser schwebende Unterbrechung
helical scanning
bolted joint, screwed connection
screw motion of grip organ
impulse recorder
maximum recording attachment
X‐Y‐recorder
write enable signal
write pulse
write operation
write control
write pulse
print unit
pedipulator, walking robot
pedipulator, walking robot
character recognition
character recognition
step single‐step mode
single‐step operation;
step‐by‐step control
stepping control step‐by‐step system step correction of robot control
pacemaker
pecking motor
stepping motor
repeat motor
step‐by‐step control
stepping control step[ping] controller
stepping switch operation stepping distributor
step selectors for automatic operations iterative addition
stepwise integration
single‐step mode
single‐step operation;
intermitted feed
incrementation parameter
step restart
step action sliding axis of IR
gripper sliding movement, robot gripper sliding movement
u‐sliding movement
v‐sliding movement
pincer sliding joint
gripper sliding route
batch processing
pulsed supply
bulk factor
contactor
single‐phase earth‐fault protection set
relay fitted contactor
protection of direct current supply lines
protection facility
protective equipment
protective equipment operation
protective function
protective gas contactor
protective action
protection check
protection system
protective system
protective equipment
protective resistance
loose coupling
weak coupling
attenuation degree
degree of attenuation
fluctuating signal
function oscillation
meter reading variations
black box
black‐and‐white sensor
suspended body flowmeter pending interruption
stran 249 od 326
EN ‐DE: slovar avtomatizacije in robotike Schwebung
Schwebung
Schwebung
Schwebungsfrequenz
Schwebungslücke
Schwebungsnull
Schwebungsnullmesser
Schweißapparat
Schweißen in Kammern mit kontrollierter
Schweißen in kontrollierter Atmosphäre
Schweißen mittels Roboters
Schweißnaht
Schweißroboter
Schweißroboter für Lichtbogenschweißtechnik
Schweißroboter‐Bewegungszyklus
Schweißroboterpositionierung Schweißteil
Schweißteilaufnahme
Schweißung mit pulsierendem Laser
Schweißverfahrenautomatisierung
Schweißwerkzeug
Schweißwerkzeugführung
Schweißzange
Schweißzangeneffektor
Schwellendetektor Schwelleneffekt
Schwellenempfindlichkeit
Schwellenfeld
Schwellenfrequenz
Schwellenfunktion
Schwellennetzwerk
Schwellensignal
Schwellenwert Schwellspannung
Schwellwertgeber
Schwellwertgeber
Schwellwertlogik
Schwellwertschaltung Schwenkachse
Schwenkarmmanipulator
schwenkbare Schubachse eines IR
schwenkbarer Sensor
Schwenkbereich
Schwenkbewegung eines Greifers
Schwenkeinheit
Schwenkeinheit eines Industrieroboters
Schwenkeinheit feines Industrieroboters
Schwenkeinheit mit Linearantrieb
schwenken
Schwenkkontaktgeschwindigkeitsregler
Schwenkmanipulator
Schwenkmechanismus
Schwenkmodul
Schwenkvorrichtung
Schwerindustrieroboter
Schwerkraftberichtigung
Schwerkraftbeschleunigung
Schwerkraftbeschleunigung
Schwerkraftförderer
Schwerpunkt der größten Fläche
Schwerpunktermittlung
Schwerpunktmethode
Schwerpunktmethode
Schwerpunktmethode
Schwerpunktsummenmethode
Schwierigkeitsgrad
Schwimmerdruckmesser
Schwimmerdurchflussmesser
Schwimmerhöheregelungsgeber
schwimmerloser Niveauregler
Schwimmermanometer
Schwimmregelung
Schwimmregelung
Schwimmspannung
Schwingeinrichtung
schwingen
beat[ing]
pulsing
pulsation
beat frequency
zero beat
zero beat
zero beat indicator wavemeter
welding set
controlled‐atmosphere welding
controlled‐atmosphere welding
welding by means of robot, welding by using of robot, robot w
welding seam
welding robot
welding robot for arc welding technique
welding robot movement cycle
welding robot positioning
welded part, welding part
welding part reception
pulsed laser welding
welding procedure automation
welding tool
welding tool guide
welding tongs, welding pliers
effector of welding tongs, effector of welding pliers
threshold detector threshold effect threshold sensitivity
threshold field
threshold frequency
threshold function
threshold network
threshold signal
threshold threshold voltage
sector‐alignment indicator
threshold value indicator
threshold logic
threshold circuit swiveling axis
swinging arm manipulator, pivoted arm manipulator
pivoting sliding axis of IR
pivoting sensor
swiveling range
swivel motion (movement) of gripper
swivel unit
robot swivel unit
robot swivel unit
swiveling unit with linear drive
yaw to
rocking‐contact speed regulator
pivoted manipulator
swivel mechanism
swivel module
slewable device
robot for heavy industry
gravity correction
gravitational acceleration
gravity acceleration
gravity conveyor
center of largest area defuzzification
determination of centre of gravity, centre of gravity search
Center of area (COA) defuzzification
center of gravity (COG), defuzzification
centroid defuzzification method
center of sums (COS) defuzzification
coefficient of difficulty
float‐operated pressure gauge
float‐operated flowmeter
float level gauge
floatless liquid‐level controller
float‐operated pressure gauge
floating control
null offset
floating potential
oscillating mechanism
pendulate v
stran 250 od 326
EN ‐DE: slovar avtomatizacije in robotike schwingen
schwingender Regelkreis
schwingendes Greifersystem
Schwingfähigkeit
Schwingfähigkeit
Schwingfähigkeit des Systems
Schwingfall)
Schwinggrenzfrequenz
Schwinggröße
Schwingindex
Schwingkontakt
Schwingkreis
Schwingkreis
Schwingkreiseinstellung circuit
Schwingkreiseinstellung circuit
Schwingmechanismus
Schwingregler
Schwingregler
Schwingregler
Schwingrelais
Schwingung
Schwingung
Schwingungsanalysator
Schwingungsanalyse
Schwingungsbauch
Schwingungsbewegung
Schwingungsdämpfer
Schwingungsenergie
Schwingungserreger
Schwingungserregung
Schwingungsforschung
Schwingungsfrequenz
Schwingungsfunktion
Schwingungsglied
Schwingungsmodell
Schwingungsphase
Schwingungsspektrumanalysator
Schwingungssynchronisation
Schwingungsübergang
Schwingungsvorgang
Schwingungszustand
Schwundregelung
Schwungradsynchronisation
S‐Ebene
sechsachsiger Fernmanipulator
Sechsexzesskode
Sechsüberschußkode
Segmentadresse
Segmentbasis
Segmentbasisadresse
Segmentgrenze
segmentieren
segmentierte Kodierungskennlinie
Segmentierung
Segmentverwaltung
seigern seinesgleichen
Seitenbandübertragung
Seitensteuerung
Sekantenmethode
Sekundärauslöser
Sekundärradar
Sekundärregelung
Sekundärspeichersystem
Sekundärverfahren
Selbstabgleich
Selbstabgleich
selbstabgleichend
selbstabgleichende Brückenschaltung
selbstabgleichender magnetischer Verstärker
selbstabgleichendes Potentiometer
selbstablaufendes Schweißen
selbstabstimmendes Modell
selbstadaptiertes Greiforgan
selbstadjungiertes System
selbständige Handhabetechnik
swing v
oscillating control servomechanism
oscillatory gripper system
oscillation capability
property to oscillate
oscillation system property
underdamped system
maximum frequency of oscillation
oscillating quantity
index of oscillation
oscillating contact
oscillating circuit
resonator circuit
circuit adjustment
circuit setting
oscillating mechanism
oscillating controller
oscillating regulator
vibrating controller
oscillating relay
oscillation
oscillatory motion
vibration analyzer
analysis of oscillation
antinode
oscillatory motion
vibration damper
vibration energy
vibration generator
oscillation excitation
vibration research
oscillation frequency
oscillation function
oscillation element
transient analyzer
oscillating phase
vibration spectrum analyzer
oscillation synchronization
vibrational transition
oscillating process
oscillating regime
fading control
flywheel synchronization
s‐plane
six‐axial distance manipulator
excess‐six‐code
excess‐six‐code
segment address
segment base
segment base address
segment boundary
segment v
segmented encoding law
segmentation
segment management
upgrade v peer adj
side‐band transmission
side control
secants method
secondary trip
secondary radar
secondary regulation
secondary storage system
secondary method
automatic balancing
automatic compensation
self‐balancing
balancing bridge circuit
self‐balancing magnetic amplifier
self‐balancing potentiometer
automatic [machine] welding
self‐adjusting model
self‐adapted grip organ
self‐adjoint system
unaided handling technique, independent technique
stran 251 od 326
EN ‐DE: slovar avtomatizacije in robotike selbständige Robotereinheit
selbständiger rechnergesteuerter Manipulator
selbständiges Programm
Selbstanlasser
Selbstanlassung
selbstanpassende Drehzahlregelung
selbstanpassende Regelung
selbstanpassende Struktur
selbstanpassender Prozess
selbstanpassungsfähige Handhabeeinrichtung
selbstanpassungsfühige Handhabeeinrichtung
Selbstanpassungsmodell
Selbstanpassungssystem
Selbstanregung
Selbstanregung
Selbstanschluss automatique
Selbstausgleich
Selbstausgleich
Selbstausgleich
Selbstausgleich
Selbstausgleicher
selbstausrichtend
selbstbezügliches Modell
Selbstdiagnosefähigkeit
Selbstdiagnosemethode
selbstduale Funktion
selbsteinstellend
selbsteinstellende Lamelle eines Greifers
selbsteinstellende Stifte eines Greifers
selbsteinstellender Dreipunktgreifer
selbsteinstellendes Modell
selbsteinstellendes System
selbsteinstellendes System
Selbsteinstellung
selbsterhaltende Schwingung optimization s 1181
selbsterregte Schwingung
Selbsterregung
Selbsterregung
Selbstfokussierung
Selbstfokussierungseffkt
selbsthaltend aufschalten
Selbsthaltestromkreis
Selbstinduktionswert
Selbstinduktivität
Selbstkontrolle
Selbstkontrolle
Selbstkontrolle
Selbstkontrolle
Selbstkontrolle
selbstkorrigierender Kode
selbstkorrigierender Speicher
selbstkorrigierendes System
selbstlernend
selbstlernender Roboter (der dritten Generation)
selbstlernendes System
selbstoptimierende Regelung
selbstoptimierendes System
selbstoptimierendes System
selbstorganisierender Automat
Selbstprogrammierung
Selbstprogrammierung
selbstprüfend
selbstprüfend
selbstprüfend
selbstprüfend
Selbstprüfmethode
Selbstprüfung
Selbstprüfung
Selbstprüfungselektronik
Selbstregelstrecke
Selbstregelung
Selbstregelungsfaktor
Selbstregler
Selbstregulierungsgeschwindigkeit
Selbstreproduktion
selbstreproduzierendes System
independent robot unit
autonomous computer‐controlled manipulator
stand‐alone program
self‐starter
automatic start[‐up]
adaptive speed regulation
self‐adaptive control
adaptive architecture
adaptive process
self‐adaptable manipulation equipment
self‐adaptable manipulation equipment
auto‐adaptive model
goal‐seeking system
autoexcitation
self‐excitation
automatic connection
self‐recovery
self‐regulation
hunting
parasitic oscillations
automatic regulator
self‐aligning
AR model, auto‐regressive model
self‐diagnostic ability
self‐diagnostic method
self‐binary function
self‐adjusting
self‐adjusting lamina of gripper
self‐adjusting pins of gripper
self‐adjusting three‐point gripper
self‐adjusting model
adaptive control system
self‐adjusting system
self‐adjustment
self‐sustained pulsation
self‐excited oscillation
autoexcitation
self‐excitation
self‐focusing
self‐focusing effect
latch v
self‐holding circuit
value of self‐inductance
self‐inductance
automatic check[ing]
self‐check
automatic test[ing]
self‐test
automatic inspection
error‐correcting code
self‐correcting memory
self‐correcting system
self‐learning
self‐learning robot (of third generation)
self‐learning system
self‐optimizing control
automatically taught system
self‐teaching system of automatic optimization
self‐organizing automaton
automatic programming
self‐programming
self‐checking
self‐testing
auto‐checking
auto‐testing adj
self‐test method
self‐check
self‐test
self‐test electronics
self‐regulating controlled system
self‐regulation
coefficent of inherent regulation
automatic controller
inherent regulation rate
self‐reproduction
self‐reproducting system
stran 252 od 326
EN ‐DE: slovar avtomatizacije in robotike Selbstrückstellung
selbstschreibendes
selbstschreibendes
Selbstschwingungsglied
Selbstschwingungssystem
Selbstschwingungssystem
Selbststabilisierung selbststartender Synchronmotor
Selbststeuerung
Selbsttaktierung
Selbsttaktierungssystem
selbsttätig
selbsttätig
selbsttätig arbeitend
selbsttätige
selbsttätige
selbsttätige Auswuchtmaschine
selbsttätige Datenvermittlung
selbsttätige Datenvermittlung
selbsttätige Elektroantriebssteuerung
selbsttätige Folgesteuerung
selbsttätige Förderung
selbsttätige Kodierung
selbsttätige Korrelationsfunktion
selbsttätige Korrelationsfunktion
selbsttätige Messeinheit
selbsttätige Nachführung
selbsttätige Nulleinstellung
selbsttätige Nulleinstellung
selbsttätige Regelung
selbsttätige Regelung
selbsttätige Regelung
selbsttätige Regelung
selbsttätige Regelung der Gasverteilung
selbsttätige Rückstellung
selbsttätige Sperrung
selbsttätige Sperrung
selbsttätige Sperrung
selbsttätige Steuerungseinrichtung
selbsttätige Umspeicherung
selbsttätige Wiedereinschaltung
selbsttätiger (automatischer) Kreislauf
selbsttätiger Ausgleicher
selbsttätiger Betriebskorrelator
selbsttätiger Energiefluss
selbsttätiger Informationsfluss
selbsttätiger Informationsfluss
selbsttätiger Netzwerkanalysator
selbsttätiger Netzwerkanalysator
selbsttätiger programmgesteuerter Roboter
selbsttätiger Roboter
selbsttätiger Unterbrecher automatique
selbsttätiger Wechselstromkompensator alternatif
selbsttätiger Werkstückfluss
selbsttätiger Werktückfluss
selbsttätiger Werktückfluss
selbsttätiger Werkzeugfluss
selbsttätiges komplexes Regelungssystem
selbsttätiges Lesen
selbsttätiges Regelsystem
selbsttätiges Regelsystem
selbsttätiges Regelungssystem
selbsttätiges Steuerventil
selbsttätiges Suchen
selbsttätiges Ventil
Selbsttestelektronik
Selbstüberwachungsstellglied
Selbstunterbrecher
Selbstunterbrechungsschaltung
selbstversorgtes Gerät
Selbstwählfernsprechsystem
selektieren (Werkstück)
Selektionsmethode
selektives Bandfilter
Selektivitätskurve
Selektivregelung
automatic resetting
automatic recorder
recording meter
autooscillation link
autooscillation system
self‐sustained oscillation system
ultrastability self‐starting synchronous motor
self‐gating
self‐clocking
self‐clocking system
automatic
self‐acting
automatically operating
automatic arc welding equipment
automatic arc welding machine
automatic balancing machine
automatic data exchange
automatic data exchange, ADE
automatic control system for electric drive
automatic sequence control
automatic conveying
automatic coding
autocorrelation function
self‐correlation function
self‐operated measuring unit
automatic tracking
automatic zero balancing
automatic zero adjustment
auto control
automatic control
self‐regulation
automatic regulation
gas distribution automatic control
automatic resetting
automatic blocking
automatic interlocking
automatic lockout
automatic control device
automatic address substitution
automatic reclosing
automatic cycle
automatic regulator
automatic process correlator
automatic energy flux
automatic flow of information
automatic flow of informations
automatic network analyzer
automatic network analyzer, ANA
automatic program‐controlled robot
automatically operated robot
automatic breaker
automatic alternating‐current compensator
automatic work flow, automatic parts flow
automatic work flow
automatic parts flow
automatic tool flow
complex automatic control system
automatic reading
automatic closed‐loop control system
automatic monitored control system
automatic control system
automatic control valve
automatic search
automatic valve
self‐test electronics
automatic checking actuating unit
automatic cut‐out
self‐interrupting circuit
self‐powered device
dial telephone system
select to (work piece)
selection method
band‐selective filter
selectivity characteristic
selective adjustment
stran 253 od 326
EN ‐DE: slovar avtomatizacije in robotike Selektivschütz
Selektivschutzrelais
Selektivschutzsystem
Selektivsteuerung
Selektivverstärker
Selektor
Selektorkanal
Selektorsystem
Selektorsystem
Selsyn
Selsyn
Selsyn mit zwei Geschwindigkeiten
Selsynnullstellungsgerät
Selsynsteuerung
Selsynsynchronsystem
Semantik feiner Robotersprache
semantische Sprachanalyse
Semidefinitheit
Semiduplex‐Lichtwellenleiterübertragung
semipermanent
semipermanente Daten pl
Sende[r]modul
Sendeanforderung
Sendedaten pl
Sendeverzerrung
sensible Daten pl
sensibler Sensor
Sensor (erkennendes Element zur Informationsgewinnung
Sensor (Fühler) mit Impulsemission (für Roboter)
Sensor eines Industrieroboters
Sensor für drei Kraftkomponenten
Sensor für Identifikation fester Objekte
Sensor für Kraftmomente
Sensor für Spannungen
Sensor mit hohem Auflösevermögen
Sensor mit Laserstrahlen
Sensor mit Laserstrahlen
Sensor mit Lumineszenzdiode und Fototransistor
Sensor mit Lumineszenzdiode und Fototransistor
Sensor mit optischer Faser
Sensor mit Optokopf (optischem Kopf) (für Roboter)
Sensor raster
Sensorabstand
Sensorabtastgerät
Sensorabtastung
Sensoraktion
Sensorangebot
Sensoranordnung
Sensoranzahl
Sensorarm
Sensoraufbau
Sensorausrüstung
Sensorbaueinheit
Sensorbauelement
Sensorbauelement
Sensorbauelement
Sensorbefehl
Sensorblock
Sensordaten eines Industrieroboters
Sensordaten pl
Sensordatenauswertung
Sensordatenerfassung
Sensordatenverarbeitung
Sensoreigenschaft
Sensoreinsatz
Sensoreinsatzbereich
Sensorelement
Sensoren auf der Handoberfläche
Sensorentwicklung
Sensorentwicklung
Sensorentwurf
Sensorerkennungsproblem
Sensorfaser
Sensorführung
Sensorfunktion
sensorgeführte Greiferbewegung
discriminating relay
discriminating relay
discriminating protective system
selective control
selective amplifier
selector
selector channel
gating system
selector system
selsyn
synchro
dual speed synchro system
instrument for selsyn zeroing
selsyn control
selsyn‐type synchronous system
robot language semantics
semantic language analysis
semidefiniteness
semiduplex optical fiber transmission
semipermanent
semipermanent data
transmitter module
request to send
transmit data
transmitting distortion
sensible data
sensible sensor
sensor
sensor with pulse emission (for robots), detection element wit
robot sensor, industrial robot sensor
sensor for three force components
sensor for identification of solid objects
sensor for force moments
voltage sensor
sensor with great resolving power
laser beam sensor
laser‐beam sensor
sensor with luminescence diode and photo transistor
sensor with luminescence diode and phototransistor
sensor with optical fibre
sensor with opto‐head
sensor raster
sensor distance
sensor scanning device
sensor scanning
sensor action
sensor supply
sensor arrangement
number of sensors
sensor arm
sensor structure
sensor equipment
sensor construction unit
sensor component, sensor part
sensor component
sensor part
sensor instruction
sensor block
sensor data of [industrial] robot
sensor data
sensor data evaluation
sensor data acquisition
sensor data processing
sensor property
sensor application
application area of sensor
sensor element, sensorial element
sensors on hand surface
development of sensor
sensor design
sensor design
sensor identification problem
sensor fibre
sensor guide
sensor function
sensor‐guided gripper movement
stran 254 od 326
EN ‐DE: slovar avtomatizacije in robotike sensorgeführte Roboterbewegung
sensorgeführte Robotersteuerung
sensorgeführte Steuerung
sensorgeführter Industrieroboter
sensorgeführter Montageroboter
sensorgeführter Roboterarm
sensorgeführter Schweißautomat
sensorgeführter Schweißroboter
Sensorgenauigkeit
Sensorgeneration
Sensorgeometrie
Sensorgerät
