Diapositivos-Aulas 6 e 7-Aminoácidos, péptidos e proteínas (cont.)
Transcrição
Diapositivos-Aulas 6 e 7-Aminoácidos, péptidos e proteínas (cont.)
LICENCIATURA EM BIOLOGIA DISCIPLINA BIOQUÍMICA Ano Lectivo de 2013/2014 Aula nº 6 28 FEV Ricardo Boavida Ferreira Laboratório 46 Aminoácidos, péptidos e proteínas (cont.) Proteínas: introdução. Breve referência às –Ómicas. Propriedades. Funções. Síntese e processamento. Níveis de estrutura das proteínas: estruturas de nível primário, secundário, terciário e quaternário. Estrutura supersecundária e domínios de estrutura. Níveis de estrutura supramoleculares: complexos multienzimáticos, ribossomas e unidades do citosqueleto. Desnaturação, agentes desnaturantes e enrolamento espontâneo de proteínas. Chaperones moleculares. Engenharia de proteínas. Material de estudo: diapositivos das aulas, bibliografia recomendada e textos de apoio. POLIPÉPTIDOS E PROTEÍNAS Polipéptidos Definição É um polímero de aminoácidos, sintetizado ou não na dependência da informação genética (isto é, em mono ou polissomas), ligados sequencialmente (isto é, cabeça-com-pés, ou grupo carboxilo grupo amina) uns aos outros por ligações peptídicas. Proteínas Definição São polímeros, constituídos por uma ou mais cadeias polipeptídicas, sintetizados nos complexos mRNAribossoma (isto é, em mono ou polissomas). Polipéptidos e outras associações de aminoácidos, quer naturais quer artificiais, que são sintetizados na ausência de ribossomas e sem o envolvimento directo de informação genética não são considerados proteínas. A palavra proteína tem a sua origem na palavra Grega Protos = Primeiro, realçando o papel que desempenham em todas as células vivas. Sendo polímeros de aminoácidos, são constituídas por C, H, O e N, podendo ou não conter quantidades variáveis de S, P e metais (ex: Zn, Cu, Fe, Mn, Mg, etc.). Apresentam massas moleculares que podem variar desde cerca de 5 kDa a mais de 2 MDa. A massa molecular de polipéptidos e proteínas é normalmente expressa em kDa Um polipéptido é um polímero de aminoácidos ligados uns aos outros por ligações peptídicas. Pode ser sintetizado quimicamente ou com base na informação genética, isto é, em mono ou polissomas. Uma proteína é um polímero ou mais de aminoácidos, sintetizado na dependência da informação genética, isto é, em mono ou polissomas. Assim, uma proteína pode ser constituída por um ou mais polipéptidos. A distinção entre oligopéptido e proteína depende do seu DP (grau de polimerização, do Inglês Degree of Polymerization). Considera-se proteína um polímero contendo uma massa molecular geralmente superior a cerca de 5 kDa, o que corresponde aproximadamente a 45 resíduos de aminoácidos. A insulina, por exemplo, é uma pequena proteína constituída por 51 resíduos de aminoácidos, com uma massa molecular de 5,8 kDa: Microfotografia de microscópio electrónico de transmissão do proteassoma da planta aquática lentilha de água menor (Lemna minor) É uma proteína com uma massa molecular de 700 kDa e um tamanho de cerca de 2 nm (500.000 vezes mais pequena que 1 mm). Em baixo está representado um esquema da sua estrutura. Funções e variabilidade. Como é que uma só classe química de compostos, as proteínas, basicamente constituídas por sequências diferentes do mesmo conjunto de 20 aminoácidos diferentes, pode desempenhar tantas e tão diversas funções como Grau de polimerização r: 20r = ~101,30r A rough estimate indicates that a cell from the bacterium Escherichia coli has about 5,000 different proteins. The human genome: 24,000 genes corresponding to 1.8% of our DNA (it is not understood why nature is so inefficient) The human body contains ~150 different cell types Human cells contains 7,000 to 8,000 different gene products (exceptions are brain and testes cells, which express 12,000 to 14,000 different gene products) Different protein molecules, alternative splicing and co- and post-translational modifications increase these numbers by several orders of magnitude. Questão: Se o genoma humano contém cerca de 24.000 genes, como pode o corpo humano ser composto por cerca de 106 proteínas diferentes? A rough estimate indicates that a cell from the bacterium Escherichia coli has about 5,000 different proteins. The human genome: 24,000 genes corresponding to 1.8% of our DNA (it is not understood why nature is so inefficient) The human body contains ~150 different cell types Human cells contains 7,000 to 8,000 different gene products (exceptions are brain and testes cells, which express 12,000 to 14,000 different gene products) Different protein molecules, alternative splicing and co- and post-translational modifications increase these numbers by several orders of magnitude. Questão: Se o genoma humano contém cerca de 24.000 genes, como pode o corpo humano ser composto por cerca de 106 proteínas diferentes? - Modificações pós-tradução das proteínas; - Splicing alternativo. The -Omics O genoma é a sequência completa de DNA de um organismo. Trata-se de um conceito estático ou dinâmico? A palavra genoma foi formada por analogia com cromossoma, a qual deriva das palavras Gregas cor + corpo (na realidade, se esta palavra tivesse sido bem formado, teria sido cromatossoma). Devido ao enorme sucesso dos projectos biológicos quantitativos de larga escala, tais como a sequenciação de genomas, o sufixo “-oma” tem sido utilizado num número crescente de outros contextos. A genómica é o estudo das funções e interacções dos genes de um genoma. First time in PubMed Temos, assim: gene genoma genómica 1932 proteína proteoma proteómica 1995 Proteínas libertadas para o exterior da célula secretoma secretómica 2000 lectina lectinoma lectinómica transcrito transcritoma transcritómica 1997 metabolito metaboloma metabolómica 1998 interacção de proteínas interactoma interactómica 1999 hidrato de carbono glicoma glicómica 1999 Oligossacáridos da face externa da membrana celular exoglicoma exoglicómica O transcritoma é o conjunto total de todos os mRNAs da célula que são transcritos sob uma determinada condição fisiológica e ambiental, tendo em consideração a abundância de cada um e, idealmente, incorporando os resultados do “splicing”. Trata-se de um conceito estático ou dinâmico? O proteoma, é o conjunto de proteínas expressas por um determinado tipo de célula, tecido, orgão or organismo, num dado estado fisiológico. O termo proteoma deriva de proteína e de genoma. Não toma, também, em consideração a abundância de cada uma. Trata-se de um conceito estático ou dinâmico? O translatoma é o conjunto total das proteínas da célula expressas num dado momento, tendo em consideração a abundância de cada uma. O metaboloma refere-se ao conjunto completo de metabolitos (sejam eles metabolitos primários ? ou metabolitos secundários ?, intermediários de vias metabólicas, hormonas ou outras moléculas envolvidas em processos de sinalização) que se encontram numa amostra biológica, como, por exemplo, um organismo. Trata-se de um conceito estático ou dinâmico? Metabolómica / metabonómica -Omes and -omics glossary & taxonomy Site: http://www.genomicglossaries.com/content/omes.asp Any active interaction between cells or between a molecule and a cell will result in an “–omics” alteration - Genomics; - Transcriptomics; - Proteomics; - Interactomics; - Lectinomics; - Metabolomics/Metabonomics; - Glycomics; - Exoglycomics. EM image of active protein synthesis in a polysome “Degrees of Freedom” for Protein Variability Covalent Modifications in Proteins • Post-translational modifications (e.g., phosphorylation, glycosylation, etc.) - more than 200 such modifications are known, and they can occur at multiple sites in a single protein • Alternative splicing of a primary transcript - in extreme cases, a single gene can produce tens of thousands of different mRNAs! • Proteolytic processing • Protein aging Thus, there are probably many millions of different proteins in our bodies!! More Reality for Proteins • They have “personalities”: each behaves differently • They exist in different concentrations, ranging over a million-fold • It will be extremely difficult to even identify them all (see previous slide) Take-home message: Proteomics presents challenges that are orders-of-magnitude more difficult than those presented by genomics! Síntese de proteínas O processamento ocorre após a tradução, ao nível do - Aminoacil-tRNA, - Cadeia polipeptídica nascente, - Cadeia polipeptídica completa, - Proteína. Determinação do “ribosome loading” 7-day-old Arabidopsis seedlings: Non-stress (NS)/hypoxia stress (HS) treatments (12 h). Tipos de processamento. Exemplos: - Enrolamento espontâneo da cadeia polipeptídica, a associação de cadeias polipeptídicas entre si e/ou com ligandos, para originar a conformação tridimensional nativa da proteína; - A modificação covalente dos aminoácidos proteicos, catalisada ou não por enzimas, para originar os aminoácidos raros das proteínas; - A ligação covalente de estruturas não proteicas, como hidratos de carbono (glicoproteínas), lípidos (lipoproteínas), ácidos nucleicos (nucleoproteínas), grupos heme (hemoproteínas), etc. - A hidrólise da pró-sequência, por proteólise limitada; Zimogénios; ex: proteases do aparelho digestivo: tripsinogénio/tripsina, , pepsinogénio/pepsina, quimotripsinogénipo/quimotripsina. - A hidrólise da pré-sequência ou sequência sinal, por proteólise limitada. The beauty of protein structure Normal prion (PrPC) 43% α-helix Abnormal, diseasecausing prion (PrPSc) 30% α-helix, 43% β-sheet “Lifeless" prion proteins, devoid of all genetic material, can evolve just like higher forms of life. Prions can change to suit their environment and go on to develop drug resistance. Jiali Li, Shawn Browning, Sukhvir P. Mahal, Anja M. Oelschlegel & Charles Weissmann (2010) Darwinian Evolution of Prions in Cell Culture. Science 327, 869-872. doi: 10.1126/science.1183218 Blad-153 Blad-169 Aparece truncada no resíduo Asn171 Blad-173 Blad-185 Hierarquias no estudo da estrutura das proteínas Dada a grande complexidade estrutural das moléculas proteicas, é frequente Considerar quatro níveis básicos na estrutura das proteínas: - Estrutura de nível primário; - Estrutura de nível secundário; - Estrutura de nível terciário; - Estrutura de nível quaternário. Como níveis de estrutura intermédios temos: - A estrutura de nível supersecundário; - Os domínios de estrutura. Acima da estrutura de nível quaternário podem considerar-se níveis de organização supramolecular como: - Complexos multienzimáticos; - Ribossomas - Elementos do citoesqueleto; ex. microtúbulos. Classificação das proteínas quanto à sua estrutura: - Fibrosas - Forma normalmente alongada - Funções típicas: estruturais e de suporte - Estrutura nativa conseguida essencialmente à custa das estruturas de nível primário e secundário. - Exemplos: colagénio, fibroína, elastina, queratinas - Globulares - Forma normalmente globular compacta - Funções típicas: funções biologicamente activas – enzimas, anticorpos, hormonas polipeptídicas - Estrutura nativa conseguida à custa das estruturas de nível primário, secundário, terciário e, por vezes, quaternário. - Exemplos: álcool desidrogenase, hemoglobina, insulina Estrutura de nível primário É definida pela sequência de resíduos de aminoácidos da cadeia polipeptídica. Esta sequência é, pelo menos em parte*, geneticamente determinada, pois está codificada no respetivo gene. Forças contribuintes: ligações covalentes. Qual o papel destas forças contribuintes a nível da - Aquisição deste nível de estrutura; - Estabilização e manutenção deste nível de estrutura? *Ter em atenção fatores como o alternative splicing e o processamento. Composição: - Esqueleto central da cadeia polipeptídica, com os seus grupos C=O e N-H, capazes de estabelecerem ligações de hidrogénio entre si, com moléculas de água do meio circundante ou com cadeias laterais de resíduos de aminoácidos. - Cadeias laterais de resíduos de aminoácidos, que podem ser apolares, polares e desprovidas de carga eléctrica ou com carga eléctrica positiva ou negativa. Podem, por isso, participar no estabelecimento de ligações persulfureto, de hidrogénio, electrostáticas, de Van der Waals ou em interacções hidrofóbicas, quer entre si, com moléculas de água ou com outras moléculas. Exemplos: Estrutura de nível primário da ribonuclease bovina The 51-residue polypeptide hormone insulin, which consists of two polypeptide chains joined by two disulfide bonds, is derived from a singlechain, 84-residue precursor named proinsulin. Proinsuline undergoes processing by limited proteolysis. However, only after its disulfide bonds have formed is proinsulin converted to the two chained active hormone by the specific proteolytic excision of an internal 33-residue segment known as its C chain. The C chain does not direct the folding of the A and B chains but rather, simply holds them together while they form their native disulfide bonds. Blad, a multifunctional, fungiphobic analeptic polypeptide from germinating Lupinus cotyledons 1 2 Sequência resíduos aminoácidos Blad Sequência de resíduos de aminoácidos do precursor da3 β–conglutina Sequência dede resíduos dede aminoácidos dada PROBLAD 