sensorgeschaltete Schwingbewegung
sensorgeschaltete Schwingbewegung sensorgesteuert
sensorgesteuerte Achse
sensorgesteuerte Feinbewegung
sensorgesteuerte Feinbewegung
sensorgesteuerte flexible Backenprofile
sensorgesteuerte Positionierung
sensorgesteuerte Robotereinrichtung
sensorgesteuerte Robotererkennungseinrichtung
sensorgesteuerte Roboterhardware (IR‐Hardware)
sensorgesteuerter Fügemechanismus
sensorgesteuerter Industrieroboter
sensorgesteuerter Manipulator
sensorgesteuerter Montagegreifer
sensorgesteuerter Montageroboter
sensorgesteuerter Roboterarm (Industrieroboterarm)
sensorgesteuerter Wechsel‐g reifer
sensorgesteuerter Wechselgreifer
sensorgesteuertes Backenprofil sensorgesteuertes Fügen
sensorgesteuertes Element
sensorgesteuertes Fügen
sensorgesteuertes Robotergerät
sensorgestützter Roboter
Sensorik
Sensorikanwendung
Sensorikanwendung
Sensorimpuls
Sensorindustrie
Sensorinformation
sensorischer Geber
sensorischer Kontaktgeber
sensorisches Element
sensorisches Gerät
sensorisches System
sensorisierter Finger
sensorisiertes Fügen
sensorisiertes System
Sensorkanal
Sensorkontakt
Sensorkontaktfläche
Sensorkopf
Sensorkörper
Sensorkraftaufnehmer
Sensorkrafterfassung
Sensorlageinformation
sensorloses Online‐Überwachungssystem
Sensormatrix
Sensormessung
Sensormodelle
Sensormoment
Sensormomenterfassung
Sensormustererkennung
Sensorobjektidentifizierung
Sensorpotentiometer
Sensorprinzip
Sensorprozessor
Sensorrauschsignal
Sensorrohr
Sensorschicht
Sensorsichtsystem
Sensorsignal
Sensorspannung
Sensorstatus
sensor‐guided robot movement
sensor‐guided control, sensor‐guided robot control
sensor‐guided control, sensor‐guided robot control
sensor‐guided industrial robot
sensor‐guided assembly robot
sensor‐guided robot arm
sensor‐guided welding automation
sensor‐guided welding robot
sensor accuracy
generation of sensors
sensor geometry
sensorial device, sensor device
sensor‐connected oscillatory motion
sensor‐connected oscillatory motion
sensor‐controlled
sensor‐controlled axis
sensor‐controlled fine motion
sensor‐controlled fine motion (movement)
sensor‐controlled flexible jaw profiles
sensor‐controlled positioning
sensor‐controlled robot device
sensor‐controlled robot identification device
sensor‐controlled robot hardware
sensor‐controlled joint mechanism
sensor‐controlled industrial robot
sensor‐controlled manipulator
sensor‐controlled assembly gripper
sensor‐controlled assembly robot
sensor‐controlled industrial robot arm, sensor‐controlled robo
sensor‐controlled change gripper
sensor‐controlled change gripper
sensor‐controlled jaw profile
sensor‐controlled element
sensor‐controlled joint[ing]
sensor‐controlled robot device
sensor‐based robot
sensor technique, sensorics
application of sensor technique, application of sensorics
application of sensor technique;
sensor pulse
sensor industry
sensor information
sensorial transmitter
sensorial contact transducer (transmitter)
sensor element, sensorial element
sensorial device, sensor device
sensor system
sensorized finger
sensorized jointing
sensorized system
sensor channel
sensor contact
sensor contact surface
Sensor head
sensor body
force receiver of sensor
sensor force acquisition
sensor position information
sensorless online monitoring system
sensor matrix
sensor measurement
sensor models
sensor moment
sensor moment acquisition
sensor pattern recognition
sensor object identification
sensor potentiometer
sensor principle
sensor processor
sensor noise signal
sensor pipe, sensor tube
sensor layer
sensor visual system
sensor signal
sensor voltage
sensor state (status)
stran 255 od 326
EN ‐DE: slovar avtomatizacije in robotike Sensorsteuerung
Sensorsystem
Sensortaste
Sensortechnik
Sensortechnik‐Applikation
Sensortechnik‐Applikation
Sensorteilinformation
Sensortyp
Sensorüberwachung
Sensorüberwachung der Robotergreifkraft
Sensorverarbeitung der Information
Sensorzeile
Sensorzustand
separates Modul
Separation
Separation
Separationsprinzip
separierte Daten pl
sequentiell
sequentiell
sequentielle Basiszugriffsmethode
sequentielle Basiszugriffsmethode
sequentielle Berechnung
sequentielle Logik
sequentielle Steuerung
sequentielle Steuerung
sequentielle Steuerung
sequentielle Verarbeitung
sequentieller Automat
sequentieller Betrieb sequential processing 568
sequentieller digitaler Servomechanismus
sequentieller Entscheidungsprozess
sequentielles Korrekturglied
Sequenzanalyse
seriell
seriell
serielle Datenleitung
serielle Übertragung
serielle Übertragung
serieller Dateneingang
serieller Datenkanal
serieller Zugriff
Serienadder
Serienaddierer
Serienkompensationsnetzwerk Serienkondensator
Serien‐Parallel‐Arithmetik
serienparalleles System
Serienprinzip
Serienproduktion
Serienproduktion
Serienproduktion
Serienrechenwerk
Serienresonanz
Serienschalter
Serienschalter
Serienschaltung
Serienschaltung
Serienschaltung der Glieder im Regelkreis
Serienschaltung der Regelkreisglieder
Serienstabilisierung
Serienübertragung
Serienübertragung
serienweise Informationsübertragung
serienweiser Zugriff
Servicefunktion
Serviceprozessor
Servoanalysator
servobetrieben
Servogerätausgangssignal
servohydraulischer Manipulatorantrieb
servohydraulischer Manipulatorantrieb servohydraulique
servohydraulischer Roboterantrieb
Servomechanismus für Dauerbetrieb
Servomechanismus für Dauerbetrieb
Servomechanismus zweiter Ordnung
sensor control
sensor system
sensor key
sensor technique, sensorics
application of sensor technique, application of sensorics
application of sensor technique;
sensor partial information
sensor type
sensor survey
sensor survey of robot grip force
sensor processing of information
sensor line
sensor state (status)
separate module
separation
separating
separation principle
separated data
sequential
serial
basic sequential access method
basic sequential access method, BSAM
sequential calculation
sequential logic
run‐off control
series control
sequential control
sequential processing
sequential automaton
sequential operation
sequential digital servomechanism
sequential decision process
sequential correcting element
sequential analysis
sequential
serial
serial data line
serial transfer
serial transmission
serial data input
serial data channel
serial access
serial adder
serial adder
tandem compensation network series capacitor
serial‐parallel arithmetic
series‐parallel system
serial principle
production in series
serial production
series manufacture
serial arithmetic unit
series resonance
commutation switch
change‐over gate
cascade connection
series connection
linear combination of control‐loop elements
linear combination of control‐loop elements
series stabilization
serial transfer
serial transmission
series transmissions of informations
serial access
service function
service processor
servoanalyzer
servo‐driven
servo‐output signal
Servo hydraulic manipulator drive
servo‐hydraulic manipulator drive
Servo hydraulic robot drive
Servo mechanism for continuous operation
servomechanism for continuous operation
second‐order servo
stran 256 od 326
EN ‐DE: slovar avtomatizacije in robotike Servomotor
Servomotor
Servomotor mit fortschreitender Bewegung
Servomotor mit Kurbelantrieb
Servomultiplizierer
Servopotentiometer
Servoregler
Servoregler
Servoregler
Servoregler
Servoschalter
Servoschleife
Servosteuerung
Servosystem
Servosystem
Servosystem
Servosystem mit magnetischem Verstärker
Servosystemstabilität
Setzen eines Zählers
Sheffer‐Funktion
sich aufhebende Fehler
sichere Reaktorregelung
Sicherheit
Sicherheit
Sicherheit
Sicherheit
Sicherheit
Sicherheit der Datenübertragung
Sicherheitsanforderungen für Roboter
Sicherheitsfaktor
Sicherheitsfaktor
Sicherheitsfunktion
Sicherheitsgurt mit automatischer Aufhängung
Sicherheitskreis
Sicherheitsprogramm
Sicherheitsregler
Sicherheitsrelais
Sicherheitssensor
Sicherheitssperre
Sicherheitssystem in unvermaschter
Sicherheitssystem in unvermaschter
Sicherheitstechnik
sicherheitstechnische Einrichtung
Sicherheitsventil
Sicherheitsventil mit Gewichtshebel
Sicherheitsverriegelung
Sicherheitsvorrichtung (eines Roboters)
Sicherung
Sicherung gegen Störung
Sicherungsautomat
Sichtgerät
Sichtgerät
Sichtkontrolle
Sichtkontrolle
Sichtorientierung
Sichtsensor
Sichtsensorsystem
Sichtsystem
Sichtsystemgeneration
Sichtsystemstruktur
Siebdruckverfahren (mittels Roboter)
Siebung
Signal aus der Peripherie
Signal automatischer Blockierung
Signal eines Industrieroboters
Signal mit hohem Pegel
Signal mit niedrigem Pegel
Signal zum Übertrag
Signalabsonderung aus dem Rauschen
Signalabtastung
Signalanalyse
Signalaufbereitung
Signalauswahl
Signalauswähler
Signalauswertung
Signalbandbreite
power cylinder
servomotor
prograssive motion servomotor
level power cylinder
servomultiplier
servopotentiometer
servo regulator
follow‐up controller
servofollower
servoregulator
servo switch
servoloop
servocontrol
Servo system
follow‐up system
servosystem
magnetic amplifier servosystem
servostability
set of counter
Sheffer's function
compensating errors
safe reactor control
dependability
safety
eqiupment dependability
equipment safety
reliability
safety in data transmission
safety requirements for robots
factor of safety
safety factor
safety function
safety belt with automatic suspension
safety circuit
safety program
safety regulator
safety relay
safety sensor
safety interlock
non‐interacting safety system
single‐loop safety system
safety technology
safety‐technical device
safety valve
level safety valve
safety interlock
safety device (of robot)
safety fuse
antiblocking device
automatic cut‐out
display device
display unit
visual check[ing]
visual checking
view orientation
visual sensor
visual sensor system
visual system
visual system generation
visual system structure
silk screen process (by robot)
filtering
peripheral signal
signal of automatic blocking
robot signal, signal of industrial robot
high‐level signal
low‐level signal
carry initiating signal
detection of signal in noise
signal scanning
wave analysis
signal conditioning
signal selection
signal selector
signal evaluation
signal bandwidth
stran 257 od 326
EN ‐DE: slovar avtomatizacije in robotike Signalbehandlung
Signalbehandlung
Signalblock
Signalcharakter
Signaldämpfung
Signaldarstellung
Signaldaten pl
Signaldauer
Signalentschlüsselung
Signalerfassung
Signalerkennung
Signalflussbild
Signalflussbild
Signalfolge zum Belegen der Koppeleinheit
Signalformung
Signalgeber
Signalgebung
Signalgemisch
Signalhauptleitung
Signalhüllkurve
signalisierter Roboterfehler
Signalisierung
Signalkode
Signalkonverter
Signalkopplung
Signalkorrelation
Signallampe
Signallampe
Signalleitung
Signallinearität
Signalmuster
Signalnachspürer
Signalpegel
Signalprobenabnahme
Signal‐Rausch‐Abstand
Signal‐Rausch‐Verhältnis
Signalschwelle
Signalselektor
Signalspeichersystem
Signalstärkeregelung
Signaltafel
Signaltaste
Signalübertragungsgeschwindigkeit
Signalübertragungsstärke
Signalumsetzer
Signalverarbeitung
Signalverarbeitung
Signalverarbeitung feines IR
Signalverfolger
Signalverteiler
Signalverzögerung
Signalverzögerungszeit
Signalwandler
Signalwandlungseinrichtung
Signifikanzkriterium
Signifikanzniveau
Signifikanzuntersuchung
Signum‐Funktion
Simplexalgorithmus
Simplexbetrieb
Simplexkanal
Simplexkriterium
Simplexmethode
Simplexmethode
Simplexverfahren
Simplexverfahren
Simpsonsche Formel
Simpsonsche Regel
Simulation
Simulation
Simulation eines kybernetischen Systems
Simulation eines physikalischen Vorgangs
Simulation nichtlinearer Gleichungen
Simulationsergebnis
Simulationsprogramm für Montage
Simulationsprozessor
signal handling
signal processing
signal block
signal character
damping of a signal
signal representation
signal data
signal duration
signal decoding
signal acquisition
signal recognition
block diagram
functional block diagram
capture interface sequence
signal conditioning
signal generator
signalling
composite signal
signal main line
amplitude envelope
signalized robot error
signalling
signal code
signal converter
signal coupling
signal correlation
indicating lamp
check indicator
signal line
linearity of signal
signal sample
signal tracer
signal level
sampling [action]
signal‐to‐noise ratio
signal‐to‐noise ratio
signal threshold
signal selector
signal storage system
signal strength adjustment
annunciator board
signal button
signal transmission speed
signal transmission level
signal converter
signal handling
signal processing
signal processing of IR
signal tracer
signal distributor
signal delay
signal delay time
signal converter
signal conversion equipment
significance criterion
level of significance
significance study
Signum function
simplex algorithm
simplex operation
simplex channel
simplex criterion
simplex method
simplex technique
simplex method
simplex technique
Simpson's rule
Simpson's rule
simulation
computer simulation
simulation of cybernetic system
simulation of physical phenomenon
simulation of non‐linear equation
simulation result
assembly simulation program
simulator processor
stran 258 od 326
EN ‐DE: slovar avtomatizacije in robotike Simulationsprüfung
Simulationsrechnung
Simulationssprache
Simulationssystem
Simulationstechnik
Simulationsverfahren
Simulationsverfahren für Montage
Simulationsvorteil
Simulator
Simulator einer Robotersoftware
Simulatorsteuerung
simulieren
simulierter Entwurf
simulierter Roboter
simuliertes Programm
Simulierung typischer Nichtlinearitäten
simultan
simultan zur Aufgabenbearbeitung durchgeführte
Simultanbewegungen
simultane Ausführung
simultane Mehrfachoptimierung
simultane Trennung
Simultansteuerung in Verteilungsnetzen
Simultanverarbeitung
Singleton
Singleton
singuläre Matrix
singuläre Trajektorie
singulärer Automat
singulärer Punkt
Sinus
Sinusantwort
sinusförmige Modulation
sinusförmiges Eingangssignal
Sinusfunktion
Sinusfunktion
Sinus‐Kosinus‐Potentiometer
Sinussignalgenerator
Sinusstörung
Situationsanzeige
Skalar
skalare Achse
skalare Feldtheorie
skalare Größe
skalares Variationsproblem
Skalarfunktion
Skalarprodukt
Skale
Skalendurchlaufzeit
Skaleneinheit
Skaleneinstellung
Skalenendwert
Skalenintervall
Skalenscheibe
Skalenteilung
Slave‐arm
Slave‐Prozessor
Slave‐Prozessor
Slave‐Prozessor
Slave‐Roboterarm
S‐Norm
s‐Norm
s‐Norm
s‐Norm
Sofortbildsystem
sofortiger Zugriff
sofortiger Zugriff
Sofortmaßnahme
Sofortverarbeitung
Softgreiferglied
Softgreiferkraft
Softgreiferrollen
Softgripper‐Prinzip
Software
Software eines Industrieroboters
Software eines Montageroboters
simulation testing
simulation computation
simulation language
simulation system
simulation techniques
simulation procedure
assembly simulation process
simulation advantage, advantage of assembly simulation
simulator
simulator of robot software
simulator control
simulate v
simulated design
simulated robot
simulated program
typical non‐linearity simulation simultaneous
concurrent testing
simultaneous movements
simultaneous executing
multiple simultaneous optimization
multielement separation
simultaneous control in distribution networks
simultaneous processing
fuzzy singleton, singleton
singleton
singular matrix
singular trajectory
singular automaton
singular point
sine
sine response
sinusoidal modulation
sinusoidal input
sine function
sine‐function
sine‐cosine potentiometer
sinusoidal signal generator
sinusoidal disturbance
situation display
scalar quantity
scalar axis
scalar fielad theory
scalar quantity
scalar variational problem
scalar function
scalar product
scale
scale time
scale unit
scale positioning
full‐scale value
scale interval
calibrated dial
scale division
slave robot arm
support processor
support processor, slave processor
slave processor slave robot arm
s‐norm, triangular conorm, t‐conorm
s‐norm
t‐conorm
triangular conorm
immediate image system
immediate access
instantaneous access
emergency measure
real‐time processing
element of soft gripper, soft‐gripper element
Soft gripper force, force of soft gripper
Soft gripper rolls, rolls of soft gripper
Soft gripper principle
software
robot software, IR software
assembly robot software
stran 259 od 326
EN ‐DE: slovar avtomatizacije in robotike Software eines Plattensystems
Software für Bildanalyse
Softwareanforderung
Softwareanwendung
Softwareapplikation
Softwareausstattung
Software‐Diagnose
Software‐Entwicklungssystem
Software‐Fehlersuche
Software‐Forschung
software‐gesteuert
softwaregestütztes Erkennungssystem
softwaregestütztes Erkennungssystem software
Softwareprojekt
Software‐Robotersteuerung
Software‐Struktur
Softwaresystem mit Steuer Programm
Softwaresystemrücksetzen
Softwaresystemrücksetzen
Softwaresystemrücksetzen
Softwaretechnik
Softwaretechnik Solenoidantrieb Solenoidservomechanismus Solenoidventil
Soll‐Bahn
Solleistung
Sollgeschwindigkeit
Soll‐Istwert‐Vergleich
Sollmuster einer Objekterkennung
Sollstrom
Sollwert
Sollwert
Sollwert
Sollwert
Sollwert
Sollwert
Sollwert
Sollwert
Sollwert
Sollwert der Regelgröße
Sollwertänderung
Sollwertbereich
Sollwerteinsteller
Sollwerteinsteller
Sollwerteinstellung
Sollwertfolge
Sollwertgeber consigne
Sollwertvergleich
Sonderausrüstung
Sonderbefehl
Sonderfunktion
Sondermaschineneinsatz
Sonderspeicher
Sortiereinrichtung
sortieren
sortieren Sortierhilfen
Sortierprozess
Sortiervorgang Spaltbreiteneinstellung
Spaltenanzeiger
Spaltenvektor
Spaltungsimpuls
spanende Bearbeitung
spanlose Kaltverformung
Spannelemente
spannen
spannen
Spannfutter
Spannkraft
Spannmittel
Spanntechnik
Spannung in Flußrichtung
Spannungsabfall
Spannungsabfragegruppe
disk system software
image analysis software
software request
software application
software application
software package
software diagnostic
software development system
software diagnostic
software research
software‐controlled
Software‐aided identification system
softwareaided identification system
software project
software robot control
software architecture
software system with control program
backspace of software system, reset of software system
backspace of software system
reset of software system
software technique
software technique solenoid actuator solenoid servomechanism solenoid valve nominal path
demand power
velocity rating
nominal‐actual value comparison
nominal design of object identification
rated current
command
command input
desired value
index value
nominal value
reference input
reference variable
required value
set value
final control condition
desired value change
range of set value
director
set‐point adjuster
set‐point adjustment
sequence of nominal value
set‐point adjuster
nominal value comparison
special equipment
special instruction
special function
application of special machines
zone (of a computer)
sorting device
classify v
sort v sorting aids
sorting process
sorting process gap adjustment
column indicating device
column vector
fission pulse
machining
chipless cold deformation
clamping elements
clamp to
clamp v
chuck
progressing force
holding tool
clamping technique
forward voltage
voltage drop
voltage inquiry group
stran 260 od 326
EN ‐DE: slovar avtomatizacije in robotike spannungsabhängiger Widerstand
Spannungsanalogon
Spannungsauslösung
Spannungsbegrenzer
Spannungsbegrenzer
Spannungsbereich
Spannungsdeviator
Spannungseichgerät
Spannungserniedriger
Spannungsfernmessung
Spannungsfunktion
Spannungsgegenkopplung
spannungsgesteuerter Oszillator
spannungsgesteuertes Bauelement
Spannungsgrenzwerttest
Spannungskomparator
Spannungspegel
Spannungsregelung
Spannungsregler
Spannungsregler
Spannungsrichtung
Spannungssensor
Spannungssprung
Spannungsstabilisator
Spannungsstabilisator
Spannungsstabilisierungssystem
Spannungsteiler
Spannungsteiler
Spannungstheorie
Spannungstheorie
Spannungsverdoppler
Spannungsverdopplungsschaltung
Spannungsvergleicher
Spannungsverstärker
Spannungsverstärkung
Speicher einer Ablaufsteuerung
Speicher einer Ablaufsteuerung
Speicher eines Industrieroboters
Speicher eines Industrieroboters
Speicher eines Industrieroboters
Speicher für Fertigungsprogramm
Speicher für Roboterdaten
Speicher mit akustischem Laufzeitglied
Speicheradapter
Speicheraufbau
Speicheraufbau
Speicheraufbau
Speicheraufbau
Speicherausnutzung
Speicherausnutzung
Speicherbereich
Speicherbereich
Speicherbereichserweiterung
Speicherbewegungsmedium
Speicherbewegungsmittel
Speicherbildgerät
Speicherblock
Speicherdaten pl
Speicherdiskette
Speicherelement
Speicherelement mit Vormagnetisierung
Speichererneuerung
Speicherfähigkeit der Regelkreisglieder
Speicherfunktion
Speichergeschwindigkeit
speichergesteuerter Manipulator
Speicherherstellungstechnologie
Speicherinhalt
Speicherintegrator
Speicherkapazität
Speicherkondensator
Speicherkonfiguration
Speicher‐Manipulator‐Beziehung
speichern
Speichern einer Floppy‐Datei
Speicheroperation
varistor
voltage analog
shunt tripping
overvoltage device
voltage limiter
voltage range
stress deviator
voltage calibrator
negative booster
voltage‐type telemetering (US)
voltage function
negative voltage feedback
voltage‐controlled oscillator
voltage‐driven device
marginal voltage check
voltage comparator
voltage level
voltage control
voltage regulator
voltage stabilizer
voltage direction
voltage sensor
voltage jump
voltage stabilizer
constant‐voltage regulator
voltage regulating system
voltage divider
potential divider
theory of strain
tension theory
voltage doubler
voltage‐doubling circuit
voltage comparator
booster
voltage gain
development control memory
development control memory (store)
robot memory
robot memory, robot store, IR memory, IR store
robot store
manufacturing program memory
memory for robot data
acoustic delay line memory
storage adapter, memory adapter
memory assembly, store assembly
memory assembly
memory configuration
store assembly
memory efficiency
storage efficiency
memory zone
memory area
store zone extension, memory zone extension, store area exten
storage movement medium
storage movement medium
store display unit
memory block
store data
memory diskette
memory element
coincident flux device
storage regeneration
capacity of element of automatic control system
storage function
storage speed
memory‐controlled manipulator, store‐controlled manipulato
memory fabrication technology
store contens
store integrator
memory capacity
reservoir capacitor
memory configuration
memory‐manipulator relation, store‐manipulator relation
store v
storage of floppy file
memory operation
stran 261 od 326
EN ‐DE: slovar avtomatizacije in robotike Speicheroszillograf
Speicherplatz
Speicherplatz
Speicherplatzbedarf
Speicherplatzzahl
Speicherprinzip
Speicherprinzip
Speicherprinzip
speicherprogrammierbare Robotersteuerung
speicherprogrammierte Steuerung
speicherprogrammierte Steuerung
speicherprogrammierte Steuerung
speicherprogrammierte Steuerung
speicherprogrammiertes Verfahren
Speicherregister
Speicherrückstellung auf Null
Speicherschaltung
Speicherschutzvorrichtung
Speicherstation feines Industrieroboters
Speichersteuerung
Speichersteuerung
Speicherstufe
Speichersystem
Speichersystem
Speicherung mit wahlfreiem Zugriff
Speichervermittlung
Speicherverteilung
Speicherverteilungskontrolle
Speicherverteilungskontrolle
Speicherverteilungskontrolle
Speicherverwaltungseinheit
Speicherwerk
Speicherwerk
Speicherwiederherstellung
Speicherzone
Speicherzone
Speicherzugriffsschutz
Speisedruck supporting function 598
Speiseenheit Speisefrequenz Speisefrequenz speisen
Speiser
Speiseregler
Speiseschaltung
Speisestrom Speisevorrichtung
Speisewasserregelung
Speisung
Speisung des Reglers
Speisungsunterbrechung
Spektralanalysator
Spektralanalyse
Spektralanalyse in hydraulischen Systemen
Spektralangaben Spektralbolometer Spektralcharakteristik
Spektralcharakteristik
spektrale Dämpfungskurve spektrale Emissionsfähigkeit
spektrale Fehlerdichte spektrale Selektivität
spektrale Verteilungscharakteristik
spektrale Verteilungscharakteristik
Spektralempfindlichkeit Spektralempfindlichkeit spektraler Absorptionsgrad spektraler Emissionsgrad
Spektralfunktion Spektralindex Spektralkurve Spektralselektivität spektrochemische Messung mit Digitalzähler
Spektrometer mit großer
Spektrometer mit Proportionalzählrohr
Spektrometer mit schneller Abtastung
storage oscillograph
memory location
store location
memory location demand, store location demand
memory location number, store location number
memory principle, store principle
memory principle
store principle
memory‐programmable robot control, store‐programmable ro
memory‐programmed control, store‐prog rammed control
memory‐programmed control
teach‐in control
storeprogrammed control
teach‐in process
memory register
memory return to zero
memory circuit
memory protection system
robot memory station, industrial robot memory station
memory control
storage control
accumulator stage
memory system
storage system
random access storage
message switching
allocating
memory distribution checking, store distribution checking
memory distribution checking
store distribution checking
memory management unit
store mechanism
memory mechanism
storage regeneration
memory zone
memory area
memory access protection
supply pressure supply block supplay frequency supply frequency drive v
feed apparatus
feed controller
feeding circuit
supply current feed[ing] system
water supply control
feed[ing]
regulator supply
dump
spectrum analyzer
spectrum analysis
spectral analysis in hydraulic systems spectral information spectrobolometer spectral‐response characteristic
spectralresponse curve
spectral loss curve spectral emissivity spectral error density spectral selectivity spectral‐response characteristic
spectralresponse curve
spectral responsivity
spectral response spectral absorptance spectral emissivity spectral function spectral index spectral curve spectral selectivity spectrochemical measurement with digital counter
rapid‐scan spectrometer
proportional counter spectrometer
rapid‐scan spectrometer
stran 262 od 326
EN ‐DE: slovar avtomatizacije in robotike Spektrum der angeregten Zustände
Sperrbereich
Sperrelais
Sperrelais
Sperrelais
Sperrelais
sperren
Sperrfilter
Sperrfilter
Sperrichtung
Sperrimpuls
Sperrkennlinie
Sperrkippsender
Sperrkippsender
Sperrklinkenrelais
Sperrkondensator
Sperrkreis
Sperrkreis
Sperrleitwert
Sperrmagnet
Sperrschalter
Sperrschalter
Sperrschaltung
Sperrschaltung
Sperrschaltung
Sperrschichtgleichrichter
Sperrschichtgleichrichter
Sperrschichtkapazität
Sperrschichtkapazität
Sperrschütz
Sperrschwinger
Sperrschwinger
Sperrsignal
Sperrsignal
Sperrsignal
Sperrspannung
Sperrstromkreis
Sperrstromkreis
Sperrung
Sperrung
Sperrung des Interruptsystems
Sperrwiderstand
Sperrzeit
Sperrzustand
Sperrzyklus
Spezial[zweck]rechner
Spezialanwendung
Spezialbaustein
Spezialbauuntergruppe
Spezialbefehl
Spezialfügemechanismus
Spezialgreifer
spezialisierter Baustein
spezialisierter Manipulatoreinsatz
spezialisierter Rechner
Spezialmaschine
Spezialschaltung
Spezialschraubendreher
Spezialtestprogramm
Spezialtestprogramm
Spezialwerkzeug
Spezialzweck‐Logikschaltkreis
speziell zugeschnittene Struktur
spezielle Montageausrüstung Spezialkamera für Roboter
spezielle Programmiersprachen
spezielle Programmierstrategie
spezielle Roboterprogrammierung
spezielle Zustände
spezieller Bildprozessor
spezieller Roboterfinger
spezieller Sensor Prozessor
spezieller Sensorprozessor
spezielles Greiforgan
spezielles Prüfprogramm
spezielles Prüfprogramm
spezielles Softwareprogramm für einen Roboter
excited state spectrum
stop band
blocking relay
closing relay
guard relay
interlocking relay
inhibit v
band elimination filter
band rejection filter
blocking direction
inhibit pulse
blocking characteristic
blocking generator
blocking oscillator
latched relay
blocking capacitor
band elimination filter
band rejection filter
back conductance
blocking magnet
gating switch
holding key
inhibiting circuit
lock[ing] circuit
time delay circuit
barrier‐layer rectifier
junction rectifier
barrier capacity
barrier‐layer capacitance
blocking contactor
blocking generator
blocking oscillator
cut‐off signal
inhibiting signal
disabling signal
back voltage
blocking circuit
interlock circuit
blocking
interlock[ing]
disabling of the interrupt system
blocking resistance
cut‐off time
blocking state
blocking period
special‐purpose computer
special application
specialized device
special sub‐assembly
special instruction
special jointing mechanism
special gripper
specialized device
specialized manipulator use
special‐purpose computer
special machine
special circuitry
special screw driver
special test program
special test routine
special tool
special‐purpose logic chip
dedicated structure
special assembly equipment
special programming languages
special programming strategy
special robot programming
special states
special image processor
special grab member, special grabbing element
special sensor processor
special sensor processor
special grab member, special grabbing element
special test program
special test routine
special software program for robot
stran 263 od 326
EN ‐DE: slovar avtomatizacije in robotike spezielles System
Spezifikation einer Robotertrajektorie
Spezifikationssprache spezifische Form eines Werkstücks
spezifische Form feines Werkstücks
spezifische Funktion
spezifische Verwendung spezifischer Impuls spezifiziertes Datenbyte
spezifiziertes Datenbyte sphäroidischer Arbeitsraum
Spiegelbildbearbeitung
Spiel
spielarmes Robotergetriebe
Spieleinstellung feines Greifers
spielfreier Greiferantrieb
spielfreies Robotergetriebe
Spieltheorie
Spieltheorie
Spindelantrieb
Spitze eines Greiforgans
Spitzen‐ Datenübertragungsgeschwindigkeit f
Spitzenamplitude
Spitzenbelastung
Spitzendruckmesser
Spitzenenergie
Spitzenflussdichte
Spitzenfrequenz
Spitzenkontakt
Spitzenleistung
Spitzensignal
Spitzenspannung
Spitzensperrspannung
Spitzensperrspannung
Spitzenstrom
Spitzentechnologie
Spitze‐Null‐Spannung
Spitzenwert
Spitzenwert
Spitzenwert der magnetischen Erregung
Spitzenzähler
Spitzenzeit
Spitze‐zu‐Spitze‐Amplitude
Spitze‐zu‐Spitze‐Amplitude
sprach gesteuerter Roboter
Sprachanalyse
Sprache eines Roboters
Sprache für automatische mechanische Montage
Sprache für automatische mechanische Montage
Sprache zur Anwendungssteuerung
Spracheingabe
Sprachgrundsymbol
Sprachoperation
Sprachspeicher
Sprachsyntax
Springkontakt
Spritzdruckgefäß eines Roboters
Spritzgießen (von Plasten)
Spritzgießen (von Plasten)
Spritzkopf eines Industrieroboters
Spritzmanipulator
Spritzmanipulator
Spritzroboter
Spritzroboterzyklus
Sprühpistoleneffektor
Sprung
Sprung
Sprungantwort
Sprungantwort sprungartige Änderung
sprungartige Geschwindigkeitsänderung
Sprungbefehl
Sprungbefehl
Sprungfunktion
Sprungfunktion
Sprungprogramm
particular system
specification of robot trajectory
specification specific shape of work piece specific shape of specific function
specific use specific impulse specified data byte
specified data byte spheroid operating space
mirror image operation (symmetrical switching)
backlash
robot gear with small play
adjusting of gripper play, gripper play adjusting
gripper drive free from play
robot gear free from play
theory of game
game theory spindle drive
grip organ point
peak data transfer rate
peak amplitude
peak load
peak pressure meter
peak energy
peak flux density
peak frequency
point contact
maximum output
peak signal
peak voltage
peak reverse voltage
peak inverse voltage
peak current
top technology
peak‐to‐zero voltage
crest value
peak value
peak magnetizing force
maximum demand indicator
peak time
double amplitude peak
peak‐to‐peak amplitude
language‐controlled robot
language analysis
robot language, IR language
language for automatic mechanical assembly
LAMA, language for automatic mechanical assembly
application control language, ACL
voice input
basic symbol of programming language
language operation
language memory, language store
language syntax
instantaneous contact
robot pressure tank
injection moulding, moulding by injection (of plastic material)
injection molding, molding by injection (US)
extruder head of industrial robot
manipulator for moulding by injection (of plastic material), US
paint spray manipulator, paint spray handler
paint spray robot
paint spray robot cycle
spray‐pistol effector
jump
step
step response
step response abrupt change
step velocity input
alternate instruction
jump instruction
jump function
step function
jump program
stran 264 od 326
EN ‐DE: slovar avtomatizacije in robotike Sprungschalter grande vitesse
Sprungschalter grande vitesse
Sprungschalter grande vitesse
Sprungvorschub
Spulensteigungsmaß
SRAM
SRAM
SRAM
stabile Daten pl
stabile Knotenpunktmenge
stabile Regelung
stabiler Knotenpunkt
stabiler Zustand
stabiler Zustand
stabiler Zustand
stabiles Bauelement
stabiles Bauelement
stabiles Bewegungsverhalten
stabiles Bewegungsverhalten
stabiles Element
stabiles Element
stabiles Leistungsniveau
stabiles System
Stabilisator
stabilisierendes Rückkopplungsnetwerk
Stabilisierschaltung
stabilisierte Stromversorgung
stabilisierte Stromversorgung
stabilisierte Stromversorgung
stabilisierter Gleichrichter
stabilisierter Supraleiter
Stabilisierung
Stabilisierungsdauer
Stabilisierungsstromkreis
Stabilisierungssystem
Stabilisierungszeit
Stabilität
Stabilität Stabilität automatischer Regelkreise
Stabilität der geschlossenen Schleife
Stabilität der periodischen Lösung
Stabilität des offenen Regelkreises
Stabilität im Großen
Stabilität im Großen
Stabilität im Kleinen
Stabilität im Kleinen
Stabilität Regeldifferenz
Stabilitätsabschätzung
Stabilitätsabschätzung
Stabilitätsanalyse
Stabilitätsanalyse
Stabilitätsbedingungen
Stabilitätsbedingungen erfüllende Lösung Stabilitätsbereichabgrenzung
Stabilitätsfehler
Stabilitätsgrad
Stabilitätsgrad
Stabilitätsgrenze
Stabilitätsgrenze
Stabilitätsgrenze
Stabilitätskriterium
Stabilitätskriterium
Stabilitätskriterium
Stabilitätskriterium von Hurwitz
Stabilitätskriterium von Popow
Stabilitätslinie
Stabilitätslinie
Stabilitätslösung
Stabilitätsprüfeinrichtung
Stabilitätsrand
Stabilitätsrand der Amplitude
Stabilitätsreserve
Stabilitätsresrve der Amplitude
Stabilitätsuntersuchung
Stabilitätsuntersuchung
Stabilitätsuntersuchung linearer Systeme
quick‐action switch
snap‐action switch
snap‐switch
intermitted feed
coil pitch
SRAM, static random access memory
static random access memory
SRAM stable data
stable node point quantity
stable control
stable nodal point
stable state
steady state
steady‐state regime stable component
stable element
stability behaviour of motion
stable behavior of motion
stable component
stable element
equilibrium power level
stable system
stabilizer
stabilizing feedback network
compensating network
stabilized current supply
regulated supply
stabilized power supply
regulated rectifier
stabilized superconductor
stabilization
stabilization time
stabilizing circuit
stabilization system
stabilization time
stability
static stability automatic control system stability
closed‐loop stability
periodic solution stability
open‐loop stability
stability in the large
global stability
stability in the small
local stability
steady‐state control error
estimation of stability
stability estimation
analysis of stability
stability analysis
stability conditions
solution satisfying stability conditions stability domain determination
stability error
degree of stability
stability degree
critical stability
stability limit
stability boundary
stability criterion
estimation of stability
stability estimation
Hurwitz stability criterion
Popov stability criterion
line of stability
stability line
steady‐state solution
stability check device
stability margin
amplitude stability margin
stability margin
amplitude stability margin
stability analysis
analysis of stability
linear system stability inverstigation
stran 265 od 326
EN ‐DE: slovar avtomatizacije in robotike Stabilitätsuntersuchung nach Bode
Stabilitätsuntersuchung nach Evans
Stabilitätsuntersuchung nach Evans
Stabilitätsuntersuchung nach Kochenburger
Stabilitätsuntersuchung nach Nyquist
Stabilitätsuntersuchung nach Nyquist
Stabilitätsverhalten
Stabilitätsverhalten von Zweifachregelkreisen
Stabilitätswahrscheinlichkeit
Stablängenbelastung
Stadium
Standard
Standard
Standardantwortspektrum
Standardauslegung
Standardausrüstung
Standardblock
Standardblock
Standardbussystem
Standardeinheit
Standardeinheit
Standardelemente
Standardgerät
Standardgleichgewichtspotential
Standardgreifer
Standardinterface
standardisierte Ausrüstung
standardisierte Elemente
standardisierte Greiffläche
standardisierte Makroinstruktion
standardisierte Roboterelemente
standardisierte Struktur
standardisierter Aufbau
standardisierter Baustein
standardisierter Greifer
standardisiertes Anwendungsprogramm
standardisiertes Bausteinsystem
standardisiertes Softwaresystem
Standardkoordinatensystem i
Standardmakroinstruktion
Standardmethode
Standardmodell
Standardprogrammausstattung
Standardregelkreis
Standardregelkreis
Standardresponsespektrum
Standardschnittstelle
Standardsoftware
Standardsoftwareauswahl
Standardvektor
Standardvereinbarung
Ständermanipulator
Ständerroboter
Standleitung
Standsicherheit
Stanzkode
Stanzleistung
Stapelbetrieb
Stapelbetriebssystem
Stapeljob
Stapelmontage
Stapelmontageprinzip
Stapeln
stapeln
stapelorientierter Rechner
Stapelpositionskoordinaten
Stapelprogramm
Stapelrechner
Stapelsumme
Stapelverarbeitung
stapelweise Jobverarbeitung
stapelweise verarbeiten
Stark‐Schwach‐Regelung
Stark‐Schwach‐Steuerung
starre Begrenzung
starre Kopplung
Bode method
method of Evans
Evans method
method of least squares
method of Nyquist
Nyquist method
stability behaviour
stability behaviour of two‐loop control systems
probability of stability
linear heat rate
stage
norm
standard
standard response spectrum standard design
standard equipment
standard block
standard unit
standard bus system
standard block
standard unit
standard elements, standardized elements
standard instrument
standard equilibrium potential
standard gripper, standardized gripper
standard interface
standardized equipment
standard elements, standardized elements
standardized grip surface
standardized] macroinstruction
standardized robot elements
standardized structure
standardized structure
standardized device
standard gripper, standardized gripper
standardized application program
standardized modular system
standardized software system
standard coordinate system
standardized] macroinstruction
standard method standard type
standard software
standard control circuit
standard control loop
standard response spectrum standard interface
standard software
standard software selection
default vector
default declaration (US)
support manipulator
support robot
direct line
static stability punch code
punch capacity
batch operation
batch operating system
batch job
stacking assembly
stacking assembly principle