5´MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEWQPRRQRPQSRRE MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEWQ 5´ MGKMRVRFPTLVLVLGIVFLMAVSIGIAYGEKDVLKSHERPEEREQEWQ PRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREERE EREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYSRRQRNPYHFSSQR PRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREERE QEQQQGSPSYSRRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNR FQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLNGRA QEQQQGSPSYSRRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNR LENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLNGRATITIVNPDRRQAY TITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTK LENLQNYRIVEFQSKPNTLILPKHSDADYVLVVLNGRATITIVNPDRRQAY 5´RRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEF NLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTK DQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQDEGVIVIVSKKQI NLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTK QSKPNTLILPKHSDADYVLVVLNGRATITIVNPDRRQAYNLEYGDALRIPA DQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQ QKLTKHAQSSSGKDKPSDSGPFNLRNEPIYSNKYGNFYEITPDRNPQVQDLNISLTYIKINEG DQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRRGQEQSDQ GSTSYILNPDDNQKLRVVKLAIPINNPGYFYDFYPSSTKDQQSYFSGFSR DEGVIVIVSKKQIQKLTKHAQSSSGKDKPSDSGPFNLRNEPIYSNKYGNF ALLLPHYNSKAIYVVVVDEGEGNYELVGIRDQQRQQDEQEEKEEEVIRYSARLSEGDIFVIPA DEGVIVIVSKKQIQKLTKHAQSSSGKDKPSDSGPFNLRNEPIYSNKYGNF NTLEATFNTRYEEIQRIILGNED 3´ YEITPDRNPQVQDLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYEL GYPISINASSNLRLLGFGINADENQRNFLAGSKDNVIRQLDRAVNELTFPGSAEDIERLIKNQ YEITPDRNPQVQDLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYEL VGIRDQQRQQDEQEEKEEEVIRYSARLSEGDIFVIPAGYPISINASSNLRLL QQSYFANGQPQQQQQQQSEKEGRRGRRGSSLPF 3´ VGIRDQQRQQDEQEEKEEEVIRYSARLSEGDIFVIPAGYPISINASSNLRLL GFGINADENQRNFLAGSKDNVIRQLDRAVNELTFPGSAEDIERLIKNQQQ GFGINADENQRNFLAGSKDNVIRQLDRAVNELTFPGSAEDIERLIKNQQQ SYFANGQPQQQQQQQSEKEGRRGRRGSSLPF 3´ 3´ SYFANGQPQQQQQQQSEKEGRRGRRGSSLPF 3 Ferreira, R.B., Monteiro, S., Loureiro, V. e Teixeira, A (2005) Proteína extraída de plantas do género 1 Monteiro, S.A., Freitas, R.M., Teixeira, A.N. E Ferreira, R.B. (2003) Lupinus albus β-conglutin precursor 2 Monteiro, Lupinus, sequência nucleotídica que a A.N. codifica e sua utilização no combate a fungos patogénicos por S.A., Freitas, R.M., Teixeira, e Ferreira, R.B. (2006) Stable protein intermediary of Lupinus mRNA. 1791 nucleótidos. Accession no. AY500372, GenBank. aplicação directa na forma ou por em plantas no. transgénicas. I.N.P.I., albus β-conglutin catabolism withrecombinante defense properties. 519expressão nucleótidos. Accession DQ142920, GenBank. http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=46451222 submissão nº 103322 F. Estrutura de nível secundário É difinida pela regularidade espacial de sequências de resíduos de aminoácidos. Forças contribuintes: ligações de hidrogénio, interacções electrostáticas e forças de Van der Waals Qual o papel de cada uma das forças contribuintes a nível da - Aquisição deste nível de estrutura; - Estabilização e manutenção deste nível de estrutura? Exemplos: Hélices Helices are the most striking elements of protein 2° structure. If a polypeptide chain is twisted by the same amount about each of its C atoms, it assumes a helical conformation. A helix may be characterized by the number, n, of amino acid units per helical turn and by its pitch, p, the distance the helix rises along its axis per turn. Several examples of he!ices are diagrammed below. Note that a helix has chip Examples of helices. These provide definitions of the helical pitch, p, the number of repeating units per turn, n, and the helical rise per repeating unit, d = p/n. Right- and lefthanded helices are defined, respectively, as having positive and negative values of n. For n = 2, the helix degenerates to a nonchiral ribbon. For p = 0, the helix degenerates to a closed ring. Note that a helix has chirality; that is, it may be either right handed or left handed (a right-handed helix turns in the direction that the fingers of a right hand curl when its thumb points along the helix axis in the direction that the helix rises). In proteins, moreover, n need not be an integer and, in fact, rarely is. If a particular conformation is to have more than a transient existence, it must be more than just allowed, it must be stabilized. The "glue“ that holds polypeptide helices and other 2° structures together is, in part, hydrogen bonds. A hélice α Can a polypeptide chain fold into a regularly repeating structure? To answer this question, Linus Pauling and Robert Corey evaluated a variety of potential polypeptide conformations by building precise molecular models of them. They adhered closely to the experimentally observed bond angles and distances for amino acids and small peptides. In 1951, they proposed two periodic polypeptide structures, called the α helix and β pleated sheet. The α helix is a rodlike structure. The tightly coiled polypeptide main chain forms the inner part of the rod, and the side chains extend outward in a helical array. The α helix is stabilized by hydrogen bonds between the NH and CO groups of the main chain. The CO group of each amino acid is hydrogen bonded to the NH group of the amino acid that is situated four residues ahead in the linear sequence: Models of a right-handed α helix: (A) only the α-carbon atoms are shown on a helical thread; (B) only the backbone nitrogen (N), α-carbon (C,,), and carbonyl carbon (C) atoms are shown; (C) entire helix. Hydrogen bonds (denoted in part C by ... in red) between NH and CO groups stabilize the helix. The right-handed α helix. Hydrogen bonds between the N-H groups and the C=O groups that are four residues back along the polypeptide chain are indicated by dashed lines. Stereo, space-filling representation of an α-helical segment of sperm whale myoglobin (its E helix), as determined by X-ray crystal structure analysis. In the main chain, carbon atoms are green, nitrogen atoms are blue, oxygen atoms are red, and hydrogen atoms are white. The side chains are yellow. All the main-chain CO and NH groups are hydrogen bonded. Each residue is related to the next one by a translation of 1.5 Å along the helix axis and a rotation of 100°, which gives 3.6 amino acid residues per turn of helix. Thus, amino acids spaced three and four apart in the linear sequence are spatially quite close to one another in an α helix. In contrast, amino acids two apart in the linear sequence are situated on opposite sides of the helix and so are unlikely to make contact. The pitch of the α helix is 5.4 Å, the product of the translation (1.5 Å) and the number of residues per turn (3.6). The screw-sense of a helix can be right-handed (clockwise) or left-handed (counterclockwise); the α helices found in proteins are right-handed. Only one helical polypeptide conformation has a favorable hydrogen bonding pattern: the α helix, a particularly rigid arrangement of the polypeptide chain. Its discovery through model building, by Pauling in 1951, ranks as one of the landmarks of structural biochemistry. For a polypeptide made from L-α-amino acid residues, the α helix is right handed with n = 3.6 residues per turn, and a pitch of 5.4 Å. An a helix of D-α-amino acid residues is the mirror image of that made from L-amino acid residues: It is left handed with n = -3.6 but with the same value of p. The hydrogen bonds of an α helix are arranged such that the peptide N - H bond of the nth residue points along the helix toward the peptide C=O group of the (n - 4)th residue. This results in a strong hydrogen bond that has the nearly optimum N ... O distance of 2.8 Å. In addition, the core of the α helix is tightly packed; that is, its atoms are in van der Waals contact across the helix, thereby maximizing their association energies. The R groups, whose positions all project backward and outward from the helix so as to avoid steric interference with the polypeptide backbone and with each other. Indeed, a major reason why the left-handed α helix has never been observed (its helical parameters are but mildly forbidden) is that its side chains contact its polypeptide backbone too closely. Note, however, that 1 to 2% of the individual non-Gly residues in proteins assume this conformation. The α helix is a common secondary structural element of both fibrous and globular proteins. In globular proteins, α helices have an average span of ~12 residues, which corresponds to over three helical turns and a length of 18 Å. However, α helices with as many as 53 residues have been found. Nota: a hélice α é direita quando, vista de cima, desce no sentido dos ponteiros do relógio. The α-helix content of proteins of known three-dimensional structure is highly variable. In some, such as myoglobin and hemoglobin, the α helix is the major structural motif. Other proteins, such as the digestive enzyme chymotrypsin, are virtually devoid of α helix. The single-stranded α helix discussed above is usually a rather short rod, typically less than 40 Å in length. A variation of the α-helical theme is used to construct much longer rods, extending to 1000 Å or more. Two or more α helices can entwine around each other to form a cable. Such α-helical coiled coils are found in several proteins: keratin in hair, myosin and tropomyosin in muscle, epidermin in skin, and fibrin in blood clots. The helical cables in these proteins serve a mechanical role in forming stiff bundles of fibers. The structure of the α helix was deduced by Pauling and Corey six years before it was actually to be seen in the x-ray reconstruction of the structure of myoglobin. The elucidation of the structure of the α helix is a landmark in molecular biology because it demonstrated that the conformation of a polypeptide chain can be predicted if the properties if its components are rigorously and precisely known. - O dipolo da hélice α - A formação da hélice α é um processo cooperativo - Hélices α anti-congelantes Other Polypeptide Helices Helix types and notations The hydrogen bonding pattern of several polypeptide helices. In the cases shown, the polypeptide chain is helically wound such that the N-H group on residue n forms a hydrogen bond with the C=O groups on residues n-2, n-3, n-4, or n-5. This figure shows how hydrogen bonded polypeptide helices may be constructed. The first two, the 2.27 ribbon and the 310 helix, are described by the notation, nm, where n, as before, is the number of residues per helical turn and m is the number of atoms, including H, in the ring that is closed by the hydrogen bond. With this notation, an α helix is a 3.613 helix. Comparison of the two polypeptide helices that occasionally occur in proteins with the commonly occurring α helix. (a) The 310 helix, which has 3.0 peptide units per turn and a pitch of 6.0 Å, making it thinner and more elongated than the α helix. (b) The α helix, which has 3.6 peptide units per turn and a pitch of 5.4 Å. (c) The π helix, which has 4.4 peptide units per turn and a pitch of 5.2 Å, making it wider and shorter than the α helix. The peptide planes are indicated. The right-handed 310 helix, which has a pitch of 6.0 Å, is thinner and rises more steeply than does the α helix. Its R groups experience some steric interference and this explains why the 310 helix is only occasionally observed in proteins, and then mostly in short segments that are frequently distorted from the ideal 310 conformation. The 310 helix most often occurs as a single-turn transition between one end of an α helix and the adjoining portion of a polypeptide chain. The π helix (4.416 helix), which also has a mildly forbidden conformation, has only rarely been observed and then only as segments of longer helices. This is probably because its comparatively wide and flat conformation results in an axial hole that is too small to admit water molecules but too wide to allow van der Waals associations across the helix axis; this greatly reduces its stability relative to more closely packed conformations. The 2.27 ribbon has strongly forbidden conformation angles and has never been observed. A folha pregueada β In 1951, L. Pauling and R. Corey discovered another periodic structural motif, which they named the β pleated sheet (β because it was the second structure they elucidated, the α helix having been the first). The β pleated sheet differs markedly from the α helix in that it is a sheet rather than a rod. The polypeptide chain in the β pleated sheet is almost fully extended, rather than being tightly coiled as in the α helix. The axial distance between adjacent amino acids is 3.5 Å, in contrast with 1.5 Å for the α helix. Another difference is that the β pleated sheet is stabilized by hydrogen bonds between NH and CO groups in different sections of the same or belonging to different polypeptide chains, whereas in the α helix the hydrogen bonds are between NH and CO groups in the same polypeptide chain. Adjacent strands in a β pleated sheet can run in the same direction (parallel β sheet) or in opposite directions (antiparallel β sheet). For example, silk fibroin consists almost entirely of stacks of antiparallel β sheets. Such β sheet regions are a recurring structural motif in many proteins. Structural units comprising from two to five parallel or antiparallel β strands are especially common. Folding patterns; Beta-pleated sheet β Pleated sheets. Hydrogen bonds are indicated by dashed lines and side chains are omitted for clarity. (a) The antiparallel β pleated sheet. (b) The parallel β pleated sheet. Nonrepetitive Structures Regular secondary structures (helices and β sheets) comprise around half of the average globular protein. The protein's remaining polypeptide segments are said to have a coil or loop conformation. That is not to say, however, that these nonrepetitive secondary structures are any less ordered than are helices or β sheets; they are simply irregular and hence more difficult to describe. One should therefore not confuse the term coil conformation with the term random coil, which refers to the totally disordered and rapidly fluctuating set of conformations assumed by denatured proteins and other polymers in solution. Globular proteins consist largely of approximately straight runs of secondary structure joined by stretches of polypeptide that abruptly change direction. Such reverse turns or β bends (so named because they often connect successive strands of antiparallel β sheets) almost always occur at protein surfaces; indeed, they partialIy define these surfaces. Most reverse turns involve four successive amino acid residues more or less arranged in one of two ways, Type I and Type II, that differ by a 1800 flip of the peptide unit linking residues 2 and 3. Both types of β bends contain a hydrogen bond, although deviations from these ideal conformations often disrupt this hydrogen bond. Type I β bends may be considered to be distorted sections of 310 helix. In Type II β bends, the oxygen atom of residue 2 crowds the Cβ atom of residue 3, which is therefore usualIy Gly. Residue 2 of either type of β bend is often Pro since it can facilely assume the required conformation. Reverse turns in polypeptide chains. (a) A Type I β bend. (b) A Type II β bend. Variations from these ideal conformation angles by as much as 300 are common. Hydrogen bonds are represented by dashed lines. Estrutura de nível terciário É difinida pelos enrolamentos e dobras da cadeia polipeptídica já com a estrutura de nível secundário, resultando das interacções das cadeias laterais dos resíduos de aminoácidos entre si e com as moléculas do meio circundante. No caso de muitas proteínas, pode dizer-se que é geneticamente determinada, pois depende directamente da estrutura de nível primário. Forças contribuintes: - Ligações de persulfureto (ligações covalentes); - Ligações de hidrogénio; - Interacções electrostáticas; - Interacções hidrofóbicas; - Forças de Van der Waals. Qual o papel de cada uma das forças contribuintes a nível da - Aquisição deste nível de estrutura; - Estabilização e manutenção deste nível de estrutura? Alguns tipos de forças responsáveis pela estrutura de nível terciário das proteínas: (I) – interacções electrostáticas; (II)- ligação de hidrogénio; (III)ligação de persulfureto (ligação covalente); (IV) - força de Van der Waals; (V) interacções de grupos polares com a água. Disulfide bridges A different set of forces are at work within the polypeptide molecule itself. Intra-molecular forces attract or repel parts of segments of the amino acid chain as the various R-groups are twisted into proximity with one another. The strongest of these intra-molecular forces is a covalent bond that forms, under the right circumstances, between the two R-groups of two cysteine amino acids. Many proteins that are secreted from cells, or find themselves on the surface of cells, are "spot welded" in places along their length by crosslinks formed between two sulfur containing amino acid R-groups. Disulfide bridges (also called "disulfide bonds" or "S-S- bonds") are strongly stabilizing, particularly if the protein is to be transported to the outside of the cell. It is thought that these kinds of crosslinks are not essential for creating the three-dimensional protein shape, but rather are used to hold them in the correct shape once it has formed. Chemical reducing agents can be used to break these crosslinks, snapping them open, without materially altering the overall shape of the protein. Disulfide Bridges Two Cysteine residues that are widely separated in the primary sequence can become covalently linked to form a disulfide brid Disulfide Bridges and Oxidation-Reduction The amino acid cysteine undergoes oxidation and reduction reactions involving the -SH (sulfhydryl group). The oxidation of two sulfhydryl groups results in the formation of a disulfide bond by the removal of two hydrogens. An unspecified oxidizing agent (O) provides an oxygen which reacts with the hydrogen (red) on the -SH group to form water. The sulfurs (yellow) join to make the disulfide bridge. This is an important bond to recognize in protein tertiary structure. The reduction of a disulfide bond is the opposite reaction which again leads to two separate cysteine molecules. Remember that reduction is the addition of hydrogen. Disulfide bridge reaction Ligações químicas por pontes de hidrogénio Ligação por pontes de hidrogénio entre o hidrogénio da água e o azoto do amoníaco Ligações por pontes de hidrogénio entre o oxigénio das moléculas de água Hydrogen Bonds Hydrogen Bonds Hydrogen bonds form when a hydrogen atom is covalently bonded to one electronegative atom (usually oxygen or nitrogen) and is simultaneously attracted to another electronegative atom. This attraction is the hydrogen bond (shown as dashed lines below). Electrostatic interactions, ionic bonds or salt bridges The tetrad salt bridge showing the distance in Å between the residues Ionic Bonds A charged R-group in one part of a polypeptide chain can attract an oppositely charged R-group in another part of the chain. The force of such an electrostatic attraction is the ionic bond, sometimes called a salt linkage, salt bridge, or electrostatic bond. Highlighting two salt bridges in hemoglobin tetramer (hemo group as sticks at bottom-right). Forças de van der Waals The Nobel Prize in Physics 1910 Johannes Diderik van der Waals Van Der Waals force is a weak attractive force between atoms or nonpolar molecules caused by an instantaneous dipole moment of one atom or molecule that induces a similar temporary dipole moment in adjacent atoms or molecules. In simple words, Van Der Waals forces are short range electro magentic forces that attract dust to surfaces, you may have noticed that your television screen gets dusty very quickly this is partly due to van der waals forces. van der Waals attraction. What is it? It is an electrostatic attraction between opposite charges. It is a weak force of attraction. Hydrophobic Interactions Non polar R-groups tend to cluster together in water. These weak associations are called hydrophobic interactions. When the polypeptide chain folds, the hydrophobic R-groups tend to be close to each other in the interior of the folded chain, whereas hydrophilic R-groups tend to be on the outside, attracted to water. The diagram below illustrates some hydrophobic interactions between Rgroups. Hydrophobicity of various amino acids. Hydrophobic Interactions The hydrophobic effect is the name given to those influences that cause nonpolar substances to minimize their contacts with water and amphipathic molecules, such as soaps and detergents, to form micelles in aqueous solutions. Since native proteins form a sort of intramolecular micelle in which their nonpolar side chains are largely out of contact with the aqueous solvent, hydrophobic interactions must be an important determinant of protein structures. The hydrophobic effect derives from the special properties of water as a solvent, only one of which is its high dielectric constant. In fact, other polar solvents, such as dimethyl sulfoxide (DMSO) and N,Nimethylformamide (DMF), tend to denature proteins. The thermodynamic data of the table below provide considerable insight as to the origin of the hydrophobic effect because the transfer of a hydrocarbon from water to a nonpolar solvent resembles the transfer of a nonpolar side chain from the exterior of a protein in aqueous solution to its interior. The isothermal Gibbs free energy changes ΔG = ΔH - T ΔS for the transfer of a hydrocarbon from an aqueous solution to a nonpolar solvent is negative in ali cases, which indicates, as we know to be the case, that such transfers are spontaneous processes (oil and water don't mix). What is perhaps unexpected is that these transfer processes are endothermic (positive ΔH) for aliphatic compounds and athermic (ΔH = O) for aromatic compounds; that is, it is enthalpically more or equally favorable for nonpolar molecules to dissolve in water than in nonpolar media. In contrast, the entropy component of the unitary free energy change, -T ΔS, is large and negative in all cases. Evidently, the transfer of a hydrocarbon from an aqueous medium to a nonpolar medium is entropically driven. The same is true of the transfer of a nonpolar protein group from an aqueous environment to the protein's nonpolar interior. What is the physical mechanism whereby nonpolar entities are excluded from aqueous solution? Recall that entropy is a measure of the order of a system; it decreases with increasing order. Thus the decrease in entropy when a nonpolar molecule or side chain is solvated by water (the reverse of the foregoing process) must be due to an ordering process. This is an experimental observation, not a theoretical conclusion. The magnitudes of the entropy changes are too large to be attributed only to changes in the conformations of the hydrocarbons; rather, as Henry Frank and Marjorie Evans pointed out in 1945, these entropy changes mainly arise from some sort of ordering of the water structure. Liquid water has a highly ordered and extensively H bonded structure. The insinuation of a nonpolar group into this structure disrupts it: a nonpolar group can neither accept nor donate H bonds, so the water molecules at the surface of the cavity occupied by the nonpolar group cannot H bond to other molecules in their usual fashion. In order to recover the lost H bonding energy, these surface waters must orient themselves so as to form an H bonded network enclosing the cavity. This orientation constitutes an ordering of the water structure, since the number of ways that water molecules can form H bonds about the surface of a nonpolar group is less than the number of ways that they can H bond in bulk water. The orientational preference of water molecules next to a nonpolar solute. In order to maximize their H bonding energy, these water molecules tend to straddle the inert solute such that two or three of their tetrahedral directions are tangential to its surface. This permits them to form H bonds (black) with neighboring water molecules lining the nonpolar surface. This ordering of water molecules extends several layers of water molecules beyond the first hydration shell of the nonpolar solute. Unfortunately, the complexity of liquid water's basic structure has not yet allowed a detailed structural description of this ordering process. The unfavorable free energy of hydration of a nonpolar substance caused by its ordering ot the surrounding water molecules has the net result that the nonpolar substance is excluded from the aqueous phase. This is because the surface area of a cavity containing an aggregate of nonpolar molecules is less than the sum of the surface areas of the cavities that each of these molecules would individually occupy. The aggregation of the nonpolar groups thereby minimizes the surface area of the cavity and therefore the entropy loss of the entire system. In a sense, the nonpolar groups are squeezed out of the aqueous phase by the hydrophobic interactions. Thermodynamic measurements indicate that the free energy change of removing a -CH2group from an aqueous solution is about -3 kJ/mol. Although this is a relatively small amount of free energy, in molecular assemblies involving large numbers of nonpolar contacts, hydrophobic interactions are a potent force. Walter Kauzmann pointed out in 1958 that hydrophobic forces are a major influence in causing proteins to fold into their native conformations. The amino acid side chain hydropathies (indexes of combined hydrophobic and hydrophilic tendencies; Table above) are, in fact, good predictors of which portions of a polypeptide chain are inside a protein, out of contact with the aqueous solvent, and which portions are outside, in contact with the aqueous solvent. ln proteins, the effects of hydrophobic forces are often termed hydrophobic bonding, presumably to indicate the specific nature of protein folding under the influence of the hydrophobic effect. You should keep in mind, however, that hydrophobic bonding does not generate the directionally specific interactions usually associated with the term "bond”. Residue number Hydropathic