stacking
store v
stack‐oriented computer
stacking position coordinates
batch program
stack computer
batch total
batch processing
stacked job processing, batched job processing
batch to
high‐low control
high‐low control
rigid limitation
proportional coupling
stran 266 od 326
EN ‐DE: slovar avtomatizacije in robotike starre Rückkopplung
starre Rückkopplung
starre Verkettung
starrer Finger
Starrkörperkoordinate
Starrkörperverschiebung
Startbedingungen
Startbedingungen
Startbit
Starten eines Roboterprogramms
Startimpuls
Startimpuls
Startimpulsverhalten
Startimpulswirkung
Startknopf
Startkontrolle
Startkopfzeichen
Startprogramm
Startprogramm
Startpunkt
Startrampe
Startrichtung
Startsignal
Start‐Stopp‐Betrieb
Start‐Stopp‐Taster eines IR
Start‐Stopp‐Übertragung
Starttaste
Starttextzeichen
Startvektor
Startwert
Startwert
Startzeit
Station eines Industrieroboters
stationär stationäre Lösung
stationäre Regeldifferenz
stationäre Robotermontage
stationäre Schwingung stationäre stochastische Einwirkung stationäre stochastische Funktion stationäre Zustandsbedingungen stationärer Funktionsumformer stationärer Iterationsprozess stationärer Kennwert stationärer Miniroboter
stationärer Programmträger
stationärer Prozess stationärer Reaktor stationärer Zustand
stationärer Zustand
stationäres Breitbandrauschen
stationäres Filter
stationäres Verhalten permanent
Stationärwert
Stationsbestimmung Stationssteuerblock
Stationssteuerblock statisch
statische Analyse statische Belastung
statische Berechnung statische Eichkurve statische Eichkurve statische Empfindlichkeit statische Genauigkeit
statische Instabilität statische Lichtempfindlichkeit statische Lösung statische Magnetspeicherung statische Optimierung statische Reaktivität
statische Reaktivität
statische Schaltung statische Sichtanzeige statische Temperatur
statische Umschalteinheit proportional feedback
rigid feedback
rigid linkage
rigid finger
rigid‐body coordinate
rigid‐body displacement
initial conditions
starting conditions
start bit
start of robot program, starting of robot program
initiating pulse
release pulse
starting‐pulse action
starting‐pulse action
start button
launch control
start heading character
start routine
starter, starting] program
start point
start‐up ramp
start direction
start signal, starting signal
start‐stop operation
start‐stop probe of (industrial] robot
start‐stop transmission
start key
start text character
start vector
start value
initial value
start time
robot station, industrial robot station
stationary steady state solution
steady state control error
stationary robot assembly
steady‐state oscillation stationary random action stationary random function steady‐state conditions stationary function converter stationary iterative process steady state characteristic stationary mini‐robot
stationary program carrier
stationary process stationary reactor steady state
steady‐state regime broadband stationary noise
time‐invariant filter
stationary behaviour conservative value
station identifikation station control block, SCB
station control block static
statics analysis static load[ing] static design static calibration curve
static calibrating plot
static sensitivity static accuracy
static instability static luminous sensitivity static solution static magnetic storage static optimization static reactivity
global reactivity static circuitry static display static temperature static switching unit stran 267 od 326
EN ‐DE: slovar avtomatizacije in robotike statische Zuordnung
statischer Arbeitspunkt
statischer Fehler
statischer Fehler
statischer Fehler
statischer Regler statischer Regler statischer Speicher mit wahlfreiem Zugriff
statischer Speicher mit wahlfreiem Zugriff
statischer Speicher mit wahlfreiem Zugriff
statischer Wirkungsgrad statischer Zustand statisches Analogongerät
statisches Einrichtmaß statisches Gleichgewicht
statisches Magnetlogikelement statisches System statisches Verhalten
statisches Verhalten Statistik Statistikprogramm
statistische Analyse statistische Analyse des Systems
statistische Auswertung
statistische Auswertung
statistische Bewertungen statistische Eigenschaft statistische Kompensation statistische Linearisierung statistische Nichtgleichgewichtsmechanik
statistische Schwingung
statistische Variable statistische Verarbeitung
statistische Verarbeitung
statistischer Faktor statistischer Test statistisches Modell des Systems statistisches Programm
Status
Status
Status der Geräteeinheit
Status der Geräteeinheit
Statusbit Statusbyte Statusrettungsschaltung
Statuswechsel
Statuswechsel
Staudruck
steckbar
steckbar
steckbar
steckbar
Stecker
Steckkontakt
Steckplan
Steckrelais
Steckverbindung
Steckvorrichtung
stehender Greiferständer
Steifigkeitsgrad
Steifigkeitskoeffizient
Steigerung Steilheit
Steilheit von Kennlinien
Stellantrieb
Stellantrieb
stellbarer Kontakt
Stellbereich
Stelleinheit
Stelleinheit
Stelleinheit
Stelleinheit
Stelleinheit
Stelleinheit positionneur
Stelleinrichtung
Stelleinrichtung
static allocation
quiescent point
position[ing] error
offset
steady‐state error
static controller
static regulator SRAM, static random access memory
static random access memory
SRAM static efficiency static regime static analog device
static setting dimension static balance
static magnetic logic element static system static behaviour
static performance statistics statistical program statistic analysis system statistical analysis
statistical treatment
statistical processing statistical estimations statistical property statistical compensation statistical linearization non‐equilibrium statistical mechanics
random vibration
statistical variable statistical treatment
statistical processing statistical factor statistical test statistical model of system statistical program state
status
device status
unit status
status bit status byte status‐saving hardware status change
state change stagnation pressure
pluggable
plug‐in
plug‐type
removable
plug
plug
plugging chart
plug‐in relay
plug connection
plug connection
vertical gripper support
degree of rigidity
stiffness coefficient
upgrade slope
slope of characteristics
actuator
motor element
adjustable contact
correcting range
actuating appliance
actuating unit
regulating element
effector
regulating unit
executive device
actuator
final control element
stran 268 od 326
EN ‐DE: slovar avtomatizacije in robotike Stelleinrichtung
stellenbewerteter Kode
Stellenergie
stellengerechte Anordnung Stellenschreibweise
Stellenverschiebung f
Steller
Stellgeschwindigkeit
Stellgeschwindigkeit
Stellgeschwindigkeit
Stellgeschwindigkeit
Stellgeschwindigkeit
Stellgeschwindigkeit
Stellglied
Stellglied
Stellglied
Stellglied für automatische Kontrolle
Stellglieder npi der Bewegungsachsen
Stellgröße
Stellgröße
Stellgröße
Stellgröße
Stellgröße
Stellgrößenänderung
Stellgrößengesetz
Stellknebel
Stellknebel
Stellkraftberechnung
Stellkrafterzeugung für Roboterbewegung
Stellmoment
Stellmotor
Stellmotor
Stellmotor
Stellmotor mit konstanter Geschwindigkeit
Stellmotor mit Kurbelantrieb
Stellorgan
Stellorgan
Stellorgan
Stellorgan
Stellorgan
Stellorgan
Stellort
Stellrelais
Stellservomechanismus
Stellsignal
Stellstrom
Stellübertragungsfunktion
Stellung des Steuergliedes
stellungsabhängiger Kode
Stellungsanzeiger
Stellungskodierer
Stellungsmelder
Stellungsmessgerät
Stellungsrückkopplung
Stellungsservosteuerung
stellungsunabhängiger Kode
Stellwerk
Stellwerk
Stellwerk
Stellwerk
Stellzeug
Sternschaltung
stetig
stetig geregeltes System
stetig verlaufende selbsttätige Messung
Stetigbahnsteuerung
Stetigbahnsteuerung
stetige Abhängigkeit
stetige Annäherung
stetige Flüssigkeitsstandmessung
stetige Funktion
stetige Größe
stetige Kurve
stetige Regelung
stetige Regelung
stetige Regelung
actuating device
weighted code
adjusting energy
after point alignment positional notation
arithmetical shift
final control element
adjusting speed
floating rate
control rate
floating speed
regulation speed
control speed
actuator
executive device
final control element, correction device
automatic checking actuating unit
final control elements of movement axes
actuating variable
actuating variable, control medium, manipulated variable
correcting variable
manipulated variable
actuating quantity
corrective action
law of regulating action
positioner
position mechanism
adjusting forces calculation
adjusting force generating (generation) of robot movement
adjusting moment
actuator
power cylinder
servomotor
constant‐velocity servomotor
level power cylinder
final control element
actuating appliance
actuating unit
regulating element
effector
regulating unit
point of control
valve positioner
position control servomechanism
actuating signal
controlling flow
actuating transfer function
regulating unit position
position‐dependent code
position indicator
position encoder
positional checking
position measuring instrument
position feedback
position servocontrol
position‐independent code
positioner
correcting unit
final control element
position mechanism
final control element
star connection
continuous
continuous control system
continuous automatic measurement
continuous path control
path control of [industrial] robot, path control of IR
continuous dependence
continuous approximation
continuous liquid level measurement
continuous function
continuous variable
continuous curve
continuous control
notchless control
infinitely fine control
stran 269 od 326
EN ‐DE: slovar avtomatizacije in robotike stetige Steuerung
stetige Steuerung
stetige Variable
stetige Zufallsgröße
stetiger Analysator
stetiges Fernmessverfahren
stetiges Reihenfolgeintervall
stetiges selbsttätiges Visko[si]meter continue
Stetigkeit
Stetigkeitsbedingungen
Stetigkeitsprüfung
Steuer‐ und Anzeigetafel
Steueralgorithmensimulation
Steuerautomat
Steuerband
Steuerband
Steuerband
Steuerband
Steuerband
Steuerband eines Industrieroboters
steuerbar
steuerbare Achse
steuerbare Koordinaten
steuerbare Koordinaten fpt
steuerbare Speicherzuweisung
steuerbarer Näherungssensor
steuerbares System
Steuerbarkeit
Steuerbarkeitsmatrix
Steuerbefehl
Steuerbefehl
Steuerbewegung
Steuerbus
Steuercharakteristik
Steuerdaten pl
Steuerdaten pl
Steuerdatengeneration
Steuerdatengeneration r*
Steuerdrehmelder
Steuerdrehmelder‐Differentialgeber
Steuerdrehmeldergeber Steuereingang
Steuereingangsignal Steuereinheit
Steuereinheit
Steuereinheit
Steuereinheit Steuereinheit Steuereinheit eines Industrieroboters
Steuereinheit für die Außenstation
Steuereinrichtung
Steuereinrichtung
Steuereinwirkung
Steuerelektrode
Steuerelektronik
Steuerelement
Steuerfläche
Steuerfluss
Steuerflussrechner
Steuerfolge
Steuerfunktion eines Industrieroboters
Steuerfunktionsoperation
Steuerfunktionsoperation
Steuergatter Steuergerät
Steuergerät
Steuergerät
Steuergerät
Steuergitter
Steuergitter
Steuergittereinsatzspannung
Steuergliedstellung
Steuergröße
Steuergröße
Steuergröße
Steuerhebel
continuous control
infinitely fine control
continuous variable
continuous random variable
continuous analyzer
continuous telemetring
constant repetition interval
continuous automatic visco[si]meter
continuity
continuity conditions
persistency checking
control and display panel
control algorithm simulation
control automaton
control tape, pilot tape
control tape
control band
pilot tape
regulation band
control tape of [industrial robot
controllable
controllable shaft
controllable coordinates
controllable coordinates
storage assignment control
controllable approximation sensor
controllable system
controllability
controllability matrix
control command
control word
controlling motion
control bus
control characteristic
control information
control data
control data generation
control data generation
control synchro
synchro‐control differential transmitter synchro‐control transmitter control input signal
control input signal
controller
control device
control unit
robot control unit
control unit of industrial robot
robot control unit, control unit of industrial robot
terminal control unit
control equipment
controlling system
control action
control electrode
control electronics
pilot cell
control area
control flux
control‐flow computer
control sequence
robot control function, IR control function
control function operation
control function operation, CFO
steering gate control appliance
controller
control device
control unit
control grid
signal grid
grid cut‐off voltage
regulating unit position
control quantity
controlling quantity
controlled variable
control lever
stran 270 od 326
EN ‐DE: slovar avtomatizacije in robotike Steuerimpuls
Steuerimpuls
Steuerimpuls
Steuerimpuls eines Manipulators
Steuerimpulsquelle
Steuerinformation
Steuerinformation Steuerinformation Steuerinstruktion
Steuerkammer
Steuerkapazität
Steuerkarte
Steuerkennlinie
Steuerknüppel‐Robotersteuerung
Steuerkode
Steuerkontakt
Steuerleistung
Steuerleitung
Steuerluft
Steuermakro
Steuermanipulator
Steuermanipulator
Steuermodus
steuern
Steuern (offene Wirkungskette)
Steuern des Werkstoffübergangs
Steuernachricht
Steuernachricht
steuernde Maschine
Steuerobjekt
Steuerobjekt
Steuerpaneel
Steuerpaneel
Steuerparameter
Steuerprogramm
Steuerprogramm
Steuerprogramm
Steuerprogramm für Objektherstellung
Steuerprogrammentwicklung
Steuerprozessor
Steuerpult
Steuerpult
Steuerpult
Steuerquittungsschalter
Steuerrechner
Steuerrechner für Gelenk
Steuerschalter
Steuerschaltkreis für Mikroprogramm
Steuerschaltkreis für Mikroprogramm
Steuerschaltung
Steuerschaltung
Steuerschaltung
Steuerscheibe
Steuerschmelzleiter
Steuerschütz
Steuersignal
Steuersignal
Steuersignale für Roboter
Steuersignalerzeugung
Steuersignalsender
Steuerspannung
Steuerspeicher
Steuerspeicher
Steuersprache
Steuersprache eines Industrieroboters
Steuerstrom
Steuerstromkreis
Steuersymbol
Steuertakt horloge Steuertastknopf
Steuerteil
Steuerübertragung
Steuerübertragung
Steuerumfang eines IR
Steuerung
Steuerung
actuating pulse
control pulse
driving pulse
manipulator control impulsion
source of control pulses
control information
control information
control data
control command
control chamber
control capacitance
control card
control characteristic
actuating rod for robot control, robot control by means of the control code
control contact
driving power
control line
control air
control macro
control manipulator
regulating circuit control manipulator
control mode
control v
open‐loop control
control of metal transfer
control message
command message
controlling machine
controlled device
controlled member
control board
control panel
controlled variable
control program
master program
steering program control program for object production
control program development
control processor
benchboard
console
operation console
acknowledging relay
control computer
joint control computer
control switch
microprogram control circuit
microprogram control circuit, microprogram control switchin
control circuit
steering circuit
driving circuit
control dial
initiating fuse element
contactor
actuating variable
influencing variable
control signals for robots
control signal generation
control transmitter
control voltage
control memory
control store
control language
robot command language, IR command language
drive current
pilot circuit
control symbol
control clock [pulse]
control scanning button
control section
control transfer
transfer of control
robot control circumference
control
guidance
stran 271 od 326
EN ‐DE: slovar avtomatizacije in robotike Steuerung
open‐loop control
Steuerung
guide
Steuerungfür Manipulationssysteme
control for manipulation systems
Steuerung auf Mikroprozessorbasis
microprocessor‐based control
hardware control
Steuerung der Gerätetechnik
Steuerung des Montagebandes
assembly‐line control
Steuerung durch Tonsprachen
tone language control
Steuerung einer Greiferhand
hand control of gripper
Steuerung eines Elektroantriebes mittels Drehverstärker
rotary amplifier control of electric drives
Steuerung eines Industrieroboters
robot control, industrial robot control
Steuerung für Datenkanal
data channel attachment
Steuerung für Manipulationssysteme
control for manipulation systems
Steuerung mit LSI‐Bausteinen
control by LSI‐modules, control by large scale integration mod
Steuerung nach Lage
positioning
one‐line control
Steuerung über eine einzelne Leitung
Steuerung über nicht geschlossene Schleife
non‐closed loop control
Steuerung von gespeicherten Daten
data storage control
Steuerungsalgorithmus
control algorithm
Steuerungsalgorithmus m
operation algorithm
Steuerungsanforderungen
control requirements
Steuerungsanforderungen
control needs
Steuerungsanpassungsbaustein
control adapter
Steuerungsantrieb
controlling motion
Steuerungsart eines Industrieroboters
control kind of industrial robot
Steuerungsaufgabe
control task
control equipment
Steuerungsausrüstung
Steuerungsausschalter
control cut‐off switch
Steuerungsbaustein
control module
Steuerungsbereich
control field
Steuerungsdaten pl
control data
control decentralization
Steuerungsdezentralisierung
Steuerungsempfindlichkeit
command resolution
Steuerungserfordernisse
control requirements
Steuerungserfordernisse
control needs
Steuerungsfolge
control sequence
master mode
steuerungsführende Betriebsart
master device
steuerungsführendes Gerät
master
steuerungsführendes Gerät
Steuerungsfunktion
steering function Steuerungshardware
control hardware
steuerungsinterne Funktion
control‐internal function
Steuerungsmerkmal eines Manipulators
control feature of manipulator
Steuerungsmodell
control model
Steuerungsmoment
controlling torque
Steuerungsmoment
driving torque
robot control operation, control operation of IR
Steuerungsoperation eines IR
Steuerungsoptimierung
control optimization
steuerungsorientierter Befehlssatz
control‐oriented instruction set
Steuerungsprotokoll
control protocol
control protocol
Steuerungsprozedurvorschrift
Steuerungsregel
control convention
Steuerungsregister
control register
Steuerungsrelaisstromkreis
control relay circuit
Steuerungssender
control transmitter
Steuerungssoftware
control software
Steuerungssystem eines Roboters
control system of robot
Steuerungssystem mit offener Schleife
open‐loop[ed] control system
Steuerungssystemaufbau
construction of the control system
control engineering
Steuerungstechnik
Steuerungstechnik
control technique
control‐technical equipment
steuerungstechnische Ausrüstung
steuerungstechnische Kopplung eines Maschinensystems
control‐technical coupling of machine system
steuerungstechnische Möglichkeiten
control‐technical possibilities
control‐technical connection
steuerungstechnische Verknüpfung
steuerungstechnischer Greiferaufwand
control‐technical gripper expense
steuerungstechnisches Merkmal
control‐technical feature (of manipulator generation)
steuerungstechnisches Merkmal (einer Manipulatorgeneratio control‐technical feature (of manipulator generation)
Steuerungstechnologien
control technologies
Steuerungstechnologien für Automaten
control technologies for automatons
Steuerungstechnologien für Roboter
control technologies for robots
Steuerungsunterbrecher
control cut‐off switch
control interruption
Steuerungsunterbrechung
Steuerungsunterscheidungsvermögen
command resolution
Steuerungsvektor
control vector
control action
Steuerungsverhalten
Steuerungsvorschrift
control convention
stran 272 od 326