index pIot for bovine chymotrypsinogen. The sum of the hydropathies of nine consecutive residues (see table previous slide) are plotted versus the residue sequence number. A large positive hydropathic index is indicative of a hydrophobic region of the polypeptide chain, whereas a large negative value is indicative of a hydrophilic region. The bars above the midpoint line denote the protein's interior regions, as determined by X-ray crystallography, and the bars below the midpoint line indicate the protein's exterior regions. Protein folding To understand how protein structures form beyond the primary structure determined by the RNA sequence requires an understanding of the role of energy and hydrophobic interactions on the confirmation of the protein. While the hydrophobic/philic calculations of individual amino acids may seem tedious, it actually greatly helps in the process of determining protein structures. Though the process of protein conformation is not direct, and takes a variety of different routes, the overall pathway can be viewed as moving down a free energy “folding funnel”, a type of topological (3-D) energy map that traces a protein’s free energy as it assumes its conformation. As a protein proceeds in folding, and approaches its most energetically stable conformation, its free energy becomes lower and lower. A schematic of protein energy as it moves from its iniditial chaotic polypeptide strand state to the native state of the protein A 3-D visualization of the protein energy diagram as it moves from its high energy initial state, to its lowest energy native state. Again, there are numerous conformational routes and cul-de-sacs a polypeptide will confront, so a folding funnel has various peaks of free energy within its overall downward curve. Like all reactions, every step in a folding pathway requires a certain activation energy, and if this energy is not available, the polypeptide will stop folding and dead-end against one of the free energy hills in the folding funnel. Thus, the dips and peaks in the folding funnel, representing states of high free energy in the polypeptide, help indicate where major steps in the folding process start and stop. This information has been crucial in figuring out the individual mechanisms - such as secondary structure formation and hydrophobic interactions (see below) - by which polypeptides achieve their functional conformation. Though R group interactions provide specific conformations between individual amino acids, the hydrophobic interactions drives the larger-scale framework of the entire protein fold. The 20 amino acids are commonly divided into four categories: acidic, basic, uncharged polar, and nonpolar R groups - which can be further generalized into hydrophobic and hydrophilic. Ionic (acidic and basic) as well as heavily polar amino acids are soluble in polar water molecules, and are hydrophilic; nonpolar amino acids, which cannot form hydrogen bonds with water, are not soluble, and are hydrophobic. The black dots represent the hydrophobic domains of the polypeptide chain. When it moves to its native state, the hydrophobic domains try to bunch into the middle. In a real protein, this happens on a 3 dimentional scale, making predictions a bit more difficult. In lowering its free energy and travelling down the folding funnel, the polypeptide optimizes the most chemically stable interactions between hydrophobic and hydrophilic amino acids. Early on in the folding process, the hydrophobic amino acids aggregate in order to minimize the number of disrupted hydrogen bonds between water molecules, in the same way that oil droplets in water do. Because of their differing chemical natures, it is very energetically unfavourable for polar water molecules to come in contact with a large nonpolar surface area; the clumping of hydrophobic amino acids minimizes surface area, helping to avoid contact. To further complete the energetically favourable isolation from water, the aggregated amino acids undergo the “hydrophobic collapse”, where they are buried in the interior of the protein. The hydrophilic amino acids assume conformations on the exterior of the protein, where they are in contact with the water molecules. The hydrophobic collapse leads to an intermediate state in a protein’s conformation process known as a “molten globule”. The hydrophobic collapse is represented by a major, steep dip in the folding funnel, indicating how vital this step is to achieving a stable protein conformation. Hydrophobic interactions are among the few large-scale steps that are common to all protein conformation processes. They provide a stable, general outline for the following smaller-scale folding processes. The hydrophobic collapse definitely doesn’t deal with everything - there are certain amphipathic amino acids, such as alanine, that can be found in both the hydrophobic interior and hydrophilic exterior of a protein. Many alpha helix structures also form so that hydrophobic R groups extend off one side, and hydrophilic R groups the other, making the helix itself amphipathic. Despite exceptions, however, a polypeptide will run into countless energy barriers in folding if it cannot first undergo the hydrophobic collapse. Thus, proteins must be in an aqueous environment in order to carry out the most efficient conformation process possible. The folding funnel of a polypeptide in a non-aqueous environment. Note how the chaotic behaviour of the energy function serves as a barrier to further conformation change towards the native state. The folding funnel of a polypeptide in an aqueous environment. This time, the chaotic behaviour is absent. Representations of the X-ray structure of sperm whale myoglobin Jack bean protein concanavavalin A Human carbonic anhydrase Estrutura de nível quaternário É difinida pelo arranjo das subunidades individuais quando a proteína é constituída por mais de uma subunidade – proteína oligomérica. Por subunidade entende-se a unidade mais pequena cujos constituintes estão unidos por ligações covalentes. Assim, uma subunidade (monómero) pode ser constuída por uma ou mais cadeias polipeptídicas, desde que estejam ligadas por ligações persulfureto. As subunidades de uma proteína oligomérica podem ser todas do mesmo tipo (estrutura de nível quaternário homogéneo) ou de mais de um tipo (estrutura de nível quaternário heterogéneo). Forças contribuintes: - Ligações de hidrogénio; - Interacções electrostáticas; - Interacções hidrofóbicas; - Forças de Van der Waals. Qual o papel de cada uma das forças contribuintes a nível da - Aquisição deste nível de estrutura; - Estabilização e manutenção deste nível de estrutura? Subunidade versus cadeia polipeptídica: Onde está o erro? Estrutura de nível supersecundário Consiste numa série de elementos da estrutura de nível secundária ligados sequencialmente, não constituindo, no entanto, nem um domínio de estrutura, nem a estrutura de nível terciária completa. (a) Schematic diagrams of supersecondary structures. (a) A βαβ motif, (b) a β hairpin motif, (c) an αα motif, and (d) a Greek key motif, showing how it is constructed from a folded-over β hairpin. Domínios de estrutura Domínios de estrutura de uma cadeia polipeptídica são porções contíguas dessa cadeia que adquirem frequentemente a estrutura de nível terciária (isto é, se enrolam para a conformação nativa) em unidades locais compactas. Constituem um nível de complexidade estrutural entre a estrutura de nível secundária e a estrutura de nível terciária. Se uma proteína for composta por mais do que um domínio de estrutura, então os domínios adquirem a estrutura de nível terciária separadamente e o último passo no enrolamento da cadeia polipeptídica será a associação entre os domínios. Classificação dos domínios de estrutura The simplest way to catagorize domain structures is to classify them as - α domains, containing secondary structural elements that are exclusively α helices; - β domains, containing only β sheets; - α/β domains, containing both α helices and β sheets. The α/β domain category may be further divided into two main groups: - α/β barrels; - open β sheets. α domain: the globin fold, which contains 8 helices in two layers and occurs in myoglobin and in both the α and β chains of hemoglobin. ln another common all-α fold, two αα motifs combine to form a 4-helix bundle such as occurs in cytochrome b562. The helices in this fold are inclined such that their contacting side chains intermesh and are therefore out of contact with the surrounding aqueous solution. They are consequently largely hydrophobic. The 4-helix bundle is a relatively common fold that occurs in a variety of proteins. However, not all of them have the up-down-up-down topology (connectivity) of cytochrome b562. For example, human growth hormone is a 4-helix bundle with up-up-down-down topology. The successive parallel helices in this fold are, of necessity, joined by longer loops than those joining successive antiparallel helices. The α domain of (a) E. coli cytochrome b562 and (b) human growth hormone. The proteins are represented by their peptide backbones, drawn in ribbon form, in which the helices and their connecting links are colored, from Nto C-terminus, in rainbow order, from red to blue. Cytochrome b562‘s bound heme group is shown in balland-stick form with C magenta, N blue, O red, and Fe orange. The inset below each ribbon diagram is a topological diagram indicating the connectivity of the α helices in each 4-helix bundle. Cytochrome b562 (106 residues) has up-down-up-down topology, whereas human growth hormone (191 residues) has up-up-down-down topology. Note that the N- and C-terminal helices of human growth hormone are longer than its other two helices, so that, at one end, these longer helices associate as an αα motif. β domain: β domains contain from 4 to >10 predominantly antiparallel β strands that are arranged into two sheets that pack against each other to form a β sandwich. For example, the immunoglobulin fold, which forms the basic domain structure of most immune system proteins, consists of a 4-stranded antiparallel β sheet in face-to-face contact with a 3-stranded antiparallel β sheet. Note that the strands in the two sheets are not parallel to one another, a characteristic of stacked β sheets. The side chains between the two stacked β sheets are out of contact with the aqueous medium and thereby form the domain's hydrophobic core. Since successive residues in a β strand alternately extend to opposite sides of the β sheet, these residues are alternately hydrophobic and hydrophilic. The β domain of the immunoglobulin fold. The Xray structure of the Nterminal domain of the human immunoglobulin fragment Fab New shows its immunoglobulin fold. The peptide backbone of this 103-residue domain is drawn in ribbon form with its β strands represented by flat arrows pointing toward the C-terminus and colored, from N- to C-terminus, in rainbow order, from red to blue. The inset is the topological diagram of the immunoglobulin fold showing the connectivity of its stacked 4-stranded and 3stranded antiparallel β sheets. α/β domain: α/β barrels. In α/β domains, a central parallel or mixed β sheet is flanked by α helices. The α/β barrel is a remarkably regular structure that consists of 8 tandem β units (essentially 8 overlapping βαβ motifs) wound in a right-handed helical sense to form an inner 8-stranded parallel β barrel concentric with an outer barrel of 8 α helices. Each β strand is approximately antiparallel to the succeeding α helix and all are inclined at around the same angle to the barrel axis. Chicken triose phosphate isomerase (TIM), determined by David Phillips, consists of an α/β barrel. This is the first known structure of an α/β barreI, which is therefore also called a TIM barrel. The side chains that point inward from the α helices interdigitate with the side chains that point outward from the β strands. A large fraction (-40 %) of these side chains are those of the branched aliphatic residues Ile, Leu, and VaI. The side chains that point inward from the β strands tend to be bulky and hence fill the core of the β barrel (α/β barrels, with one known exception, do not have hollow cores). Those side chains that fill the ends of the barrel are in contact with solvent and hence tend to be polar, whereas those in its center are out of contact with solvent and are therefore nonpolar. Thus, α/β barrels have four layers of polypeptide backbone interleaved by regions of hydrophobic side chains. In contrast, both α domains and β domains consist of two layers of polypeptide backbone sandwiching a hydrophobic core. Around 10% of known enzyme structures contain an α/β barrel, making it the most common fold assumed by enzymes. Moreover, nearly all known α/β barrel proteins are enzymes. Intriguingly, the active sites of α/β barrel enzymes are almost all located in funnel-shaped pockets formed by the loops that link the C-termini of the β strands to the succeeding α helices and hence surround the mouth of the β barrel, an arrangement that has no obvious structural rationale. Thus, despite