EN ‐DE: slovar avtomatizacije in robotike Steuerungswirkung
Steuerungszentrale
Steuerverfahrensnetzwerk
Steuerverhältnis
Steuerwicklung Steuerwortfolge
Steuerwortspezifizierung
Steuerworttechnik
Steuerzeichen
Steuerzone
Steuerzustand
Steuung von Rauschstörungen
Stichprobe
Stichproben pro Sekunde
Stichprobenanalyse
Stichprobenprüfung
Stichprobenraum
Stiftmontage durch Industrieroboter
Stillsetzen eines Speichers
Stillsetzen eines Speichers
Stimmgabelsteuerung
Stimmgabelsteuerung
stochastisch
stochastisch gestörtes System
stochastische Approximation
stochastische Einwirkung
stochastische Elemente
stochastische Funktion
stochastische Hypothese
stochastische Simulation
stochastische Steuerung
stochastische Variable
stochastische Verteilung
stochastischer
stochastischer Automat
stochastischer Prozess
stochastischer Regelungsprozess
stochastischer Vektor
stochastisches Lernmodell
stochastisches Optimierungsverfahren
stochastisches System
Stoppbefehl
Stoppschalter
Stoppzeit
Stoppzyklus
Störabstand
Störanfälligkeit
Störanfälligkeit
Störbegrenzer parasites
Storben
Störbereich
Störbereich
Störbereich
Störbeseitigung
Störbewegungsstabilität
Störeffekte
Störeinwirkung
Störeinwirkung
Störeinwirkung
Störeinwirkung
stören
störende Kraft
störende Veränderliche
störende Veränderliche
störende Veränderliche
störende Veränderliche
Störfeldstärkemessgerät parasite
Störfrequenz
Störfunktion
Störgeräusch
Störgröße
Störgröße
Störgröße
Störgröße
Störgröße
Störgröße
control action
central control station
control process network
control ratio
control winding
sequence of control word
control word specification
control‐word technique
control character
control field
control state
noise dispersion
random sample
samples per second
sampling analysis
sampling test
sample space
robot pin assembly (mounting)
memory inactivation
inactivation of a memory
fork control
tuning fork control
random
stochastically disturbed system
stochastic approximation
random action
stochastic elements
random function
stochastic hypothesis
stochastic simulation
stochastic control
stochastic variable
random distribution
stochastic process
stochastic automaton
stochastic process
stochastic control process
random vector
stochastic learning model
stochastic optimizing method
stochastic system
breakpoint halt (instruction)
breakpoint switch
stopping time
stop cycle
noise margin
fault liability
susceptibility of failure
interference limiter
strobing
disturbance band
range of disturbance
disturbance range
debugging
stability of perturbed motion
parasitics
disturbance variable
disturbing variable
disturbance upset
disturbance quantity
noise v
disturbing force
disturbance variable
disturbing variable
disturbance upset
disturbance quantity
interference field strength measuring instrument
parasitic frequency
forcing function
background noise
disturbance input
disturbance quantity (variable)
disturbance variable
disturbing variable
disturbance upset
disturbance quantity
stran 273 od 326
EN ‐DE: slovar avtomatizacije in robotike Störgrößenaufschaltung
Störgrößenaufschaltung
Störgrößenbeobachtung
Störgrößeneinfluß
Störgrößeneinfluss
Störimpuls
Störimpuls
Störimpuls
Störkraft
Störmeldeprogramm eines IR
Störmeldung
Störpegel
Störpegelabstand
Störpegelabstand
störsicher
Störsicherheit
Störsignal
Störsignal
Störsignal
Störsignale eines Roboterantriebs
Störspannung
Störspannungsspanne
Störsperre
Störspitze
Störstellenleifähigkeit
Störstellenleitung
Störübertragungsfunktion
Störuchproblem Störung
Störung
Störung
Störung
Störung
Störung Störung Störung durch Einheitssprung
Störungsanalyse
Störungsanzeige
Störungsaufklärung
Störungsausbreitung
Störungsauswertung
Störungsbeseitigungseinrichtung
Störungsdauer perturbation
Störungseffekt
Störungserfassung
Störungsfehlerfunktion
Störungsfortpflanzung
störungsfrei
Störungsgebiet
Störungsgrad
Störungskoeffizient
Störungskompensation
Störungskompensierung
Störungskompensierung
Störungslokalisierung
Störungslokalisierung Störungsmeldung
Störungsmessgerät
Störungsrelais
Störungssuche
Störungssuche
Störungssucher
Störungstheorie
Störungsursache
Störungszustand
Störunterdrückung
Störverhalten
Störvorgang
Störvorgang
Störvorgang
Störvorgang
Stoßbeschleunigung
Stoßeinschaltstrom
Stoßkurzschlußstrom
Stoßspannungsschutz
Stoßstromhalteprüfung
disturbance variable compensation
feed forward control
disturbance observation
influence of disturbance variable
influence of disturbance variable
disturb[ing] pulse
interference pulse
noise pulse
disturbing force
disturbance message program of IR
alarm function
disturbance level
noise level
noise ratio
fail‐safe
noise immunity
disturbance signal
jamming signal
spurious signal
disturbing signals of robot drive
noise voltage
noise margin
noise gate
interference peak
impurity conductivity
extrinsic conduction
disturbance transfer function
trouble‐location problem disturbance
perturbation
interference effect
fault breakdown
interference
Coulomb friction [force]
dry friction
step unit disturbance
disturbance analysis
trouble indication
disturbance analysis
disaster propagation
disturbance analysis
clearing device
disturbance time
interference effect
disturbance registration
disturbance error function
disaster propagation
free of disturbances
interference area
degree of disturbance
perturbation coefficient
disturbance variable compensation
disturbance feedforward
disturbance superposition
trouble location
trouble location fault indication
interference measuring apparatus
interference relay
trouble shooting
failure detection
fault finder
perturbation theory
cause of disturbance
failure condition
disturbance rejection
disturbance response
disturbance variable
disturbing variable
disturbance upset
disturbance quantity
impact acceleration
peak making current
instantaneous short‐circuit current
impulse‐voltage protection
impulse current withstand test
stran 274 od 326
EN ‐DE: slovar avtomatizacije in robotike Stoßüberschlagspannung
Stoßwelle
Stoßwellenrücken
Strahlablenkung
Strahlabtastmethode
Strahleinstellung
Strahlenausbreitungsanalyse
Strahlendosimeter
Strahlenformierung
Strahlenintensität
Strahlenkopplung
Strahlenmesser
Strahlenmesskopf
Strahlenmesssonde
Strahlenmonitor
Strahlennachweis
Strahlungsdetektor rayonnement
Strahlungsdetektor rayonnement
Strahlungsdiagramm
Strahlungsdosimeter
strahlungsfest
Strahlungsflussdichte
Strahlungsindikator
Strahlungsindikator
Strahlungsmessdetektor
Strahlungsmesser
Strahlungsnullpegel
Strahlungspyrometer
Strahlungsvakuummeter
Streckenschutz mit direktem Vergleich
Streckenschutz mit Funkverbindung radiocommunication
Streckenschutz mit indirektem Vergleich
Streckensteuerung
Streifen
streifengesteuert
streifengesteuert
streng monoton
streuen
Streufrequenz
Streukopplung
Streulicht eines optischen Sensors
Streuung
Strobierung
Strobimpuls
Strobimpuls
Strobimpulsgenerator
Strobimpulsgenerator
Strobometrie
Stroboskop
stroboskopisches Verfahren
Strom von Handhabeobjekten
Stromanzeiger in Brückenschaltung
Stromaufweitung
Stromausbeute
Stromausfall
Stromausfallinterrupt
Strombegrenzung
Strombegrenzungsregelung
Strombelastbarkeit
Stromdichte
Stromempfindlichkeit
Stromfernmessgerät
Strom‐Frequenz‐Umsetzung
Strom‐Frequenz‐Wandlung
Stromgegenkopplung
stromgesteuertes Anlassen
stromgesteuertes Bauelement
Stromgewinn
Stromimpulsverstärker
Stromkreis
Stromkreis
Stromkreis mit direkter Wirkungsrichtung
Stromkreis mit Phasenverzögerung
Stromkreisanpassung
Stromkreisäquivalent
Stromkreisrauschmesser
impulse flashover voltage
impulse wave
impulse wavetail
beam deflection
beam‐scanning method
beam control
propagating beam analysis
radiation dosimeter
beam forming
beam intensity
beam coupling
actinometer
dosimetry probe
dosimetry probe
radiation monitor
detection of radiation
radiation indicator
radiation detector
radiation pattern
radiation dosimeter
radiation‐resistant
radiant flux density
radiation indicator
radiation detector
radiation measuring detector
actinometer
zero radiation level
radiation pyrometer
vacuum radiometer gauge
pilot protection with direct comparison
radio‐link protection
pilot protection with indirect comparison
section control
tape
tape controlled
tape operated
strongly monotonic
scatter v
scattering frequency
parasitic connection
diffused light of optical sensor
variance
strobing
gate pulse
gating pulse
strobe‐pulse generator
strobe‐pulse oscillator
strobometry
stroboscope
stroboscopic method
stream of handling objects
bridge detector
current spreading
current efficiency
power fail[ure]
power failure interrupt
current limit
current‐limit control
current‐carrying capacity
current density
current sensitivity
current telemeter
current‐to‐frequency conversion
current‐to‐frequency conversion
negative current feedback
current‐limit starting
current‐driven device
current gain
current pulse amplifier
current circuit
electric circuit
direct action circuit
lag network
adaptation of circuits
circuit analog
circuit noise meter
stran 275 od 326
EN ‐DE: slovar avtomatizacije in robotike Stromkreisunterbrecher
Stromkreiwähler
Stromquelle
Stromregelung
Stromregler
Stromregler
Stromrelais eines Roboters
Stromrichterschutz
Stromrichtung
Stromrückkopplung
Stromschutz
Strom‐Spannungs‐Charakteristik
Strom‐Spannungs‐Kennlinie
Stromspitze
Stromstabilisator
Stromstabilisator
Stromstoß
Stromstoß
Stromstoß
Stromübertragungsverhältnis
Strömung von Flüssigkeiten
Strömungsdichte
Strömungsrichtung
Strömungssensor
Stromverstärker
Stromverstärkungsfaktor
Strudelpunkt
Struktur
Struktur der Ziffern
Struktur des Rechnersystems
Struktur des Rechnersystems
Struktur eines digitalen Steuerrechners
Struktur feiner Koordinatentransformation
Struktur feines Montageroboters
Strukturanalyse
Strukturausgabe
Strukturauswahl
Strukturauswahl eines Greifers
Strukturbezeichnung eines Robotergreifers
Struktureingabe
Strukturelement
strukturell
strukturell stabiles System
strukturell unstabiles System
strukturelle Automatentheorie
strukturelle Eigenschaft
strukturelle Instabilität
strukturelle Kompatibilität
strukturelle Synthese
strukturelle Verträglichkeit
strukturelle Zuverlässigkeit
Strukturentwurf von Digitalrechnern
Strukturformel
Strukturgewicht eines Industrieroboters
strukturierte Programmierung
strukturierte Schaltung
strukturkinetische Einheit
Strukturmodell
Strukturmodell
Strukturmodellierung
Strukturmodellierung
Strukturoptimierung
Strukturparameter
Strukturparametermethode
Struktursimulator
Strukturstabilität
Strukturveränderung structurale
Strukturwandlung
ststionärer Wert
stückweise Approximation
stückweise lineare Approximation
stückweise lineare Kennlinie
stückweise stetige Funktion
stückweise stetige Funktion
Stufe
Stufe mit niedrigem Pegel
circuit‐breaker
circuit selector
current source
current control
current regulator
current stabilizer
current relay of robot
converter protection
current direction
current feedback
current protection
current‐voltage characteristic
voltage‐to‐current characteristic
current peak
current regulator
current stabilizer
current impulse
current pulse
current surge
current transfer ratio
liquid flow
flow density
direction of flow
flow sensor
current amplifier
current amplification factor
focus
structure
structure of digits
structure of computer system
computer system structure
digital control computer structure
structure of coordinate transformation
assembly robot structure, structure of assembly robot
structure analysis
structure output
structure selection
gripper structure selection
gripper structure designation (of robot)
structure input
structure element
structural
structurally stable system
structurally unstable system
structural theory of automata
structural property
structural instability
architectural compatibility
structure synthesis
architectural compatibility
structural reliability
digital computer structure designing
structural formula
robot structure weight
structured programming
structured circuit
structural‐kinetic unit
structural model
structure model
structure modelling
structure simulation
structure optimization
structural parameter
structure parameter method
structure simulator
structure stability
change of structure
structural change
conservative value
piecewise approximation
broken‐line approximation
piecewise linear characteristic
locally continuous function
piecewise continuous function
stage
low‐level stage
stran 276 od 326
EN ‐DE: slovar avtomatizacije in robotike stufenartiges System
Stufeneingangswirkung
Stufeneinwirkung
stufenlose Geschwindigkeitsregelung
stufenloses Regelgetriebe
Stufenregelung
Stufenregelung
Stufenschalter
Stufenverstärker
stufenweise Abstimmung stufenweise Korrelationsberechnung
Stützfunktion Stützmenge einer unscharfen Menge
Stützpunkt
subharmonische Resonanz
subharmonische Schwingung
subharmonischer phasengekoppelter Oszillator
Submodularphase
Suboptimierung
subpermanenter Magnetismus
Substitutionsbefehl
Substitutionsmodus
Subtraktionsimpuls
Suche
Suchfilter
Suchfunktion
Suchgerät
Suchkreis
Suchkreis
Suchoperation
Suchoperation
Suchposition feines IR
Suchprozess
Suchprüfung
Suchprüfung
Suchschaltung
Suchschaltung
Suchschrittmethode
Suchspeicher
Suchstrategie
Suchstrategie (eines Industrieroboters)
Suchtechnik
Suchtheorie
Suchverlust
Suchvorgang
Suchvorgang
Suchzeit
Summationselement
Summationsglied
Summationsglied
Summationskette
Summationskette
Summationspunkt
Summationsstelle
Summationsstelle
Summationsstelle
Summierrelais
Summierrelais
Summierungsregelung computer‐aided design facilities
Summierungsrelais
SUM‐MIN‐Inferenz
SUM‐PROD‐Inferenz
superkleiner Rechner
Superkleinstroboter
Superminirechner
Superposition Superpositionsprinzip
Superpositionsprinzip
Superpositionsprinzip
superreine Oberfläche
Supervision
Supervision
Supervision
Supraleitfähigkeit
Sylvester's Interpolationsformel Symbolik der Rechenmaschinen
cascade system
step input step input progressive speed control
infinitely variable speed gearing
step‐by‐step control
stepping control tapping switch
cascade amplifier
step‐by‐step tuning stepwise correlation calculation
supporting function support of membership function
point of support
subharmonic resonance
subharmonic oscillation
subharmonic phase‐locked oscillation
submodular phase
suboptimization
subpermanent magnetism
extract instruction
substitute mode
subtract pulse
research
detecting filter
locate function
search device
search circuit
finding circuit
searching operating
seek operation
robot search position, search position of IR
search process
search check
seek check
search circuit
finding circuit
hill climbing
search memory
search strategy
search strategy (of industrial robot)
searching technique
search theory
search loss
searching operating
seek operation
search time
summation point
summation element
summing element
adder circuit
summation circuit
summation point
adder
adding element
summator
averaging relay
integrating relay
compound control action
adding relay
sum‐min inference
sum‐prod inference
super‐minicomputer
super‐mini‐robot
super‐minicomputer
superposition principle of superposition
superimposing principle
superposition principle
micro‐cleaned surface
monitoring
verification
supervision
superconductivity
Sylvester's interpolation formula computer symbology
stran 277 od 326
EN ‐DE: slovar avtomatizacije in robotike symbolische Analyse symbolische Logik
symbolische Operation symbolischer Befehl symbolisches Gerät symbolisches Gerät symbolisches Programmier[ungs]system Symbolkombination eines IR‐Programms
Symbollogik Symbolsprache
Symboltabelle
symmetrische Ausgangsspannung
symmetrische Belastung
symmetrische Binomialverteilung symmetrische Funktion symmetrische Greifhilfe
symmetrische Impulse
symmetrische Klauenbewegung
symmetrische Leitung
symmetrische logische Funktion symmetrische Mischstufe
symmetrische Nichtlinearität symmetrische Schaltung
symmetrische Schaltung
symmetrische Schwingungen symmetrischer Ausgang
symmetrischer Binärkanal
symmetrischer Eingang
symmetrischer Gegentaktverstärker
symmetrischer Kode symmetrischer Phasendiskriminator
symmetrisches Gleichungssystem Symmetrisches Optimum
symmetrisches Signal
symmetrisch‐zyklisch magnetisierter Zustand
Synchro
Synchro
Synchrodifferentialsender m
Synchroempfänger
Synchronadapter
Synchronantrieb
Synchronausgabe
Synchronbetrieb
Synchrondetektor
synchrone Betriebsart
synchrone Betriebsweise
synchrone Bewegung (eines Greiforgans)
synchrone Datenleitungssteuerung synchrone Datenübertragung
synchrone Datenübertragung
synchrone Logik
synchrone Querimpedanz
synchrone Roboterbewegung
synchrone Übertragungsschnittstelle
Synchroneingabe
synchrones Folgesystem
synchrones optisches Netzwerk
synchrones Sequenzsystem
Synchronisation
Synchronisation zwischen Roboter und Peripherie
Synchronisationsimpuls synchronisation
Synchronisationsimpuls synchronisation
Synchronisationsimpuls synchronisation
Synchronisationspuffer
Synchronisationssignal
Synchronisationssignal Synchronisierkreis
synchronisierte Gesamtoperation
Synchronisierung
Synchronisierung der Maschinenarbeit
Synchronisierungsgruppe
Synchronisierungssatz
Synchronmanipulator
Synchronmodus
Synchronmotorantrieb
Synchronphasenschieber
symbolic analysis mathematical logic
symbolic operation symbolic instruction symbolic unit
symbolic device symbolic programming system symbolic combination of IR‐program
symbolic logic symbolic language
symbol table
balanced output
balanced load
symmetrical binomial distribution symmetrical function symmetrical grip aid
balanced pulses
symmetrical movement of claw
balanced line
symmetric logic function balanced mixer
symmetric non‐linearity balanced circuit
symmetrical circuit
symmetric oscillations balanced output
binary symmatric channel
balanced input
balanced push‐pull amplifier
symmetric code balanced phase discriminator
symmetrical equation system symmetrical optimum
balanced signal
symmetrically cyclically magnetized condition
selsyn
synchro
synchro‐control differential transmitter synchro‐torque receiver
synchronous adapter
synchronous motor drive
synchronous output
synchronous operation
synchronous detector
synchronous mode
synchronous working
synchronous motion (movement) (of grip organ)
synchronous data link control synchronous data transmission
synchronous data transfer
synchronous logic
quadrature‐axis synchronous impedance
synchronous robot movement
synchronous communication interface
synchronous input
synchronous serial system
synchronous optical network
synchronous serial system
synchronization synchronization between robot and periphery
dating pulse
master pulse
synchronization pulse
synchronization buffer
synchronization signal
synchronization signal lock[ing] circuit
synchronized total operation
synchronization machine‐operation synchronizing
synchronization unit synchronization unit Hand‐controlled manipulator, manual‐controlled manipulator
synchronous mode
synchronous motor drive
phase‐shifting transformaer
stran 278 od 326
EN ‐DE: slovar avtomatizacije in robotike Synchronspeicherungsverfahren
synchronous storage method
Synchrontakt
synchronous clock
Synchrontakt
synchronous tact
Synchrophasenverschieber synchro dephaser Synchrotrigonometer
synchro‐trigonometer
Synchrowinkelvergleicher
coincidence synchro
syntaktische Sprachanalyse
syntactic language analysis
syntaktischer Algorithmus
syntactic algorithm
Syntax einer Robotersprache
robot language syntax
Synthesator
synthesizer
Synthesator optimaler Systeme
optimum system synthesizer
Synthese der Parole
synthesis of parole
Synthese linearer einschleifiger Regelungssysteme
synthesis of linear single‐loop control systems
Synthese von Netzwerken
network synthesis
Synthese von Regelkreisen mit Prozessrechnern
synthesis of control systems with process computers
Synthese von Relaisanlagen
switching devices synthesis Syntheseverfahren
method for synthesis
System
system
System auf Interruptbasis
interrupt‐based system
System automatischer Optimierung
automatic optimization system
System der Basisvektoren eines ndimensionalen Zustandsrau basis for n‐dimensional state space
radio‐control system
System der Funkfernsteuerung
System der Objekterkennung
object recognition system, system of object detection
System der Objekterkennung
object recognition system
System der Objekterkennung
system of object detection
System entwerf er
system designer
System erster Ordnung
first order system
System kontaktloser Schaltung
system of contactless switching
System linear unabhängiger Lösungen
fundamental system
System logischer Gleichungen
system of logical equations
System mit angeschlossenem Prozessor
attached processor system
System mit automatischer Anforderung einer Wiederholung automatic request for repetition system
System mit automatischer Wiederholungsanforderung
request‐repeat system
System mit Dämpfung
system with damping
System mit digitaler Steuerung
digital control system
System mit direkter Steuerung
direct routing system
System mit einem Freiheitsgrad
system with one degree of freedom
System mit einem ruhenden Detektor
single‐stationary detector system
system with a simple position feedback
System mit einfacher Stellenrückführung
System mit Flankenspiel
system with play
System mit geschlossener Schleife
closed loop system
closed‐loop system
System mit geschlossener Schleife
System mit konstanter Stellgeschwindigkeit
constant‐velocity system
System mit konzentrierten Parametern
lumped parameter system
System mit mehreren Freiheitsgraden
system with several degrees of freedom
System mit Mehrfachfreiheitsgraden
multiple‐degree freedom system
System mit selbsttätiger Stabilisierung
automatic stabilization system
System mit stetiger Wirkung
continuous action system
System mit Totzeit
time‐lag system
System mit unmittelbarer gesteuerter Wahl
direct routing system
System mit veränderlicher Dämpfung
variable damping system
System mit verteilten Parametern
distributed parameter system
System mit verteilter Vermittlung
distributed switching system
System mit Zeitquantisierung
sampled‐data system
system with additional pressure feedback
System mit zusätzlicher Druckrückführung
System niedriger Leistungsaufnahme
low‐power system
System variabler Feldlänge
variable field length system
system engineering
System[entwurfs]technik
system technology
System[entwurfs]technik
Systemabsturz
abnormal system end
Systemabsturz
system crash
Systemanalyse
system analysis
Systemanteil
system part
Systemarchitektur
system architecture
Systematik von Zangengreifeinheiten
systematic of pincer grip units
Systematik von Zangengreifern
systematic of pincer grippers
systematic data checking
systematische Datenprüfung
systematische Klassifizierung
systematic classification
systematische Lösung
systematic solution
systematic software technique
systematische Softwaretechnik
systematischer Fehler
bias error
systematischer Fehler
systematic error
Systemaufbau
system architecture
Systemausgabeschreiber
system output writer
Systemberechnung
system calculaion
Systembeschreibung
system description
stran 279 od 326
EN ‐DE: slovar avtomatizacije in robotike Systembibliothek
Systemblockierung
Systemblockierung
Systemblockierungsbehandlung
Systembus
Systemdiagnose
Systeme zusammenarbeitender Rechner
Systemebene
System‐Element‐Relationen
Systementwerfer
Systementwicklung
Systementwurf
Systemfalle
Systemfrequenzgang
Systemfunktion
Systemgenerierung
Systemgestaltung
Systemgrenze
Systemhierarchie
Systemkompatibilität
systemkompatibles Gerät
Systemkomponente
Systemkonfiguration
Systemkonstruktion
Systemkonzeption
systemlogisches Gerät
systemlogisches Gerät
Systemlösung
Systemmatrix
Systemmittel
Systemmodell
Systemmodellierung
Systemordnung
System‐Output‐Writer
Systemparameter
Systemplanung
Systemplanung
Systemplanung
Systemprogramm
Systemprogrammierspräche
Systemprogrammierung
Systemprogrammpaket
Systemprüfung
Systemprüfung
Systemresidenz
Systemsicherheit
Systemsoftware
System‐Software
Systemsoftwarekomfort
systemspezifischer Speicherschaltkreis
Systemstabilitätsanalyse
Systemsteuerbaustein
Systemsteuersprache
Systemsteuerung
Systemstruktur
Systemtakt
Systemtestung
Systemtestung
Systemtheorie
Systemübertragungsfunktion
Systemumgebung
Systemumgebung
Systemunterlagenforschung
Systemunterlagenwartung
Systemvariable
Systemwiederanlauf
Systemwirksamkeit
Systemwirksamkeit
Systemzusammenbruch
Systemzusammenbruch
Systemzustand
Systemzuverlässigkeit
Szene eines Industrieroboters
Szenenanalyse/für einen Roboter
T1‐Element
T1‐Element
system lybrary
system deadlock
system interlock
deadlock handling
system bus
system diagnostic
concurrently operating computer systems
system level
system‐element‐relations
system designer
system development
system design
system trap
system frequency response
system function
system generation
system configuration
system boundary
system hierarchy
system compatibility
system‐compatible device
system component
system configuration
system design
system conception
system logical device
system logical unit
system approach
system matrix
system resource
system model
system simulation
system order
system output writer
system parameter
system engineering
system planning
system technology
system program
system programming language
system programming
system software
system check[ing]
system test[ing]
system residence
system security
system software
system software
comfort of system software
system memory chip
system stability analysis
system controller
system control language
system control
system structure
system clock
system check[ing]
system test[ing]
system theory
system transfer function
system environment
system surroundings
software research
software maintenance
system variable
system restart
efficiency of the system
system efficiency
system crash
abnormal system end
system state
system reliability
robot scene, scene of industrial robot
scene analysis of robot
dead‐time element, transport‐lag element
transport‐lag element, dead‐time element
stran 280 od 326
EN ‐DE: slovar avtomatizacije in robotike Tachogenerator
Tachogeneratorgenauigkeit
Takt
Takt
Takt
Takt[ier]ung
Takt[ier]ung
Taktausgang
Taktbetrieb
Takteingang
Takterzeugung
Taktgeberbetrieb
Taktgeberfrequenz
Taktgeberstufe
Taktgenerator
taktgesteuert
taktgesteuert
Taktierungsfehler
Taktierungsfehler
Taktierungskennwerte
taktile Folgeprogrammierung
taktile Programmierung
taktile Sensormatrix
taktile Sensorüberwachung
taktiler Arm (Roboterarm)
taktiler Robotersensor
taktiler Sensor
Taktimpuls
Taktimpulsgenerator
Taktimpulsübergang
Taktimpulsverteiler
Taktmontagestrecke
Taktperiode
Taktperiode
Taktregelung
Taktsignal
Taktsignalerzeugung
Taktzeit eines IR
Taktzyklus
Tangente
Tangentenbedingung
Tangentenmethode
Taschenrechnern!
Taskabnormalhalt
Task‐Auswahlmechanismus
Task‐Management
Task‐Steuerblock
tastaturgesteuert
Tastatursteuerlogik
Tastbetrieb
Tastbetrieb
tastenprogrammierbare Robotersteuerung
Tasterrelais
Tastgeber
Tastgeschwindigkeit modulation
Tastorgan
Tastsensor
Tastsensor eines Roboters
Tastsinn
Taststift
Taststift
Tastsystem
Tastverhältnis
Tastverhältnis
tatsächlich
tatsächliche Arbeitsstunden pl
tatsächliche Leistung
tatsächliche Prozesstemperatur
tatsächlicher Förderstrom
tatsächlicher Wirkungsgrad
Tauchsonde
Tauchsonde
Tauchsonde
Tauchthermostat
Tauchverfahren mittels Roboters
Tauchwanne
Tacho generator
accuracy of tacho‐generator
beat[ing]
pulsing
pulsation
timing
clocking
clock output
synchronous operation
clock input
timing generation
fixed cycle operation
clock frequency
clock stage
clock[‐pulse] generator
clock‐controlled
clock‐actuated
timing error
clocking error
timing characteristics
tactile sequence programming
tactic programming
tactile sensor matrix
tactile sensor survey
tactile arm, tactile robot arm
tactile robot sensor
tactile sensor
clock pulse
clock[‐pulse] generator
clock transition
clock pulse distributor
automated machine assembly line
clock period
tact period
timing control
clock signal
cycle signal generation
robot cyclic time, cyclic time of IR
clock cycle
tangent
tangent condition
tangents method
pocket calculator
task abnormal end
task selection mechanism
task management
task control block
keyboard‐controlled
keyboard control logic
inching [service]
jogging service
key‐programmable robot control
key relay
touch sensor, touching sensor
modulation rate
touching organ
touch sensor, touching sensor
touching sensor of robot
touch sense, touching sense
contact feeler
contouring tracer
sampled‐data system
break‐make ratio
duty ratio
effective
actual hours
actual capacity
actual process temperature
actual displacement
actual efficiency
depth probe
depth sound
immersion probe
immersion thermostat
dipping process by robot
dipping tank
stran 281 od 326
EN ‐DE: slovar avtomatizacije in robotike TAYLOR‐Reihe
Taylor‐Reihe
Teach‐in‐Programmiersystem
Teach‐in‐Programmierung (von Robotern)
Teach‐in‐Steuerung
Teach‐in‐Tableau
Teach‐in‐Verfahren
techn[olog]ische Bewertung
Technik technische Anforderung
technische Approximierung
technische Daten pl
technische Entwicklung
technische Grenzen
technische Kommunikationswissenschaften
technische Kommunikationswissenschaften
technische Lösung
technische Lösung technische Restriktionen
technische Stabilitätstheorie
technische Zeichnung
technische Zeichnung
technischer Entwurf
technischer Produktenentwurf
technischer Roboterparameter
technischer Sensor
technischer Universalroboter
technisches Regelsystem
technisch‐ökonomisches Modell der Montagetechnik
Technologie
Technologiebeschreibung
Technologiebeschreibungsdatei
Technologienahtstelle
technologische Ausrüstung
technologische Eigenschaft
technologische Einheit
technologische Hilfsausrüstung
technologische Kriterien
technologische Mehrkoordinaten‐Ausrüstung
technologische Mehrkoordinaten‐Ausrüstung
technologische Operation
technologische Roboteroperation
technologische Struktur
technologischer Befehl
technologischer Industrieroboter
technologischer Manipulator
technologischer Mehrkoordinaten‐Manipulator
technologischer Roboter
technologischer Variantenvergleich
technologisches Fließbild
Teilautomat
teilautomatischer Bearbeitungsvorgang
Teilautomatisierung
Teileablage
Teilebearbeitung
Teileeingabe
Teileentnahme
Teilefertigung
Teilelager
Teilelokalisierung
Teilepassungsanalyse
Teilepassungsanalyse
Teilereinigungsroboter
Teiletransportweg
Teilezuführung
Teilezuführung
Teilezuführung
Teilfunktion eines Roboters
Teilgerät
Teilinformation
Teilkonvergenz
Teillastbetrieb
Teilleseimpuls
Teilmontage eines Industrieroboters
Teilmontage feines Industrieroboters
Teiloperation
Taylor series
Taylor's series
teach‐in programming system
teach‐in programming (of robots)
teach‐in control
teach‐in‐tableau
teach‐in process
technical evaluation
cryogenics
technical requisition
engineering approximation
engineering data
engineering development
engineering constraints
communication engineering
engineering cybernetics
engineering solution
status‐saving hardware engineering constraints
theory of technical stability
technical drawing
mechanical drawing
engineering design
engineering product design
technical robot parameter
technical sensor
technical universal robot
technical control system
technology‐economic model of assembly technique
technology
technology description
technology description file
technology weld place
technological equipment
technological property
technological unit
technological auxiliary equipment
technological criteria
technological multi ‐coordinate equipment
technological multicoordinate equipment
technological operation
technological robot operation
technological structure
technological command
technologically used industrial robot
technological manipulator, technological handler
technological multi‐coordinate manipulator
technological robot
technological comparison of variants
engineering flow sheet
partial automaton
partially automated machining process
partial automatization
parts deposit (input)
parts machining
parts deposit (input)
parts taking
component fabrication
parts stock
parts localization, pieces localization
piece fit analysis
piece adjusting analysis
parts cleaning robot
parts transport route
alimentation of parts, feeding of parts
alimentation of parts
feeding of parts
partial function of robot
dividing device
partial information
incomplete convergence
partial‐capacity operation
partial‐read pulse
robot submounting
robot submounting
partial operation
stran 282 od 326
EN ‐DE: slovar avtomatizacije in robotike teilparallele Verarbeitungseinheit
Teilprozess
Teilprozess
Teilregelung
Teilschaltung
Teilschreibeimpuls
Teilstrom
Teilstruktur
Teilsystem einer Robotersoftware
Teilsystem einer Robotersteuerung
Teilsystem eines Industrieroboters
Teilsystem eines Roboters
Teilsystemsynchronisation
Teilsystemsynchronisation partikulärer Punkt
teilweise bestimmte Funktion
teilweise selektive Ausgabe
Teilwert
Teilzustandsrückführung
Telebeschickung (der gespeicherten Bibliothek)
Telemanipulator
Telemanipulator
Telemechanik
telemechanisches Schütz
Telemetrie
Telemetrie
Teleoperateur
telestatische Fernübertragungsausrüstung telestatische Steuerung Tellerspeicher
Temperatur der Anströmung
Temperaturabhängigkeit
Temperaturanomalie
Temperaturbedingungen
Temperaturbereich
Temperaturdetektor
Temperaturfehler
Temperaturfehler
Temperaturfühleinrichtung
Temperaturgeber
Temperaturgefälle
Temperaturgleichgewicht
Temperaturgradient
Temperaturkoeffizient
Temperaturkompensationsgrenzen
temperaturkompensiert
Temperaturkontrast
Temperaturkontrolle der Induktionserwärmung
temperaturorientierter Sensor
Temperaturprofil
Temperaturregeleinrichtung
Temperaturregler
Temperaturschwankung
Temperaturstabilisierung
Temperaturunterschied
Temperaturwandler
Temperaturwandler
Temperaturzustand
tensometrischer Apparat
Tensorarm eines Greifers
Termanalyse
Terminal
Terminal für Stapelverarbeitung
Terminal‐Job
Terminalmehrwegschalter
Terminalmultiplexer
terminalorientiertes System
Terminalprozessor
Termstruktur
Test bei reduzierter Betriebsspannung
Test der Prozessausgabe
Test der Prozesseingabe
Test des Informationstauschs
Test‐ und Kontrollpult
Testbefehl
Testbit
Testbit
semi‐partial processing unit
sub process
subprocess
selective adjustment
subcircuit
partial‐write pulse
branch current
substructure
partial system of robot software
partial system of robot control
partial system of robot, partial system of industrial robot, robo
partial system of robot, partial system of industrial robot, robo
partial system synchronization
partial system synchronization particular point
partially determined function
partial‐select output
particular value
output feedback
Tele‐charging (of stored library)
telemanipulator
Tele‐manipulator
telemechanics
telemechanic contactor
telemetering
telemetry
Tele‐operator
telestatic long range transmission equipment
telestatic equipment plate memory (store)
static temperature temperature dependence
temperature anomaly
temperature conditions
temperature range
temperature detector
temperature correction factor
temperature error
temperature detecting device
temperature transmitter
temperature gradient
temperature equilibrium
temperature gradient
temperature coefficient
temperature compensation limits
temperature‐compensated
temperature contrast temperature control of induction heating
temperature‐oriented sensor
temperature profile
temperature control equipment
temperature controller
temperature fluctuation
temperature stabilization
temperature contrast heat converter
temperature detector
temperature conditions
tensometric apparatus
tensor arm of gripper
energy‐level analysis
terminal
batch terminal
terminal job
terminal multiplexer
terminal multiplexer
terminal‐oriented system
terminal processor
level structure
marginal voltage check
test of process output
test of process input
test of information exchange
test and control console
test instruction
check bit
test bit
stran 283 od 326
EN ‐DE: slovar avtomatizacije in robotike Testdaten pl
Testeingangssignal
Testeinrichtung für mitlaufende Prüfung
Testhilfen
Testhilfshardware
Testhilfsmittel
Testhilfsmonitor
Testhilfsprogramm
Testkammer
Testmonitor
Testmuster
Testmustererzeugung
Testoperation
Testpunkt
Testsignal
Teststand
Teststand
Teststand
Teststand
Teststand m
Teststand m
Testsystem
Testsystem
Testsystem für integrierte Schaltkreise
Testung mittels Hardware‐Redundanz
Testverfahren
Testverfahren
Testverfahren
Testwerkzeuge
Testzeitraum
Textangabe
Textausgabefunktion
Texteingabefunktion
Textformulierung (einer Roboteranweisung)
Textilroboter
Textspeicher
textuelle Formulierung
textuelle Programmierung
textuelles Formulieren
textuelles Programmiersystem
Textverwaltungssystem
Theorem von Shannon
theoretisches Modell
Theorie der Abbildungen
Theorie der automatischen Steuerung
Theorie der Datenverarbeitung
Theorie der Digitalregelkreise
Theorie der Impulskreise
Theorie der Kodierung
Theorie der numerischen Behandlung
Theorie der Relaiseinrichtungen
Theorie der Relaiseinrichtungen
Theorie der Relaisschaltungen
Theorie der selbsttätigen Regelung
Theorie der Spiele
Theorie der Spiele
Theorie der zeitabhängigen Leistungskopplung
Theorie des Übergangszustandes
Theorie dynamischer Systeme
thermische Kompensation
thermische Leitfähigkeit
thermische Leitfähigkeit
thermische Oberflächenbehandlung
thermische Relais mit Temperaturkompensation
thermische Rückführung
thermische Sicherung
thermische Überlastbarkeit
thermische Zeitkonstante des Thermoumformers
thermischer Dissoziationsgrad
thermischer Leitwert
thermischer Prozess
thermischer Wirkungsgrad
thermisches Rauschen
thermisches Rechenelement thermochemischer Gasanalysator
Thermodrucker
test data
test input signal
online test facility
test aids
testing service hardware
test[ing] tools
testing service monitor
testing service program
test chamber
test monitor
test pattern
test pattern generation
test operation
test point
test signal
instrument table
test stand
test board
test table
pilot plant
experimental unit
test system
test system, TS
integrated circuit test system
hardware redundancy testing
checking procedure
test procedure
testing technique
test[ing] tools
test period
text specification
text output function
text input function
textual formulation
textile robot
alphanumeric store
textual formulation
textual programming
textual formulation
textual programming system
text management system, TMS
sampling theorem
theoretical model
theory of mapping theory of automatic control
data processing theory
digital control circuits theory
pulse circuits theory
coding theory
theory of numerical treatment
switching theory
theory of relay systems relay circuit theory