the observation that few α/β barrel proteins exhibit significant sequence homology, it has been postulated that all of them descended from a common ancestor and are therefore (distantly) related by divergent evolution. On the other hand, it has been argued that the α/β barrel is structurally so well suited for its enzymatic roles that it independently arose several times and hence that α/β enzymes are related by convergent evolution (i.e., nature has discovered the same fold on several occasions). The nature of the evolutionary relationships among the α/β barrel enzymes remains an open question. The X-ray structure of the 247-residue enzyme triose phosphate isomerase (TIM) from chicken muscle. The protein is viewed approximately along the axis of its α/β barrel. The peptide backbone is shown as a ribbon diagram with its successive βα units colored, from N- to C-terminus, in rainbow order, red to blue. The inset is its topological diagram (with α helices represented by rectangles). α/β domain: open β sheets. Examples of open β sheet may be encountered in the structures of the enzymes lactate dehydrogenase (N-terminal domain) and adenylate kinase. Such folds consist of a central parallel or mixed β sheet flanked on both sides by α helices that form the right-handed crossover connections between successive parallel β strands. X-Ray structures of open β sheet-containing enzymes. (a) Dogfish lactate dehydrogenase, N-terminal domain (residues 20-163 of this 330-residue protein) and (b) porcine adenylate kinase (195 residues). The peptide backbones are shown as ribbon diagrams with successive βα units colored, from N- to C-terminus, in rainbow order, red to blue. In Part b, structural elements that are not components of the open β sheet are gray. The insets are topological diagrams of these proteins, with the thin black vertical arrows marking their topological switch points. Níveis de organização supramolecular - Complexos multienzimáticos; - Ribossomas; - Elementos do citosqueleto – ex: microtúbulos. Desnaturação de proteínas É a alteração estrutural das moléculas dos biopolímeros que destrói a sua conformação nativa, essencial à expressão da sua atividade biológica. Em estruturas oligoméricas, a desnaturação pode envolver também a dissociação das moléculas nos seus protómeros, com ou sem alteração da conformação destes. É normalmente produzida por temperaturas elevadas, por valores extremos de pH ou por compostos químicos (como, p. ex., ureia, detergentes, metais pesados ou solventes orgânicos), que recebem, por isso, a designação de agentes desnaturantes. A desnaturação é um processo cooperativo. A passagem de uma molécula do estado nativo ao estado desnaturado é, quase sempre, uma transição brusca, i. é, ocorre abruptamente em consequência de um pequeno incremento do agente desnaturante. Devido aos mecanismos moleculares distintos com que diferentes agentes desnaturantes actuam sobre os biopolímeros, a desnaturação tem sido utilizada no estudo dos tipos de ligações químicas responsáveis pela estrutura nativa de proteínas e ácidos nucleicos. A desnaturação de uma molécula pode ser reversível ou irreversivel, consoante se dê a sua renaturaçâo completa (molécula biologicamente activa) ou incompleta (molécula biologicamente inactiva), respectivamente, após remoção do agente desnaturante. O estudo da desnaturação assume uma importância particular no caso das proteínas globulares e dos ácidos nucleicos. A conformação nativa das proteínas globulares é termodinamicamente mais estável do que a conformação que conduz à sua forma desnaturada, mas apenas por uma margem pequena - normalmente, cerca de 3,5 a 14 kcal/mol. Não admira, por isso, que as proteínas possam ser, na maioria dos casos, facilmente desnaturadas por acção de uma grande variedade de agentes desnaturantes. O efeito mais facilmente detectável na desnaturação das proteínas é a redução da sua solubilidade. Contudo, a consequência mais significativa da desnaturação é a perda da actividade biológica característica da proteína considerada, o que, no caso das enzirnas, leva à destruição da sua capacidade catalítica. A grande maioria das proteínas globulares sofre desnaturação quando aquecidas acima de 60 a 70 °C. A formação de um coágulo branco insolúvel, quando a clara do ovo é fervida, é um exemplo comum de desnaturação proteica. Contudo, algumas proteínas podem ser desnaturadas por exposição a temperaturas baixas. Diagrama ilustrando a desnaturação (I) de uma proteína, a sua completa renaturação (II) e a sua incompleta renaturação (III) (proteína biologicamente inactiva). (■) Áreas onde se exercem as forças que mantêm a estrutura de nível terciário. Enrolamento espontâneo de proteínas Chaperones moleculares YouTube video on protein folding: http://www.youtube.com/watch?v=gFcp2Xpd29I Protein-folding researchers have until now focused on a unique group of small, fast-folding proteins that fold in hundreds of nanoseconds or microseconds. In January 2012, scientists have simulated protein folding at a timescale that begins to be relevant to biology: the millisecond. The 39-amino acid residue chain called NTL9 is the slowest folding protein yet studied—a 1.5 millisecond fold. NTL9 follows not just one or two pathways but many different paths to get to the final folded state. A Markov State Model illustrates how NTL9 progresses from a fully unfolded state (a) to a fully folded state (n) through many different pathways. This simple 14-state model illustrates only the most frequented folding pathways. The larger the arrow, the more a path is traveled. The larger the circle, the greater a state’s stability. Journal of the American Chemical Society (2010) 132: 1526-1528 O Dogma de Anfinsen Anfinsen's dogma (also known as the thermodynamic hypothesis) is a postulate in molecular biology championed by the Nobel prize laureate Christian B. Anfinsen. The dogma states that, at least for small globular proteins, the native structure is determined only by the protein's amino acid sequence. This amounts to say that, at the environmental conditions (temperature, solvent concentration and composition, etc.) at which folding occurs, the native structure is a unique, stable and kinetically accessible minimum of the free energy. The three conditions: - Uniqueness: Requires that the sequence does not have any other configuration with a comparable free energy. Hence the free energy minimum must be unchallenged. - Stability: Small changes in the surrounding environment cannot give rise to changes in the minimum configuration. This can be pictured as a free energy surface that looks rather like a funnel (with the native state in the bottom of it) than like a soup plate; the free energy surface around the native state must be rather steep and high, in order to provide stability. - Kinetical accessibility: Means that the path in the free energy surface from the unfolded to the folded state must be reasonably smooth or, in other words, that the folding of the chain must not involve highly complex changes in the shape (like knots or other high order conformations). A recent study from Harvard-MIT provided compelling evidence in support of Anfinsen's dogma that information dictating the native structural fold of protein domains is encoded in its amino acid sequence. This study examined the entire protein universe of ~ 1018 folds on a fold-by-fold basis to show that a significant portion of the fold-dictating information is encoded by the atomic interaction network in the solventunexposed core of protein domains (termed protein core atomic interaction network or PCAIN). How the protein reaches this structure is the subject of the field of protein folding, which has a related dogma called Levinthal’s paradox. The Levinthal paradox states that the number of possible conformations available to a given protein is astronomically large. Effectively, this makes computational prediction of protein structure by evaluating all possible conformations unfeasible even for relatively small proteins. Also, some proteins need the assistance of another protein called a chaperone protein to fold properly. It has been suggested that this disproves Anfinsen's dogma. However, the chaperones do not appear to affect the final state of the protein; they seem to work primarily by preventing aggregation of several protein molecules before the protein is folded. Hydrophilic exterior Enrolamento espontâneo das proteínas para adquirirem a sua conformação biologicamnente activa Hydrophobic Interior Polipéptidos e Proteínas Questões: 1 – Com base nas definições apresentadas, identifique dois aspectos fundamentais que podem distinguir proteínas de polipéptidos. 2 – Ao longo do processo evolutivo, algumas proteínas adquiriram uma estrutura de nível quaternário. Indique três vantagens que essa alteração trouxe às células. 3 – Defina subunidade de uma proteína oligomérica. 4 – Identifique os três tipos de forças que contribuem para a estrutura de nível secundário das proteínas, indicando o papel desempenhado por cada uma na (1) aquisição e na (2) estabilização desse tipo de estruturas. 5 – Indique, justificando, se a insulina, composta por 51 resíduos de aminoácidos distribuídos por duas cadeias polipeptídicas (A e B) unidas por duas ligações persulfureto, é uma proteína dimérica. 6 - Considere as seguintes proteínas, com os pontos isoeléctricos (pI) indicados: Albumina do soro humano – 4,9 Colagénio humano - 6,6 Hemoglobina humana – 7,1 Insulina bovina – 5,4 Lisozima de galinha - 11,0 Mioglobina equina – 7,0 Ovalbumina de galinha – 4,6 Se uma solução de pH = 6,6 contendo estas proteínas for submetida a um campo eléctrico, indique, para cada proteína, qual a carga eléctrica global que possui e em que direcção de desloca (ânodo ou cátodo). 7 - Considere a estrutura de nível primário da ribonuclease bovina, uma enzima que catalisa a hidrólise das ligações fosfodiéster do mRNA. “Christian Boehmer Anfinsen, Jr. (1916–1995) was an American biochemist. He was awarded the 1972 Nobel prize for his work on ribonuclease. In 1961 he showed that ribonuclease could be refolded after denaturation while preserving enzyme activity, thereby suggesting that all the information required by protein to adopt its final conformation is encoded in its primary structure.” a) Defina nível de estrutura primário de um polipéptido. Quais as forças contribuintes para este tipo de estrutura? b) Para desnaturar a ribunuclease, C. Anfinsen tratou uma solução desta enzima na forma nativa com uma concentração elevada de ureia e de 2-mercaptoetanol, de modo a desenrolar completamente o polipéptido. Qual o efeito de cada um destes agentes desnaturantes. c) Uma vez desenrolado o polipéptido e removidos os agentes desnaturantes, a ribonuclease recupera a sua estrutura de nível terciário e, consequentemente, a sua actividade catalítica. Explique, sucintamente, recorrendo a conceitos termodinâmicos, como é que de entre um número de conformações possíveis extremamente elevado, ela se enrola sempre para a conformação que exibe actividade biológica. d) Indique o tipo de forças que mais contribui para a aquisição da estrutura de nível terciário da ribonuclease e qual o que mais contribui para a sua manutenção. e) Poder-se-á dizer que a estrutura de nível terciário da ribonuclease já se encontra definida pela sequência de nucleótidos do gene que a codifica? f) Como coaduna a resposta à alínea e) com a existência de uma família de proteínas com actividade de chaperones moleculares? 8 - A hélice α é um elemento estrutural das proteínas. a) O que é uma hélice α e em que nível de estrutura participa? b) Porque é que a formação de uma hélice α é um processo cooperativo? c) O que é o dipolo da hélice α? d) Explique o papel desempenhado pelas ligações de hidrogénio, interacções electrostáticas e forças de Van der Waals na estabilização da hélice α. e) Como explica a actividade anticongelante de algumas proteínas ricas em hélices α? LICENCIATURA EM BIOLOGIA DISCIPLINA BIOQUÍMICA Ano Lectivo de 2013/2014 Aula nº 7 12 MAR Ricardo Boavida Ferreira Sala 40 Aminoácidos, péptidos e proteínas (cont.) Interactómica. As interacções proteína-proteína e o dogma central da biologia molecular. Agregados de proteínas e neurodegeneração. Priões e corpos de Lewy. Glicoproteínas e o exoglicoma. Lectinas. Lipoproteínas. Aminoácidos, péptidos e proteínas como mecanismos de defesa. Introdução. Aminoácidos: aminoácidos como análogos de aminoácidos proteicos; latirismo. Péptidos: péptidos antifúngicos; faloidinas e amanitinas. Proteínas: sistema imunológico humano; lectinas; ricina; proteínas antifúngicas e proteínas PR. Material de estudo: diapositivos das aulas, bibliografia recomendada e textos de apoio. Interactómica: Protein-protein interactions Protein-protein interactions often involve what may be considered as information transfer: 1 – Cristian Anfinsen – Molecular chaperones 2 – Prions 3 – Protein aggregates Protein-protein interactions often involve what may be considered as information transfer: 1 – Cristian Anfinsen – Molecular chaperones 2 – Prions 3 – Protein aggregates Christian Boehmer Anfinsen, Jr. (1916–1995) was an American biochemist. He was awarded the 1972 Nobel prize for his work on ribonuclease. In 1961 he showed that ribonuclease could be refolded after denaturation while preserving enzyme activity, thereby suggesting that all the information required by protein to adopt its final conformation is encoded in its primary structure. Como a estrutura de nível primário está codificada no gene, então poder-se-ía concluir que a conformação biologicamente activa da proteína já se encontra determinada no gene. Estrutura de nível primário da ribonuclease bovina, uma enzima que catalisa a hidrólise das ligações fosfodiéster do mRNA. Mais recentemente, observou-se que muitas proteínas requerem, para assumirem a conformação biologicamente activa, outras proteínas, por isso denominadas chaperones moleculares. São exemplos os proteassomas 20 S e 26 S e a ribulose bisfosfato carboxilase (Rubisco). Nestes casos, a estrutura de nível terciário depende não só de informação contida no gene da proteína, como também nos genes das outras proteínas que participam no seu processamento. Protein-protein interactions often involve what may be considered as information transfer: 1 – Cristian Anfinsen – Molecular chaperones – Rubisco activase RuBP! Estranho; CA1-P – estranho! 