theory of automatic control
theory of game
game theory time‐dependent coupled power theory
transition state theory
theory of dynamics thermal compensation thermal admittance
thermal conductivity thermal surface treatment
compensated thermal overload relay
thermal feedback
thermal cut‐out
thermal overload capacity
thermal time constant of the thermal converter
degree of thermal dissociation
thermal admittance
thermal process heat effect
thermal noise
thermal computing element thermochemical gas analyzer
thermal printer
stran 284 od 326
EN ‐DE: slovar avtomatizacije in robotike Thermodrucker
Thermodrucker
Thermodynamik
thermodynamische Analyse
thermodynamische Beziehung
thermodynamische Eigenschaften
thermodynamische Funktionen
thermodynamische Koordinate
thermodynamische Wahrscheinlichkeit
thermodynamischer Prozess
thermodynamisches Gleichgewicht
thermodynamisches Potential
thermoelektrischer Komparator
Thermoelement
Thermoelemente für hohe Temperaturen
thermografisches Bild
Thermokontakt
Thermokreuzstrommesser
thermomagnetische Analyse
Thermometer mit verstellbarem Kontakt
Thermopaarstrommesser
Thermoregler
Thermoregler
Thermoregler
thermostatisch
thermostatische Regelung
thermostatische Sonde
thermostatischer Flüssigkeitsregler
thermostatischer Gasanalysator
thermostatischer Regler
thermostatischer Schließer
thermostatischer Sensor
thyristorgesteuerter Roboterantrieb
thyristorgesteuerter Robotermotor
Tiefendruckregistriergerät
Tiefpass
Tiefpassfilter
Tiefpassfilter in Regelkreisen asservis
Tieftemperaturanlage
Tieftemperaturbehandlung
Tieftemperaturbereich
Tieftemperaturbetrieb
Tieftemperaturelemente
Tieftemperaturtechnik
Tilgungswiderstand
Timeout
Timeout‐Betrieb
Time‐Sharing
Time‐Sharing
Time‐Sharing‐Terminal
Tippbetrieb
Tippbetrieb
Tippbetriebsteuerung
Tisch eines Industrieroboters
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
t‐Konorm
tmax‐Zeit
t‐Norm
t‐Norm
t‐Norm
t‐Norm
t‐Norm
t‐Norm
t‐Norm
t‐Norm
t‐Norm
Toleranz
electrothermic printer
thermoprinter
thermodynamics
thermodynamic analysis
thermodynamic relationship
thermodynamic properties
thermodynamic functions
thermodynamic coordinate
thermodynamic probability
thermodynamic process
thermodynamic equilibrium
thermodynamic potential
thermoelectric comparator
thermocouple
high‐temperature thermocouples
thermo graphical image
thermocontact
thermocouple ammeter
thermomagnetic analysis
adjustable electric contact thermometer
thermocouple ammeter
heat controller
heating controller
thermoregulator
thermostatic
thermostatic control
thermostatic probe
thermostatic liquid level control
thermostatic gas analyzer
thermostatic controller
thermostatic closing contact
thermostatic sensor
thyristor‐controlled robot drive
thyristor‐controlled robot motor
depth pressure recorder
low‐pass filter
low‐pass filter
low‐pass filters in control‐loops
low‐temperature plant
low‐temperature processing
low‐temperature field
low‐temperature operation
cryogenic elements
cryogenics
quenching resistance
timeout
timeout mode
timesharing
time division
timesharing terminal
inching [service]
jogging service
inching control
robot table, industrial robot table
s‐norm
s‐norm, t‐conorm, triangular conorm
algebraic sum
bounded sum
drastic sum
Einstein sum
Hamacher sum
Hamacher union operator
maximum function
t‐conorm
triangular conorm
peak time
t‐norm
algebraic product
bounded difference
drastic product
Einstein product
Hamacher intersection operator
Hamacher product
minimum function
triangular norm
tolerance
stran 285 od 326
EN ‐DE: slovar avtomatizacije in robotike Toleranz einer unscharfen Menge
Toleranzabweichung
Toleranzabweichungsausgleich
Toleranzfaktor Toleranzsystem Tonfrequenzmultiplexsystem
Tonfrequenzoszillator
Tonfrequenzverstärker
Tongenerator
tonnenförmiger Arbeitsraum
tonnenförmiger Arbeitsraum eines IR
tonnenförmiger Roboterarbeitsraum
Tonsignal
Tonsignal
Toröffnungsstufe
Torschaltung
Torschaltung
Torschaltung
Torschaltung
Torschaltung
Torschaltungslogik
Torsionsschwingungsdämpfer
Torsteuerung
totale Programmierung
Totalgewinn des Hohlraumes
toter Gang
toter Gang
totes Band
totes Band
Totgang
Totspeicher
Totspeicher
Totzeit
Totzeit
Totzeit
Totzeitelement
Totzeitelement
Totzeitkorrektur
Totzeitmodellierung
Totzeitsystem
Totzone (Lose
Totzone bei Dreipunktregler
Totzone bei einer Lose
Tourenzähler
tragbarer Mikrorechner
tragbares Datenerfassungsterminal
tragbares Terminal
Trageinsatz
Tragekapazitätsdaten
Träger (eines Schweißroboters)
Träger einer unscharfen Menge
Träger[strom]signal
Trägeramplitude
trägerfrequente Übertragung
Trägerfrequenz
Trägerfrequenzfernmessung
Trägerfrequenzkomponente
Trägerfrequenzrelais
Trägerfrequenzsignalübertragung
Trägerfrequenzspeiseanlage porteurs
Trägerfrequenzstreckenschutz
Trägerfrequenzverstärker
Trägerkanal
Träger‐Rausch‐Abstand
Träger‐Rausch‐Verhältnis
Trägerstrom
Trägerstromfernmessgerät
Trägerwelle
Trägerwellenverstärkung
Tragfähigkeit
Tragfähigkeit eines Industrieroboters
Trägheit
Trägheitsachse
trägheitsarmer Roboterantrieb
Trägheitskonstante
core of membership function
tolerance deviation
tolerance deviation compensation
tolerance factor tolerance system audio‐frequency multiplex system
audio‐frequency generator
audio‐frequency amplifier
audio‐frequency generator
barrel‐shaped working room
barrel‐shaped working room of industrial robot
barrel‐shaped working room of industrial robot
audio signal
sound signal
gating stage
gating stage
coincidence circuit
coincidence gate
gate [circuit]
gating circuit
gate circuit logic
torsional vibration damper
port controller
total programming
overall cavity gain
dead stroke
backlash
dead band
dead zone
backlash
fixed memory
permanent memory
dead time
transport lag
idle time
dead‐time element, transport‐lag element
transport‐lag element, dead‐time element
dead time correction
modeling of the transfer lag
time‐lag system
dead zone (relay, on‐off‐controller, amplifier), dead band (backlash nonlinearity
dead zone (relay, on‐off‐controller, amplifier)
dead band (backlash nonlinearity)
revolution counter
portable microcomputer
portable data collection terminal
portable terminal
portable use
supporting capacity data
support (of welding robot)
support of membership function
carrier current signal
carrier amplitude
carrier frequency transmission
carrier frequency
carrier telemetring
carrier wave component
carrier‐actuated relay
carrier‐frequency signal transmission
carrier wave supply equipment
carrier‐current protection
carrier‐frequency amplifier
carrying channel
carrier‐to‐noise ratio
carrier‐to‐noise ratio
carrier current
carrier‐current telemetering equipment
carrier wave
carrier wave amplification
load‐carrying capacity
robot load‐carrying capacity, industrial robot load‐carrying ca
inertia
axis of inertia
robot drive with little inertia
inertia constant
stran 286 od 326
EN ‐DE: slovar avtomatizacije in robotike Trägheitskraft
force of inertia
Trägheitskraft
mass force
Trägheitskraftgröße
size of inertia force
Trägheitskraftmoment
moment of force inertia
Trägheitslenkung
inertial guidance
Trägheitsmoment
moment of inertia
Tragkapazität
supporting capacity
Tragkraft
carrying capacity
carrying air
Tragluft
Trajektoriensollwert
trajectory nominal value
Trajektorieplanung
trajectory planning
Tran Sportpalette
pallet
Transceiver‐Kode
transceiver code
Transduktor
converter
Transduktor
transducer
Transduktor
transductor
Transduktortemperaturregler
magnetic amplifier temperature controller
transfer time
Transferzeit
Transformation
conversion
Transformation
converting
Transformation
transformation
Transformation
transforming
Transformationsmatrix
transform matrix
Transformationsmatrix
transformation matrix
transformation section
Transformationsstück
Transformator
transformer
Transformator mit Ferritkern
ferrite core transformer
transformieren
transform v
transformierte Gelenkreaktion
transformated joint reaction
Transistor
transistor
Transistorelektroantrieb
transistor electric drive
transistorgesteuert
controlled by transistor
transistorisierte Schaltbaukasteneinheiten
transistorized building‐block switching units
transistorisierter Integralverstärker
integral transistorized amplifier
transistor‐transistor logic
Transistor‐Transistor‐Logik
TTL
Transistor‐Transistor‐Logik
Transition
transition
Transitionsmatrix
transition matrix
Transitivität
transitivity
Translation
translation
Translationsachse
translations axis
Translationsachse eines Industrieroboters
translation axis of [industrial] robot
Translationseinheit
translation unit
Translationseinheit eines Greifers
translation unit of gripper
translatorische Greiferbewegung
translatory gripper movement
translatorische Robotergrundbewegung (IR‐Grundbewegung)translatory base movement of robot
translatorischer Greifer
translatory gripper
Transmissionsgrad
transmittance
Transmitter
transmitter
Transparenz
transparency
Transponierte einer Matrix
transpose of a matrix
transportables Programmiergerät
portable programming machine
Transportalgorithmus
transportation algorithm
Transportautomatisierung
transport automation
Transportband
conveying belt (for movement of party)
Transportband (zur Bewegung der Teile)
conveying belt (for movement of party)
Transportbandbewegung
movement of conveying belt
Transportgreifeinrichtung
transport grabbing equipment, transport grab device
Transportoperation
operation of transport
Transportoptimierung
transport optimization
Transportprüfung
feed check
Transportroboter
transport robot
transport technique
Transporttechnik
Transporttechnologie
transport technology
Transportvorrichtung
transport equipment, transport installation
transcendental equation
transzendente Gleichung
trapezoidal membership function
trapezförmige Zugehörigkeitsfunktion
trapezoidal approximation of integral
Trapeznäherung
treiben
drive v
Treiberstrom
drive current
Treiberstufe
driver stage
Treiberstufe
driving stage
Treiberstufe
driver
trennen
cut off v
Trennen (durch Roboter)
disconnecting (by robot)
Trennfrequenz
cut‐off frequency
stran 287 od 326
EN ‐DE: slovar avtomatizacije in robotike Trennfrequenz
Trennschalter
Trennschalter
Trennschärfe gegen Nachbarkanal
Trennstufe
Trennstufe
Trennung
Trennung
Trennungsvermögen
Trennungsvorgang
Trennverstärker
Trennzeit
trianguläre Konorm
trianguläre Konorm
trianguläre Norm
trianguläre Norm
Triebfeder
Trigger der Übertragung
trigonometrische Roboterfunktion
trigonometrischer Ausdruck
Trimmnachfolgesteuerung
Tri‐State‐Bauelement
Tri‐State‐Bauelement
triviales Problem
trockene Reibung
trockene Reibung
Trockensystem
Trocknungsprozess
Trocknungssystem
Trommelbunker
Trommelfahrschalter m
Trommelkontroller
Trommelschreiber
Trommelspeicher
Trübungsmesser
Tschebyscheffsche Approximation
Tschebyscheffsche Ungleichung
TTL
TTL
Tubenarm
Tüpfelanalyse
Tüpfelanalyse
turbolenter Energietransport Tustin Formel
Typ eines Fasersensors
Typemodell typische Vorwärtsverarbeitung über die Zeit gemittelt
Überabtastung
Uberanpassung
Überanpassung
überbeanspruchter Verstärker
überbestimmt
überbrücken
überbrücken
überbrückt
Überbrückungskontakte
Überdämpfung
Überdeckungsimpulse
Überdeckungsoperationen
Überdeckungsregelung
Überdeckungswirkung
Überdruck Überdrucklüftung
Überdruckspritzgefäss
übereiegender Wert
übereinstimmender Wert
Übereinstimmung
Übereinstimmung
Übereinstimmung
Übereinstimmungsgesetz
Überfrequenzschutz
Übergabepunkt
Übergabepunkt eines Manipulators
Übergabetechnik
Übergang
critical frequency
cut‐off
cut‐off switch
adjacent‐channel attenuation
buffer cascade
buffer stage
separation
separating
discrimination
separation process
buffer amplifier
cut‐off time
t‐conorm
triangular conorm
t‐norm
triangular norm
driving spring
carry flip‐flop
trigonometrical robot function
trigonometrical expression
automatic shim rod follow‐up [control]
three‐state device
tristate device trivial problem
Coulomb friction [force]
dry friction
dry system
dehydration process
dry system
drum bunker
drum controller
drum controller
drum recorder
drum store
nephelometer
Chebyshev approximation
Chebyshev inequality
transistor‐transistor logic
TTL
tube arm
spot analysis
drop analysis
turbulent energy transport Tustin's method
type of fiber sensor
type model typical forward processing time‐averaged
oversampling
overfitting
overrating
overdriven amplifier
inconsistent
bypass v
shunt v
shorted out
bridging contacts
overdamping
overlapping pulses
overlapping operations
overlap action
overlap action
superpressure pressure ventilation
high‐pressure tank
prevailing value
conformable value
accordance
concordance
coincidence
correspondence rule
overfrequency protection
transfer point
manipulator transfer point
transfer technique
transition
stran 288 od 326
EN ‐DE: slovar avtomatizacije in robotike Übergang vom unteren zum oberen Signalpegel
Übergangsbedingung
Übergangsbegrenzung
Übergangscharakteristik
Übergangscharakteristik
Übergangselement
Übergangserscheinung
Übergangserscheinung
Übergangsfrequenz
Übergangsfunktion
Übergangsgegenspannung
Übergangsgegenstrom
Übergangsgraf
Übergangsprozess
Übergangsprozessdauer
Übergangsprozesskurve
Übergangsprozesskurve
Übergangsrückstrom
Übergangssignal
Übergangsspeicher
Übergangsspeicher
Übergangsspeicher
Übergangsstrom
Übergangsverhalten
Übergangsverhalten
Übergangsvorgang
Übergangswahrscheinlichkeit
Übergangszustand
Übergangszustand
übergehen
übergehen
übergeordneter Rechner
Übergeschwindigkeitsbegrenzer
Übergruppenkontrolle
Überhitzeranlage
Überhitzungsgrad
Überhitzungsprozess
Überhitzungsschutz
Überholungsschleife
Überholungsstromkreis
überkritische Temperatur
überkritischer Druck
überlagernde Kodierungsmethode
überlagernde Verschlüsselungsmethode
überlagerte Regelung
überlagerte Regelung
überlagerte Störung überlagerter Schutz
überlagerter Schutz
Überlagerung
Überlagerung von aktivierten Regeln
Überlagerungsbereich
Überlagerungsfrequenz
Überlagerungsprinzip
Überlagerungsprinzip
Überlagerungsprinzip
Überlagerungssteilheit
Überlagerungsstruktur
Überlappen
überlappender Zugriff
überlappter Zugriff
Überlappungsoperationen
Überlast[ung]
Überlastbarkeit
überlasteter Verstärker
Überlastschutz
Überlastsicherheit
Überlastsicherung
Überlastsignal
Überlastung des Roboters
Überlastungsdetektor
Überlastungsmelder
Überlastungsregler
Überlastungsschutz
Überlauf
Überlaufanzeige
low[‐to]‐high transition
transient condition
performance limitation
transient performance
transient response
transition element
transient performance
transient response
cross‐over frequency
unit‐step response
reverse conduction voltage
reverse conduction current
transition graph
transient [phenomenon] transient time
transient characteristic
transient curve
reverse conduction current
transient signal
buffer memory
buffer storage
buffer store
transient current
transient behavior
transient behavior, transient response
transient [phenomenon] transition probability
transition regime
transient state
bypass v
shunt v
contention computer
overspeed limiter
major control
superheating plant
overheating degree
process of superheating
overheat control
leading circuit
leading circuit
supercritical temperature
supercritical pressure
superimposed coding method
superimposed coding method
cascade control
concatenated control
superimposed interference back‐up protection
reserve protection
overlay
aggregation
overlay area
conversion frequency
principle of superposition
superimposing principle
superposition principle
conversion transconductance
overlay structure
overlap
overlapped access
overlapped access
overlapping operations
overload[ing]
overload capacity
overdriven amplifier
overload protection
overload safety
overload fuse
overload signal
robot overloading
overload detector
overload detector
overload controller
overload protection
overflow
overflow alarm
stran 289 od 326
EN ‐DE: slovar avtomatizacije in robotike Überlaufkontrollsignal
Überlaufregister
Überlaufzahl
Über‐MAX‐Operator (alle t‐Konormen außer MAX)
Übernahmekontrolle
übernommen
übernommen
Überprüfung auf verbotene Kombinationen
Überregelungsfaktor
Überschlagspannung bei Kraftstromfrequenz
Überschreibungseinrichtung
Überschwellen‐Laserzustand Überschwingfaktor
Überschwingweite
Überschwingweite
Überschwingweite
Überschwingweite
Überschwingzeit
Übersetzen des Anwenderprogramms
Übersetzer
Übersetzer in maschinenorientierte Programme
Übersetzer in maschinenorientierte Programme
übersetztes Maschinenprogramm
übersetztes Objektprogramm
übersetztes Programm
übersetztes Programm
übersetztes Roboterprogramm
Übersetzungsprotokoll
Übersetzungsverhältnis
Übersichtsschema
Übersichtsschema
Überspannung
Überspannungsabschalten
Überspannungsgerät
Überspannungsgerät
Überspannungsschutz
Übersprechstörungen
Übersteuerung
Übersteuerungsanzeige surcharge
Überstromauslöser mit unabhängiger Zeitverzögerung
Überstromschutz courant
Übersynchronisierung
Übertrag
Übertrag
Übertrag
Übertragen
übertragen
Übertragen
Übertragen
Übertrager
Übertragsregister
Übertragsselbsthalteschaltung
Übertragsspeicherung
Übertragsstelle
Übertragsziffer
Übertragung
Übertragung der Drehbewegung
Übertragung der Steuerung
Übertragung der Steuerung
Übertragung großer Datenmengen
Übertragung zu mehreren Stationen
Übertragungsblock
Übertragungsblock
Übertragungsblock
Übertragungscharakteristik
Übertragungscharakteristik des Rückführungssystems
Übertragungsdämpfung
Übertragungseigenschaften
Übertragungselement
Übertragungsfehler
Übertragungsfehler
Übertragungsfunktion
Übertragungsfunktion
Übertragungsfunktion
Übertragungsfunktion Übertragungsfunktion des geschlossenen Regelkreises
overrun control signal
overflow register
capacity exceeding number
over max operator
acceptance control
accepted
accepted, ACC
forbidden‐combination check
overshoot ratio
power‐frequency flashover voltage
rewriting device
after‐threshold laser behaviour amplitude factor
maximum overshoot
maximum overshoot, overshoot
overshoot
transient overshoot
overshoot period
translation of user program
combiner
compiled program
compiler
compiled machine program
compiled object program
compiled program
object program
compiled robot program
translation record
ratio of transmission
layout plan
general plan
overvoltage
overvoltage tripping
overvoltage device
voltage limiter
overvoltage protection
cross noise
overload[ing]
overload warning system
definite time‐lag over‐current release
overcurrent protection
oversynchronization
carry
carry over
transfer
carry
transfer v
carry over
transfer
transmitter
carry register
carry latch
carry storage
carry digit
carry digit
transfer
circulation transmission
control transfer
transfer of control
bulk transmission of data
multiloop transmission
block
block, functional block
functional block
transfer characteristic
feedback‐system transient response
transmission loss
transmission properties
transfer element
transfer error
transmission error
carry‐over function
inverse transfer function
transfer function
actuating transfer function
closed‐loop transfer function
stran 290 od 326
EN ‐DE: slovar avtomatizacije in robotike Übertragungsfunktion des offenen Regelkreises
Übertragungsfunktion des offenen Systems
Übertragungsfunktion Regelkreises
Übertragungsgerät
Übertragungsgeschwindigkeit
Übertragungsgeschwindigkeit
Übertragungsglied
Übertragungskanal
Übertragungskanal
Übertragungskennlinie