2 – Prions 3 – Protein aggregates Prions: - Creutzfeldt-Jacob disease in humans - Bovine spongiform encephalitis (BSE, mad cow disease) - Scrapie in sheep The notion that the only way for diseases to pass from one organism to another is by genetic information has been an undisputed postulate until recently. Even viruses, although not technically alive, still possess genetic information in the form of DNA or RNA. A normal prion (left), compared to an aberrant, disease-causing prion (right). According to the prion model, the disease progresses when a misfolded PrPSc molecule comes in contact with cellular form PrPC of this protein and converts them. The appearance of a misfolded molecule can be either spontaneous, or caused by feeding an animal with food containing the meat of diseased animals. Both modes of infection have exhaustive experimental confirmation. The problem with the spontaneous appearance of prions stems from the fact that the formation of the infectious form of the prion is thermodynamically unfavorable. If forming one molecule is unfavorable, then how can this one molecule survive in the body without reverting back into a ‘good’ cellular form, let alone convert other molecules against the ‘thermodynamic gradient’? A ‘nucleation theory, one of several, offers the answer to this question by suggesting that the process is very slow at first, with only a handful of molecules undergoing conversion. The misfolded molecules stabilize each other when they aggregate. After a very long time, the aggregate reaches a certain number ‘n’, at which point it is called a nucleus, thus the name for this theory. The nucleus is very stable and can quickly convert the rest of the ‘good’ molecules in their misfolded PrPSc forms. The presence of plaque-like clusters of the protein in infected cells supports this hypothesis. Endogenous PrPC 'Lifeless' prion proteins are 'capable of evolution' “Lifeless" prion proteins, devoid of all genetic material, can evolve just like higher forms of life. Prions can change to suit their environment and go on to develop drug resistance. Prions are associated with 20 different brain diseases in humans and animals. In a study published in the journal Science, prion populations were transferred from brain cells to other cells in culture and the prions that adapted to the new cellular environment outcompeted their brain-adapted counterparts. When returned to the brain cells, the brainadapted prions again took over the population. It seems that exactly the same process of mutation and adaptive changes seen in viruses also occur in prions. In viruses, mutation is linked to changes in nucleic acid sequence that leads to resistance. This adaptability has moved one level down - to prions and protein folding and it's clear that nucleic acids are not required in this process of evolution. Mammalian cells normally produce cellular prion protein or PrPC. During infections, such as the human form of mad cow disease known as vCJD, abnormal or misfolded proteins convert the normal host prion protein into its toxic form by changing its conformation or shape. It was generally thought that once cellular prion protein was converted into the abnormal form, there was no further change. However, it has been observed that when prions are transmitted from sheep to mice, they become more virulent over time. The abnormal prions are known to replicate, and create variants, perhaps at a low level initially. But once they are transferred to a new host, natural selection will eventually choose the more virulent and aggressive variants. Li et al. (2009) Darwinian Evolution of Prions in Cell Culture. Science DOI: 10.1126/science.1183218 Published Online 31 December 2009 Science 12 February 2010: Vol. 327 no. 5967 pp. 869-872 DOI: 10.1126/science.1183218 Darwinian Evolution of Prions in Cell Culture Deer transmit prion proteins to one another via their droppings. Nature doi:10.1038/nature08289 Protein-protein interactions often involve what may be considered as information transfer: 1 – Cristian Anfinsen – Molecular chaperones – Rubisco activase RuBP! Estranho; CA1-P – estranho! 2 – Prions 3 – Protein aggregates From a structural (and thus thermodynamic) point of view, abnormal proteins are most often potentially toxic to cells not because they are incapable of performing their biological function, but most often because they are incorrectly folded, frequently exposing hydrophobic surfaces to the external hydrophilic cellular millieux, instead of being buried inside the hydrophobic core that characterizes the protein native conformation. Such exposed hydrophobic surfaces constitute aggregation nuclei, to which partial unfolded proteins may be successively added, resulting in the buil-up of large macromolecular protein aggregates. Reactive oxygen species (ROS), thermal mobility and polypeptide movements resulting from the expression of the protein biological activity further complicate this scenario. Large protein aggregates are immune to proteolytic attack. In the aggregates, the proteins may be held together by - Hydrophobic interactions; - Electrostatic interactions; - Covalent bonds. Formação da coalhada no fabrico do queijo - Interacções hidrofóbicas No leite, as caseínas ocorre conjuntamente com o fosfato de cálcio, na forma de complexos esféricos fortemente hidratados denominados micelas. Estes complexos apresentam um tamanho variável, com diâmetros a variarem entre 20 e 600 nm e massas moleculares médias da ordem dos 100 MDa. O leite possui c. 1015 micelas por litro. Uma micela típica contém qualquer coisa como 2 x 104 moléculas de caseína. Cada micela é um agregado de subunidades, cada uma das quais consiste de 25 a 30 moléculas de α-, β-, e κcaseína em proporções semelhantes às que ocorrem no leite. A γ-caseína é um artefacto, na medida em que é um fragmento da β-caseína, que resulta de proteólise limitada por acção de proteases presentes no leite. Cada tipo de caseína apresenta uma forma alongada, do tipo de bola de rugby. Cada uma das suas moléculas possui uma extremidade com uma predominância de resíduos de aminoácidos hidrofóbicos e a outra extremidade com uma predominância de resíduos de aminoácidos polares. As extremidades hidrófobas ficam viradas para o interior, longe do contacto com a água, e as extremidades polares para o meio hidrofílico do exterior. A extremidade polar da α-caseína possui 8 resíduos de serina com grupos fosfato esterificados. A extremidade polar da β-caseína contém 4 destes resíduos de fosfosserina. Finalmente, a extremidade polar da κ-caseína não apresenta resíduos fosfato, mas 1 ou + dos seus resíduos de treonina contêm cadeias oligossacarídicas. Os grupos fosfato das caseínas α e β reagem com Ca2+ para ligar as submicelas entre si, quer directamente quer em cadeias que envolvem a participação de mais grupos fosfato ou de citrato. Nas zonas onde ocorre a κ-caseína não se observa ligação cruzada entre as submicelas, devido à incapacidade da extremidade polar desta proteína em ligar o cálcio. Na formação das micelas, à medida que o número de submicelas que se associam vai aumentando, a tendência é para as zonas polares da κ-caseína, que não participam na associação das submicelas, dominarem a superfície exterior da micela, o que impede o seu crescimento indefenido. Estrutura proposta para a micela de caseína. (A) Estrutura de uma submicela típica, ilustrando a associação entre os três tipos de moléculas de caseína envolvidas. As zonas predominantemente hidrofóbicas encontram-se sombreadas. (B) Estabelecimento de ligações cruzadas entre as submicelas de caseína. As regiões que não ligam cálcio, correspondentes às extremidades polares das moléculas de κ-caseína, estão representadas a negro: P - fosfato; Ca - cálcio; Cit - citrato. (C) Formação de uma micela. À medida que a curvatura da micela diminui, com o aumento do seu tamanho, menor oportunidade há para a ligação entre submicelas. O fabrico do queijo envolve a adição de enzimas proteolíticas ao leite para formar a coalhada. As enzimas mais utilizadas são a quimosina (EC 3.4.23.4), também denominada renina, obtida do quarto estômago dos animais ruminantes, algumas proteases de fungos (essencialmente de espécies de Mucor), a pepsina de porco e as cardosinas da flor do cardo. A renina catalisa especificamente a hidrólise de uma única ligação peptídica na κ-caseína, a ligação que une os resíduos 105 e 106: Esta reacção corta a κ-caseína em dois fragmentos polipeptídicos: a) O segmento C-terminal da κ-caseína, que representa um terço da sua molécula, é denominado macropéptido da κ-caseína e fica no soro. É fortemente aniónico e contém as cadeias oligossacarídicas. b) Os restantes dois terços da molécula, a para-κ-caseína, são fortemente hidrófobos e permanecem na constituição da submicela. A perda dos resíduos oligossacarídicos na κ-caseína significa que se podem agora estabelecer ligações cruzadas fortes entre as submicelas, com o consequente crescimento indefinido das micelas e a resultante formação rápida da coalhada. A coalhada deve ser mantida durante várias horas, durante as quais aumenta a acídífícação produzida por microrganismos, o que confere uma firmeza apropriada à coalhada. Packaging of the seed storage proteins inside the legume protein storage vacuoles - Electrostatic interactions The Ca and/ou Mg induced self-aggregation of soybean seed storage proteins with Nigari® (calcium and magnesium carbonates) leading to TOFU. Proposed mechanism for the release of the storage proteins during germination. Lewy bodies (Parkinson’s Disease) - Covalent bonds Covalent aggregates between α-synuclein and ubiquitin, a characteristic biochemical hallmark of Parkinson’s disease in neuronal cells. Transmission electron micrograph of a pathological inclusion, Lewy body, from the brain of a Parkinson disease patient. Prepared from a formalin fixed paraffin section. (Kunihiro Uryu and John Trojanowski of the University of Pennsylvania) For all these reasons, cells are under permanet surveillance by the proteolytic systems In eukaryotic cells, the ubiquitin-proteasome pathway assumes a primordial importance. Ultimately, these processes may me regarded as information passed on between proteins. Do prions and other protein aggregation processes invalidate the Central Dogma for Molecular Biology? Neurotic Yeast – Saccharomyces cerevisiae and α-synuclein Tiago Fleming Outeiro - IMM α-syn-GFP: α-synuclein – green fluorescence protein fusion Most proteins must fold into defined three-dimensional structures to gain functional activity. But in the cellular environment, newly synthesized proteins are at great risk of aberrant folding and aggregation, potentially forming toxic species. To avoid these dangers, cells invest in a complex network of molecular chaperones, which use ingenious mechanisms to prevent aggregation and promote efficient folding. Because protein molecules are highly dynamic, constant chaperone surveillance is required to ensure protein homeostasis (proteostasis). Recent advances suggest that an age-related decline in proteostasis capacity allows the manifestation of various proteinaggregation diseases, including Alzheimer's disease and Parkinson's disease. Interventions in these and numerous other pathological states may spring from a detailed understanding of the pathways underlying proteome maintenance. (Hartl FU, Bracher A & Manajit GLICOPROTEÍNAS Glycome enhancement of the molecular and functional diversity of the proteome Targeting Carbohydrates: The Exoglycome Targeting carbohydrates: the fungal exoglycome GLICOPROTEINS • Glycosylation represents one of the most frequently occurring postranslational modifications of proteins. •About 0.5-1% of the human genes encode proteins related with biosynthesis, function and degradation of sugar chains. Anchors the glycoprotein to the membrane Proposed functions for the oligosaccharides that compose the exoglycome Carbohydrates Outside of cell Cytosol Poorly specific roles: • Protection of the peptide axis from protease action; • Improvement of water solubility; • Correct positioning of the glycoprotein. Highly specialized roles: • Regulation of cell–cell interactions; • Regulation of cell–matrix interactions; • Regulation of cell–molecule interactions; • Quality control of proteins critical to the development and function of complex multicellular organisms; • Receptors for viruses, bacteria and (?) fungi Proposed functions for the oligosaccharides that compose the exoglycome 3 0 Carbohydrates Outside of cell Cytosol Poorly specific roles: • Protection of the peptide axis from protease action; • Improvement of water solubility; • Correct positioning of the glycoprotein. Highly specialized roles: • Regulation of cell–cell interactions; (discrimination between self and non-self) • Regulation of cell–matrix interactions; • Regulation of cell–molecule interactions; (oligosaccharide-lectin interactions) • Quality control of proteins critical to the development and function of complex multicellular organisms; • Receptors for viruses, bacteria and (?) fungi. To provide such highly specific functions, oligosaccharides display an extremely high coding capacity THE SUGAR CODE or The third alphabet of life The original concept of the Central Dogma by Francis Crick ignored posttranslational modifications (such as protein glycosylation) that greatly magnify the functions of a single protein encoded by a particular gene. There are three major classes of biological macromolecules, all of which encode information essential for the life of the organism. Nucleic acids, proteins and glycans. The biosynthesis of nucleic acids and proteins is carried out by relatively simple template mechanisms, glycans require a complicated non- template assembly line. Monosaccharides: versatility for oligomer formation The phosphodiester bond in nucleic acid biosynthesis to yield linear oligomers The peptide bond in protein biosynthesis to yield linear oligomers The glycosidic linkage in oligosaccharides can involve any hydroxy group, opening the way to linear and also branched structures. The Coding Capacity of the Sugar Code A quantitative measure of this characteristic is the total number of 'words‘ (isomers) built from a set of 'letters' (monomers). The following parameters need to be considered: 1 - The sequence of monosaccharides; 2 - The anomeric configuration; 3 - The ring size (pyranose or furanose); 4 - The linkage-points; 5 - The branching patterns; 6 – Introduction of site-specific modifications. Consideration of these factors sets glycans far apart from nucleic acids and proteins in terms of coding capacity. In actual numbers, and considering a DP = 6, - only 4096 (46) hexanucleotides are possible with the four letters in the DNA language, - 6.4 x 107 (206) hexapeptides from 20 proteinogenic amino acids, - but the staggering number of 1.44 x 1015 hexasaccharides from 20 monosaccharides. Glycome enhancement of the molecular and functional diversity of the proteome Lectins Targeting exoglycome oligosaccharides with lectins Lectins are proteins of non-immune origin (thus excluding antibodies), devoid of catalytic activity (thus excluding enzymes), which recognize and bind in a stable manner (thus excluding enzymes) to specific carbohydrate structures. Lectins are present in all cells. Their physiological functions remain largely to be uncovered. They were first discovered in plants where they are widely present, especially in legume seeds. Lectins on particle surfaces interact with sugars on cell surfaces Schematic examples of major types of animal lectins, based on protein structure. The emphasis is on the extracellular domain structure and topology. The following are the defined carbohydratebinding domains (CRDs) shown: (CL) C-type lectin CRD; (GL) S-type lectin CRD; (MP) P-type lectin CRD; (IL) I-type lectin CRD. Other domains are (EG) EGFlike domain; (IG2) immunoglobulin C2set domain; (TM) transmembrane region; and (C3) complement regulatory repeat. The number of domains underlying the CRD can vary among family members. This legume lectin is concanavalin A, a flexible tetramer, bound to trimannoside, which is represented by the red and silver space-filling models. The green spheres depict calcium ions and the pink spheres depict manganese ions This representation of a C-type trimer lectin depicts a cluster of three carbohydrate recognition domains bound to mannose, shown as a red stick model. The adjacent neck region of helices is also evident. The green spheres represent bound calcium The xylome The xylem has always been considered as a transport system for water and mineral salts absorbed by the root system to the aerial parts of the plants. The recent discovery of proteins in the xylem sap was therefore surprising. It turned out that some of the xylem proteins are lectins. What are grapevine lectins doing in the plant xylem? Could they be patrolling the xylem in the search for invading microorganims? Agüero et al. 2008. Xylem Sap Proteins from Vitis vinifera L. Chardonnay. Am. J. Enol. Vitic. 59: 306-311. Pathogenesis: a changing exoglycome Example 1: It has long been known that malignant transformation is associated with abnormal glycosylation, resulting in expression of altered carbohydrate determinants. Representation of the multi-step process of hematogenous metastasis of cancer. The process starts with the intravasation of cancer cells into the bloodstream in the primary tumor lesion. Cancer cells then travel through the bloodstream, where they interact with various blood cells such as leukocytes and platelets, finally adhering to endothelial cells somewhere in the peripheral vessel walls. Cell adhesion mediated by the interaction of E-selectin on endothelial cells and sialyl Lewisa/x determinant on cancer cells is involved in this step. Sialyl Lewisa/x determinants Sialyl Lewisa and sialyl Lewisx are composed of four monosaccharide residues: neuraminic acid (NeuAc), Dgalactose (Gal), N-acetyl-Dglucosamine (GlcNAc), and L-fucose (Fuc). The glycosidic linkages are shown. Carbohydrate structures for sialyl Lewisa (top) and sialyl Lewisx (bottom) oligosaccharides. Example 2a: How does influenza virus infect a host cell? Hemagglutinin (HA), a viral coat glycosylated lectin, binds to specific sialylated glycan receptors in the respiratory tract, allowing the virus to enter the host cell. Hemagglutinin (HA) promotes virus binding and entry whereas neuraminidase (NA), allows virus budding and release. Example 2b: How does the influenza virus mutates and escapes the host immune system? If measles is caused by a virus and it can only be caught once in a life time, why do we catch the flu every year? The two largest viral targets of the antibodies are the HA and NA, since they are the most exposed proteins of the virus. When the antibodies bind to them, in addition to signaling to macrophages and other types of defense cells to attack the foreign body (the virus), it can still prevent the functioning of the virus. Sialic acid Cell Cell membrane Antibody The antibody connected to HA prevents it from linking itself to the sialic acid of the host cell. Thanks to this immune response, after a few days the influenza is unable to infect us. But how is the virus able to return? When it replicates its genome, the polymerase of the influenza causes mutations which change the composition of the viral proteins This process is called gradual antigenic drift. Example 2c: How avian flu may become human? The highly pathogenic H5N1 and the 2009 swine-origin influenza A (H1N1) viruses have caused global outbreaks and raised a great concern that further changes in the viruses may occur to bring about a deadly pandemic. Human respiratory cells have glycan receptors classified as α-2,6; avian respiratory cells' glycan receptors are known as α-2,3. This classification is based on how the sugars are linked together when they are displayed on cells. To cross the species barrier and infect the human population, avian HA must change its receptor binding preference from a terminally sialylated glycan that contains α-2,3 (avian)-linked to α-2,6 (human)-linked sialic acid motifs, and this switch could occur through only two mutations, as in the 1918 pandemic. Influenza virus structure: details of HA structure. Targeting fungal exoglycome with lectins Working hypothesis: Are there host-induced changes in the exoglycome of Alternaria alternata? If so, the altered oligosaccharides may be used as targets to find specific lectins or to develop specific monoclonal antibodies, with potential applications in both therapy and/or diagnosis Fungal pathogens are capable of modulating host gene expression to their own benefit. This is dramatically demonstrated by the green island effect. 6 A detached barley leaf was inoculated with Blumeria graminis formae specialis hordei on one side and then placed in darkness to accelerate senescence of the leaf. The uninoculated (a) and inoculated (b) sides are shown. The cells underneath the colony remained green, indicating that the fungus actively suppressed senescence of host tissue. Schulze-Lefert P and Vogel J (2000) Closing the ranks to attack by powdery mildew. Trends in Plant Science 5, 343-348. Pathogenesis: a changing fungal cell wall It seems unlikely that fungal pathogens are capable of changing their cell wall carbohydrate polymers to circumvent or avoid plant defences. However, some rust fungi do just that! Barley powdery mildew (Blumeria graminis formae specialis hordei) life cycle. (Schulze-Lefert & Vogel. 2000. Trends in Plant Science 5, 343-348). During invasive growth of biotrophic rust fungi, the surface hyphae that grow within host leaves contain chitosan, a deacetylation product of chitin (Ferreira et al. 2007. Molecular Plant Pathology, 8 : 677-700). The ‘wolf intrudes in sheep’s clothing’ (Schulze-Lefert & Panstruga. 2003. Annu. Rev. Phytopathol. 41, 641–667). Targeting fungal exoglycome with lectins Working plan: - Determine the structure of host-free A. alternata exoglycome - Isolate the fungal cell membrane - Isolate the cell membrane proteome - N-Glycan release from N-linked glycoproteins: peptide-N-glycosidase F - Glycan – protein separation: protein precipitation with ethanol - Glycan desalting: Hypercab cartridges - Glycan structure: MALDI-TOF-MS - Infect human macrophages and tomato cell cultures with A. alternata - Compare the fungal exoglycomes - Determine the structure of potentially-new host-induced oligosaccharides A B (A) Strategies for N-glycan analysis of porcine kidney membrane proteins. (B) Specificity of exoglycosidase used in arrays. abs, A. ureafaciens sialidase; cbα, green coffee bean α-galactosidase; btg, bovine testis β-galactosidase; guh, S. Pneumoniae β-N-acetylhexosaminidase. Key to symbols: filled star: NeuAc; filled square: GlcNAc; open circle: mannose; open diamond: galactose; open diamond with spot: fucose; solid connecting line β-linkage; broken connecting line α -linkage. Linkage positions are shown in the box by the lines connecting the symbols. (a) Positive ion MALDITOF mass spectrum of the glycans present in extracts of porcine kidney following removal of the sialic acids with A. ureafaciens sialidase. (b–d) MALDITOF mass spectra of the same glycans after additional incubations with bovine testis β-galactosidase, green coffee bean αgalactosidase and S. Pneumonia β-Nacetylhexosaminidase, respectively. The highmass section of the spectrum has been magnified vertically. Glossary of terms ES: electrospray GC-MS: gas chromatography-mass spectrometry LC-MS: liquid chromatography-mass spectrometry MALDI: matrix-assisted laser desorption ionisation MS/MS: tandem mass spectrometry, whereby a molecular ion is selected and fragmented PNGase F: peptide N-glycosidase F, an enzyme that cleaves between the reducing-end carbohydrate and the asparagine residue in N-linked glycans Q-TOF: quadrupole/orthogonal acceleration time-of-flight TOF-TOF: two time-of-flight analysers arranged in tandem Glicoproteínas São proteínas que possuem uma ou mais porções de hidrato de carbono (ou glicana) ligadas covalentemente à cadeia polipeptídica através dos grupos laterais de resíduos de aminoácidos. Portanto, as glicoproteínas são proteínas glicosiladas que adquiriram essa forma através do processo de glicosilação, que é um dos conhecidos mecanismos de modificação pós-traducional das proteínas. Há, assim, uma distinção marcante entre glicoproteínas e peptidoglicanas (que se consideram um grupo distinto), pois que nestas estruturas, a componente hidrato de carbono é a fracção dominantes, que se encontram interligados (cross-linked) por cadeias relativamente curtas de polipéptidos sintetizados por processos independentes dos ribossomas e do rnRNA. Além destes aspectos, e dada a conhecida estereoselectividade que caracteriza o centro activo das enzimas, a presença de aminoácidos da série D nas peptidoglicanas da parede celular