Übertragungskontrolle
Übertragungskontrolle
Übertragungsleitung
Übertragungsleitung
Übertragungsmatrix
Übertragungsmatrix
Übertragungsmedium
Übertragungsoperation
Übertragungsprozedur
Übertragungsrate
Übertragungsrate
Übertragungsrichtung transmission
Übertragungsrichtung transmission
Übertragungsschnittstelle
Übertragungssteuerprogramm
Übertragungssteuerprogramm communication
Übertragungssteuerzeichen
Übertragungsstrom
Übertragungssystem
Übertragungssystem mit Wiederholung
Übertragungstechnik binärer Daten
Übertragungstechnik‐Anwendung
Übertragungsverfahren
Übertragungsverhältnis n
Übertragungsverhältnis n
Übertragungsverhältnis n
Übertragungsverzögerung
Übertragungsweg
Übertragungszeit
überwachen
überwachen
Überwachung
Überwachung
Überwachung
Überwachung Überwachung der Montagekräfte
Überwachung der Montagemomente
Überwachung eines Betriebszustands
Überwachung mit taktilem Sensor
Überwachung von Handhabungssequenzen
Überwachung von Handhabungssequenzen
Überwachung von Robotern
Überwachungsautomatisierung
Überwachungsautomatisierung Überwachungseinrichtung
Überwachungseinrichtung
Überwachungsfunktion
Überwachungsgerät Überwachungskontrolle
Überwachungspaket
überwachungspflichtige Anlage
Überwachungsprogramm
Überwachungsraum
Überwachungssensor
Überwachungssteuerung
Überwachungssystem
Überwachungssystem für IR
Überwachungssystem für lR
Überweisungsbefehl
u‐Drehbewegung
UHF‐Filter Uhrrelais
Ultrarotflüssigkeitsanalysator
Ultraschall Ultraschallabsorptionsmessung Ultraschallabtastgerät open‐loop transfer function
open‐loop transfer function
feedback transfer function
transfer device
transfer rate
transfer speed
transfer circuit
transmission channel
transfer channel
transfer characteristic
dump check
transfer check
transfer line
transmission line
transfer matrix
transfer‐function matrix
communication medium
transfer operation
communication procedure
transfer rate
transfer speed
direction of transfer
transmission direction
transmission interface
communication control program, CCP
communication control program
communication control character, CCC
convection current
communication system
request repeat system
binary data transmission technique
communication application
communication procedure
gear ratio
transfer ratio
transfer number
transfer lag
transfer path
transfer time
monitor v
verify v
monitoring
verification
supervision
operational condition monitoring
survey of assembly forces
survey of assembly moments
operational condition monitoring
tactile sensor survey
monitoring of sequential handling
monitoring of sequential handlings
surveillance of robots
monitoring automation
monitoring automation
verifying device
monitor
monitoring function
survey instrument supervisory control trace packet
plan subject control
monitor checking routine
control room
supervision sensor
supervision control
monitor system
robot supervision system
robot supervision system
move instruction
u‐rotary motion
ultrahigh‐frequency filter clock relay
liquid infrared analyzer
ultrasonics ultrasonic absorption measurement ultrasonic scanner stran 291 od 326
EN ‐DE: slovar avtomatizacije in robotike Ultraschallaufzeitglied n
Ultraschallaufzeitglied n
Ultraschalldetektor Ultraschallhochfrequenzmaschine
Ultraschallimpulsgenerator Ultraschallmaterialprüfgerät Ultraschallpegel
Ultraschallsensor
Ultraschallsensor Ultraschalltechnologie Ultraschallverzögerungsleitung
Ultraschallverzögerungsleitung
Ultrastabilität
Umdrehoperation bei Montage
Umdrehungsroboterarm
Umdrehungszähler
Umfangsregelung
Umfangsregelung
Umformer
Umformerempfindlichkeit
Umformung
Umformung
Umformung
Umformung
Umgebung
Umgebung
Umgebungsanforderungen
Umgebungsbedingung
Umgebungsbedingungen
Umgebungssimulation
Umgebungsstörungen
Umgebungstemperatur
Umgebungstemperaturinformationen
umgeformte Größe
umgeformtes Ausgangssignal
umgeformtes Eingangssignal
umgehen
umgehen
Umgehungsschaltung
Umgehungssystem
umgekehrte Amplituden‐Phasen‐Charakteristik
umgekehrte Betriebsweise
umgekehrte Folge
umgeschaltetes Fehlersignal
umgewandelte Ausgangsgröße
umgewandelte Eingangsgröße
umkehrbar
umkehrbarer Vorgang
umkehren
Umkehrfunktion
Umkehrgröße einer Variablen
Umkehrintegrator
Umkehrpunkt
Umkehrspannungserhöher
Umkehrsteuerelement
Umkehrsteuerung
Umkehrstufe
Umkodierer
Umkodierer
Umkodierer
Umladeoperation
Umlagern von Werkstücken
Umlagern von Werkstücken
Umlaufgeschwindigkeit
Umlaufintegral
Umlaufpotentiometer
Umlaufpufferspeicher
Umlaufpumpe
Umlaufregistern
Umlaufrichtung
Umlaufschalter
Umlaufspeicher
Umlaufspeicher
Umlaufsystem
Umlenkoperation feines Roboters
Umprogrammieren eines Industrieroboters
supersonic delay line
ultrasonic delay line supersonic detector high‐frequency alternator for ultrasonic transducer
ultrasonic pulse generator ultrasonic material testing apparatus ultrasonic level
ultrasonic sensor
ultrasonic sensor ultrasonic technology supersonic delay line
ultrasonic delay line ultrastability assembly revolution operation
revolute robot arm
circulation counter
band adjustment
range adjustment
transformer
converter sensibility
conversion
converting
transformation
transforming
environment
environs
environmental requirements
environmental condition
ambient conditions
environment simulation
ambient disturbances
ambient temperature
ambient temperature information
converted variable
converted output signal
converted input signal
bypass v
shunt v
bypass circuit
bypass system
inverse phase‐amplitude characteristic
inverted mode
inverse sequence
commutated error signal
converted output quantity
converted input quantity
reversible
reversible process
invert v
inverse function
reciprocal variable
inverse integrator
point of reversal
reversible booster
reverse‐acting control element
reversal control
inverter stage
code converter
code translator
transcoder
operation of transshipment
rearranging of work pieces
rearranging of workpieces
rotation[al] speed
circulation integral
circulation potentiometer
circular buffer memory
circulation pump
circulating register
circulation direction
rotary switch
circulating memory
circulating storage
circulation system
turning operation of robot
robot reprogramming, industrial robot reprogramming
stran 292 od 326
EN ‐DE: slovar avtomatizacije in robotike Umprogrammierung
reprogrammlng
Umrissfolgeregler
contour follower
Umrisssteuerung
contouring control
change‐over flexibility (of gripper)
Umrüstflexibilität
Umrüstflexibilität (eines Greifers)
change‐over flexibility (of gripper)
Umrüstung eines Roboters
change‐over of robot, resetting of robot
umschaltbar switchable Umschaltkontakt
change‐over contact
Umschaltkontakt
double‐throw contact
Umschaltkontakt
transfer contact
Umschaltkontakt
two‐way contact
Umschaltkontakt
alternating contact
Umschaltkontakt mit neutraler Stellung
double‐throw contact with neutral position
Umschaltkontrolle mit gleichzeitiger Zeitmessung
switching check with simultaneous timing Umschaltkreis
commutated network
Umschaltkreis
switching network
Umschaltkreis switching circuit Umschaltmotor
change‐speed motor
Umschaltregelautomatik commutation
automatic change‐over control
Umschaltsignal switching signal Umschalttor
change‐over gate
Umschalttor
commutation switch
Umschaltungskette
commutated network
Umschaltungskette
switching network
Umschaltzeit switching time
Umschaltzeit switching period
Umschaltzeit switch‐over time
umschreibbarer Steuerspeicher
writable control store
Umsetzer
converter
Umsetzer
transducer
Umsetzer
transductor
fuzzification
Umsetzung von scharfen Signalwerten in Zugehörigkeitsgrade von linguistischen Werten
conversion time
Umsetzungszeit
Umsteuergröße
modifier
umwandeln
convert v
Umwandler
converter
Umwandler
transducer
Umwandler
transductor
Umwandlerprogramm
converter program
Umwandlung
conversion
Umwandlung
converting
Umwandlung
transformation
Umwandlung
transforming
Umwandlung grafischer Darstellung in elektrische Spannungs graphical record converting into electric voltage wave
conversion unit
Umwandlungseinheit
Umwandlungsprogramm
transformation program
Umwandlungswirkungsgrad
conversion efficiency
conversion time
Umwandlungszeit
conversion loss
Umwandlungwerlust
Umwelt
environment
Umwelt
environs
Umweltdaten pi eines Roboters
environment data of robot
Umwelterfassung
environment acquisition
umweltgerechte Roboterkonstruktion
robot construction suitable to environment
Umweltmodell
environment model
Umweltmodelldaten pf
data of environment model
Umweltmodelldaten pl
data of environment model
Umweltsimulation
environment simulation
Umweltstabilität
environmental stability
Umweltstörgröße
environmental disturbance variable
unabhängig gesteuerte Antriebsbewegung
independent‐controlled drive movement
unabhängig programmierter Rechner
independent‐programmed computer
unabhängig verzögerter Auslöser
definite time‐limit release
unabhängig verzögerter Selbstunterbrecher
definite time‐lag circuit‐breaker
unabhängig verzögertes Relais
definite time‐lag relay
unabhängige
definite time lag
unabhängige
fixed time lag
unabhängige
permanent delay
unabhängige Antriebsbewegung
independent drive movement
unabhängige Armlängsbewegung
independent longitudinal movement of arm
unabhängige Betriebsweise
offline operation
unabhängige Konstante
non‐contiguous constant
unabhängige manuelle Operation
independent manual operation
unabhängige Regelung
independent control
unabhängige Roboterbewegungskontrolle
independent motion checking of robot
stran 293 od 326
EN ‐DE: slovar avtomatizacije in robotike unabhängige Veränderliche
unabhängige Zeitverzögerung
unabhängige Zeitverzögerung
unabhängige Zeitverzögerung
unabhängiger Handbetrieb
unabhängiges Dienstprogramm
unabhängiges Messinstrument
unabhängiges Programm
unabhängiges tragbares Gammaspektrometer
unabhängiges tragbares Gammaspektrometer
unabhängiges Zeitrelais
unabhängiges Zeitrelais
Unausgeglichenheit
unbedingt unbedlingter Sprung unbegrenzt unbegrenzt unbekannter Zustand unbelastet
unbelastet
unbelastet
unbemannte Fabrik
unbemannte Fertigung mit Robotern
unbemannte Fertigung mit Robotern
unbemanntes (selbständiges) Fahrzeug
unbenannte Zahl
unbenannter Koeffizient
unbeschränkt
unbeschränkt
unbeständiger Zustand
Unbeständigkeit
unbestimmtes Integral
Unbestimmtheitsbereich
Unbestimmtheitsdiagramm
Unbestimmtheitsfunktion UND‐Glied
undichtes Gehäuse
UND‐Operation
UND‐Schaltung
UND‐Schaltung
UND‐Tor
UND‐Tor
UND‐Verknüpfung
UND‐Verknüpfungsglied
unempfindlich
unempfindlicher Sensortyp
Unempfindlichkeit
Unempfindlichkeit
Unempfindlichkeit des Gliedes
Unempfindlichkeitsbereich
Unempfindlichkeitsbereich
Unempfindlichkeitszone
Unempfindlichkeitszone
unendlich
unendlicher Automat
unendlicher Stabilitätsgrad
unerlaubte Operation
unfaehig zu erlernen
Unfallschutz
ungedämpfte Frequenz
ungedämpfte Regelung ungelegene Betätigung
ungeordneter Teilevorrat
ungeordnetes Handhabungsobjekt
ungeordnetes HHO
ungerade Funktion
ungerade symmetrische Nichtlinearität
ungeradzahlige Harmonische
ungeregelt ungeregelte Gleichspannung ungerichteter Graph
ungesteuerte Fügebewegung
ungesteuerte Orientierungsbewegung
ungesteuerter Fügemechanismus
ungesteuerter Fügemechanismus ungestörtes dynamisches System
independent variable
definite time lag
fixed time lag
permanent delay
independent manual operation
independent utility program
self‐contained instrument
independent program
autonomous portable gamma‐ray spectrometer
independent portable gamma‐ray spectrometer
definite time‐lag relay
independent time‐lag relay
unbalance unconditional unconditional jump unbounded
boundless unknown state no‐charge
no‐load
nonchargeable
unmanned factory
unmanned production with robots
unmanned production with robots unmanned vehicle
abstract number
non‐dimensional coefficient
unbounded
boundless unsettled condition inconstancy
indefinite integral
zone of ambiguity
ambiguity diagram
uncertainty function AND‐element
leaky package
AND‐operation
AND‐circuit
AND‐gate
AND‐circuit
AND‐gate
conjunction
logical AND circuit
insensitive
insensitive sensor type
insensitivity
non‐sensitivity
non‐sensitivity of element
dead band
dead zone
dead band
dead zone
infinite
infinite automaton
infinite degree of stability
illegal operation
unable to learn (ro move, to change, … etc.) accident prevention
natural frequency
undamped control inopportune operation
disordered parts stock
disordered handling object
disordered handling object
odd function
odd symmetrical non‐linearity
odd harmonic
uncontrolled unregulated continuous voltage non‐directed graph
uncontrolled joint(ing) movement
uncontrolled orientation movement
uncontrolled joint(ing) mechanism
uncontrolled join[ing] mechanism free dynamic system
stran 294 od 326
EN ‐DE: slovar avtomatizacije in robotike ungestörtes Einersignal ungestörtes Nullsignal ungetaktet ungetaktetes System
ungezwungene Schwingung
ungezwungene Schwingung
ungezwungene Schwingung
ungezwungene Schwingung
ungezwungene Schwingung
ungleich
ungleichförmige Drehbewegung
ungleichförmiger heterostatischer
Ungleichförmigkeitsgrad
Ungleichförmigkeitsgrad
Ungleichgewicht
Ungleichimpuls ungleichmäßige Greiferbewegung
ungleichmäßiger Laserstrahl
ungültig machen
Unifizierung
Unifizierung
uniform unipolarer Mikrorechner
Unisensor
unitäre Transformation unité unité unité Universalanwendung
Universalelement universaler Labormessautomat
universales Baukastensystem Universal‐Fügemechanismus
Universalfunktionswandler Universal‐Gelenkroboter
Universalgreifer
Universalhilfsrelais Universalimpulsmodell Universalinterface für Peripherieanschluss
Universalkontrollgerät Universallabormessautomat
Universalmanipulator
Universalmanipulator Universalmaschine Universalmikroskop mit automatischer Belichtungsregelung
Universalprogrammgeber Universalprogrammierer für Roboter
Universalprüfroboter
Universalrechner
Universalregisterstruktur
Universalschnittstelle
Universalschnittstelle
Universalsteuerautomat mit freier Programmauswahl
universelle Manipulatoranwendung
universelle Manipulatoranwendung
universelle Peripherieschnittstelle
universelle rechner‐orientierte Sprache universelle Robotersteuerung
universelle Robotersteuerung universelle Sensorgeometrie
universelle Steuerung
universelle Steuerung universeller Algorithmus universeller Automat
universeller Automat
universeller Befehl universeller faseroptischer Sensor
universeller Industrieroboter
universeller IR
universeller Manipulatoreinsatz
universeller Manipulatoreinsatz
universeller Miniroboter
universeller Peripheriesteuerungs‐Schaltkreis
universeller Peripheriesteuerungs‐Schaltkreis
universeller Prozessor
universeller Prozessor undisturbed one signal undisturbed‐zero output unclocked system without clock
autooscillation
self‐oscillation
selfvibration
free oscillation
natural oscillation
unmatched non‐uniforme rotary movement
asymmetrical heterostatic circuit
degree of irregularity
irregularity coefficient
non‐equilibrium
unequal impulse non‐uniform gripper movement
non‐uniform laser beam
cancel v
standardization
uniformalization
uniform unipolar microcomputer
universal sensor
unitary transformation component part
construction unit
structural member
general‐purpose application
universal element universal measuring laboratory‐type universal aggregate system universal joint(ing) mechanism
universal function converter universal‐joint robot
universal gripper
universal auxiliary relay universal impulse model (of controlled system)
universal peripheral interface universal checking machine universal measuring laboratory‐type universal manipulator
universal manipulator universal machine universal microscope with automatic exposure
universal program transmitter universal programmer for robots
universal testing robot
general‐purpose computer
general‐register architecture
universal interface
general‐purpose interface
universal control automaton with free program selection
universal manipulator application
universal manipulator application universal peripheral interface universal computer‐oriented language universal robot command
universal robot command universal sensor geometry
universal control
universal control universal algorithm multipurpose automatic device
universal automaton
universal instruction universal fibre‐optical sensor
universal industrial robot
universal industrial robot
universal manipulator application
universal manipulator application universal mini robot
universal peripheral controller
UPC universal processor
universal processor stran 295 od 326
EN ‐DE: slovar avtomatizacije in robotike universeller Robotereinsatz
universeller Sensor
universeller Sensortyp
universeller Sensortyp universelles Entwicklungssystem universelles Greifergetriebe
universelles halbautomatisches Prüfgerät universelles Interface
universelles Interface
unklare Instruktion
unklare Programmierung
unklares Filtrierungssystem
unkohärente Analogmodulation
unkorrigierbarer Fehler
unkorrigierbarer Fehler
unkorrigierte Laufzeit
unkorrigierte Verzögerung
Unlösbarkeitsgrad
unmittelbare Regelung
unmodulierte Trägerwelle
unpaarig unpassendes Ansprechen
unpolarisiertes Relais
unregelmäßig
unregelmäßiger Kode
Unregelmäßigkeitsfaktor
unrichtige Operation
unscharfe Entscheidung
unscharfe Information
unscharfe Logik
unscharfe Menge
unscharfe Menge mit einem Wertepaar
unscharfe Menge mit einem Wertepaar
unscharfe ODER‐Verknüpfung
unscharfe Regel
unscharfe Relation (Beziehung)
unscharfe UND‐Verknüpfung
unscharfe Zahl
unscharfer Operator
unscharfes Robotermodell
unscharfes Schließen
unscharfes Schließen
unscharfes Schließen
unscharfes Schlussfolgerungssystem
unscharfes Schlussfolgerungsverfahren
unscharfes Schlussfolgerungsverfahren
unscharfes Schlussfolgerungsverfahren
unscharfes Schlussfolgerungsverfahren
unscharfes Schlussfolgerungsverfahren
unstabile Bewegung
unstabiler Brennpunkt unstabiler Grenzzyklus unstabiler Knoten unstabiler Regelvorgang Unstabilität
unstetig
unstetige Funktion
unstetige Größe
unstetige Regelung
unstetige Regelung
unstetige Wirkung
unstetiger Regler
unstetiger Regler intermittente
unstetiger Regler intermittente
unstetiger Regler intermittente
unstetiger Zustand unstetiges Glied
unstetiges Integrationsgetriebe
unstetiges Signal
unstetiges Signal
unstetiges System
unstetiges System
Unstetigkeit Unstetigkeitsstelle
unsymmetrische Massenkraft
unsymmetrische Modulation
universal robot application,
universal sensor
universal sensor type
universal sensor type universal development system universal gripper gear
universal semi‐automatic tester universal interface
general‐purpose interface
fuzzy instruction
fuzzy programming
fuzzy filtration system
incoherent analog modulation
unrecoverable error
uncorrectable error uncorrected delay uncorrected delay insolubility degree
direct control
unmodulated carrier unmatched inopportune operation
non‐polarized relay
irregular
irregular code
irregularity coefficient
incorrect operation
fuzzy decision
fuzzy information
fuzzy logic
fuzzy set
fuzzy singleton, singleton
singleton
fuzzy OR
fuzzy rule
fuzzy relation
fuzzy AND
fuzzy number
fuzzy operator
unsharp robot model
approximate reasoning
fuzzy inference
fuzzy reasoning
fuzzy inference system (FIS)
max‐prod inference
sum‐min inference
sum‐prod inference
Mamdani inference
max‐min inference
unsteady motion unstable focus unstable limit cycle unstable