de bactérias pode ser encarada como um mecanismo de fuga à acção destrutiva das proteases do hospedeiro. As glicoproteínas são glicósidos e, tal como estes, podem ser do tipo N- ou do tipo O- (N-glicoproteínas e Oglicoproteínas, portanto portadores de N- ou O-glicanas), dependendo do átomo do resíduo de aminoácido a que as glicanas estão ligadas. Embora usualmente uma dada glicoproteína possua glicanas apenas de um dos tipos, conhecem-se algumas que são simultaneamente do tipo N- e O- (p, ex., a fetuína bovina e a imunoglobina humana A). Existem várias diferenças marcantes entre glicoproteínas, nomeadamente se são de células procarióticas ou eucarióticas e, por outro lado, se são do tipo N- ou O-. Considerando as glicoproteínas de eucariotas, as N-glicoproteínas e as O-glicoproteínas começam logo por diferir no tipo de ligação e na natureza do resíduo de aminoácido, da cadeia polipeptídica, a que a glicana se liga. Isso encontra-se exemplificado na figura abaixo, onde se mostra a ligação entre o aminoácido e o hidrato de carbono nas glicoproteínas dos dois tipos, N- e O-. Nas N-glicoproteínas o aminoácido é sempre asparagina e o monossacárido que a ela se liga, a Nacetilglucosamina (GluNAc), em ligação amida de configuração β. Além disso, nas N-glicoproteínas é necessário verificar-se uma adequada sequência de resíduos de aminoácidos (sequência de ligação) para que o hidrato de carbono se possa ligar à cadeia polípeptídíca, é ela N-X-T ou N-X-S, em que N = asparagina; T = treonina, S = serina e X um qualquer aminoácido. Nas O-glicoproteínas, o aminoácido é frequentemente a serina ou a treonina (mas pode ser a hidroxilisina, no colagénio, ou a hidroxiprolina, nas glicoproteínas das plantas) e o monossacárido é frequentemente a N-acetilgalactosamina, em ligação éter, de configuração α, mas pode ser galactose, no colagénio, N-acetilglucosamina, em glicoproteínas do núcleo e do citoplasma, manose, em glicoproteínas das leveduras, e arabinose, em glicoproteínas de plantas (nas proteoglicanas é xilose). Sugar residues of glycoproteins and glycolipids are usually located on the outside surface of mammalian plasma membranes. Membranes of eukaryotic cells are usually between 2% and 10% carbohydrate, in the form of glycolipids and glycoproteins. One possible role of carbohydrate groups is to orient glycoproteins in membranes. Because sugars are highly hydrophilic, the sugar residues of a glycoprotein or of a glycolipid will tend to be located at a membrane surface, rather than in the hydrocarbon core. The cost in free energy of inserting an oligosaccharide chain into the hydrocarbon core of a membrane is very high. Consequently, there is a high barrier to the rotation of a glycoprotein from one side of a membrane to the other. The carbohydrate moieties of membrane glycoproteins help to maintain the asymmetric character of biological membranes. Carbohydrates on cell surfaces may also be important in intercellular recognition. The interaction of different cells to form a tissue and the detection of foreign cells by the immune system of a higher organism are examples of processes that depend on the recognition of one cell surface by another. Carbohydrates have the potential for great structural diversity. An enormous number of patterns of surface sugars is possible because (1) monosaccharides can be joined to each other through any of several hydroxyl groups, (2) the C-1 linkage can have either an α or a β configuration, and (3) extensive branching is possible. lndeed, many more different oligosaccharides can be formed from four sugars than oligopeptides from four amino acids. Uma questão muito debatida é a da importância e função da porção glicana das glicoproteínas. No que respeita às propriedades físicas, a desglicosilação leva frequentemente, mas não sempre, à alteração das propriedades das glicoproteínas. Em muitos casos observa-se uma maior susceptibilidade à degradação pelas proteases ou à desnaturação pelo calor, podendo suceder que a ausência da glicana impeça a glicoproteína de adquirir a estrutura de nível terciária correcta e conduza à sua destruição pela célula. Há muitos casos em que é notória a importância das glicanas das glicoproteínas, como nas interacções que se exercem entre diversos componentes celulares, no encaminhamento de certas proteínas para os locais celulares correctos e nas interacções célula a célula, inclusive na ligação de agentes patogénicos humanos (bactérias, vírus, micoplasmas) às células que infectam. Referem-se, a seguir, alguns exemplos: - No aparelho de Golgi, receptores de manose-6-fosfato ligam proteínas com porções que contêm manose6-fosfato e encaminham-nos para os lisossomas. - No sangue dos mamíferos, as glicoproteínas que têm resíduos de galactose ou GluNAc na extremidade são retiradas pelos hepatócitos. - No rato, as interacções espermatozóide/óvulo resultam da ligação de um receptor do espermatozóide a O-glicanas do óvulo. - No ser humano, o vírus da gripe liga-se a resíduos do ácido siálico da superfície das células que infecta. - O exoglicoma da célula desempenham importantes funções biológicas, a nível da adesão célula-a-célula e da interacção, sinalização e reconhecimento entre células. - Disease development and progression is often associated with changes in the glycome – this has been demonstrated in cancer cells. Glicoproteínas Questões: 1 – Descreva quatro diferenças principais que permitem distinguir glicoproteínas de peptidoglicanas. 2 - Justifique as seguintes afirmações, modificando-as para a forma correcta quando não forem verdadeiras: a) A ligação peptídica apresenta carácter parcial de dupla ligação. b) A ligação isopeptídica estabelece-se entre o grupo α-carboxilo de um aminoácido e o grupo α–amina do aminoácido adjacente. c) A hélice α é um tipo de estrutura de nível secundário das proteínas. d) As interacções hidrofóbicas são as principais forças responsáveis pela aquisição da estrutura de nível terciário das proteínas. e) Glicoproteínas e peptidoglicanas são sinónimos. LIPOPROTEÍNAS São complexos entre lípidos e proteínas. Encontram-se, p. ex., no envelope bacteriano e no plasma sanguíneo. Nas bactérias, uma das mais frequentes é a que está associada à mureína e que é designada por lipoproteína de Braun, com massa molecular de 7,2 kDa e a forma de vareta. Associa-se ao folheto interno da membrana externa, existindo, no caso de Escherichia coli, c. 750.000 cópias por célula. Um terço deste número está covalentemente ligado à peptidoglicana através do grupo ε-amina do resíduo de lisina presente na extremidade COOH da proteína. Um resíduo de cisteína da extremidade NH2 da lipoproteína foi modificado, tendo o grupo sulfidrilo sido substituído por um diacilglicerol e o grupo amina por um ácido gordo. A principal função desta lipoproteína é manter a integridade estrutural do complexo de peptidoglicana da membrana externa. No plasma sanguíneo existem várias lipoproteínas, cuja função é o transporte e a distribuiçâo de Iípídos (lipidos absorvidos dos alimentos, vitaminas lipossolúveis, hormonas), através dos sistemas sanguíneo e linfático. Costumam classificar-se de acordo com a sua densidade, em lipoproteínas VLDL (very low density Iipoprotein), de muito baixa densidade, as LDL, de baixa densidade, e as HDL (high density), de alta densidade. Têm a importante função de transportar, na forma solúvel, os Iípidos de outro modo insolúveis no plasma. As partículas de lipoproteínas contêm um núcleo hidrofóbico de estéres de colesterol e triacilgliceróis, rodeado por uma monocamada de fosfolípidos a que se associam colesterol, na forma livre, e as apolipoproteínas. Estas desempenham tanto a função de cofactores das enzimas, envolvidas no metabolismo dos Iípidos presentes no núcleo das partículas lipoproteicas, como o papel de factores de reconhecimento, durante os processos de secreção e de regulação da absorção das lipoproteínas. Aminoácidos, péptidos e proteínas como mecanismos de defesa Na batalha química permamente que ocorre entre organismos, seja para o estabelecimento de patogénese, seja numa competição para determinados recursos (alimento, território, luz, etc.), existe um sem-número de substâncias que, embora sejam compostos naturais, podem exibir um nível elevadissimo de toxicidade. Uma questão central que se coloca é como é que o organismo ou célula produtora do composto tóxico evita, ela própria, ser intoxicada pelo seu produto tóxico? Incluem-se compostos que não são naturalmente tóxicos para o organismo produtor, como por exemplo, várias plantas produzem e acumulam hormonas sexuais de mamíferos (ex. os estrogénios estrona e estradiol, bem como outras moléculas com actividade estrogénica) numa tentativa de evitar ou diminuir a predação por ovelhas. Noutras situações, a substância tóxica pode ser excretada para o meio circundante, como é o caso do aminoácido não-proteico canavanina. É relativamente frequente alguns aminoácidos não-proteicos estarem presentes nalgumas plantas em concentrações muito elevadas. As sementes de certos géneros de leguminosas podem conter 10 a 15% da sua massa em 5-hidroxitriptofano, canavanina e 3,4-di-hidroxifenilalanina. A canavanina foi incialmente detectada em Canavalia ensiformis, mas ocorre em várias espécies de leguminosas. A presença de 13% de canavanina em sementes de Dioclea megacarpa sugere que a função da canavanina é de armazenar azoto, até porque é rapidamente metabolizada durante a germinação. Mas a função de armazenamento não explica, por si só, porqure razão se acumula a canavanina e não um aminoácido proteico igualmente rico em azoto como, por exemplo, a arginina. A explicação parece residir no facto de a canavanina ser tóxica para roedores e insectos, os quais, na ausência de canavanina, poderiam destruir as sementes de Dioclea megacarpa. A produção de um aminoácido não-proteico por uma espécie pode também favorecâ-la, em termos competitivos, contra outras espécies vegetais – função alelopática. As sementes de Glycine wightii em germinação libertam canavanina para o meio, em concentrações que inibem o crescimento de plântulas de outras espécies. A canavanina pode, assim, desempenhar três funções biológicas: proteger as sementes dormentes do ataque de predadores, inibir a germinação/crescimento de outras plântulas vizinhas durante a germinação da espécie que a produz e fornecer uma reserva de carbono, azoto e enxofre orgânicos para a plântula em crescimento. Canavanina (ácido 2-amino-4-guanidino-hidróxibutírico ) Arginina (Arg, R) (ácido 2-amino-5-guanidovalérico) Contudo, a regra mais geral é a substância tóxica inibir ou, pelo menos, perturbar também o metabolismo celular do organismo produtor. E neste caso foram adoptadas várias estratégias, a grande maioria das quais estão ainda por descobrir ou esclarecer. Dentro dos casos aparentemente mais simples, pode citar-se a compartimentação celular, como são os casos, por exemplo, dos taninos e dos glicósidos cianogénicos. Assim, muitas plantas acumulam nas suas células taninos, em compartimentos celulares distintos daqueles onde se encontram as proteínas do seu metabolismo normal (as chamadas housekeeping proteins). Deste modo, os taninos não de ligam às suas proteínas, excepto quando as estruturas celulares são destruídas após ingestão por um animal herbívoro, situação em que se complexam com as proteínas, tornando-as indigeríveis para o predador. Também as plantas cianogénicas, como por exemplo a mandioca, armazenam glicósidos cianogénicos, desprovidos de toxicidade, num compartimento celular distinto daquele onde se localiza a respectiva glicosidade. Ao ser destruída a compartimentação celular, na sequência de predação, a glicosidase é posta em contacto com o glicósido cianogénico, o que resulta na hidrólise da ligação que liga o açúcar ao ácido cianídrico e na expressão do efeito tóxico deste último. Cyanogenic glycosides in plants The cyanogenic glycosides may be defined chemically as glycosides of the α-hydroxynitriles and belong to the secondary metabolites of plants. They are amino acid-derived plant constituents. The biosynthetic precursors of the cyanogenic glycosides are different L-amino acids, which are hydroxylated, then the Nhydroxylamino acids are converted to aldoximes and these are converted into nitriles and hydroxylated to αhydroxynitriles and then glycosylated to cyanogenic glycosides. All known cyanogenic glycosides are βlinked, mostly with D-glucose. There are at least 2650 species of plants that produce cyanogenic glycosides and usually also a corresponding hydrolytic enzyme (beta-glycosidase), which are brought together when the cell structure of the plant is disrupted by a predator, with subsequent breakdown to sugar and a cyanohydrin, that rapidly decomposes to hydrogen cyanide (HCN) and an aldehyde or a ketone. The glycosides, cyanohydrins and hydrogen cyanide are collectively known as cyanogens. This combination of cyanogenic and hydrolytic enzyme is the means by which cyanogenic plants are protected against predators. There are approximately 25 cyanogenic glycosides known with the major cyanogenic glycosides found in the edible parts of plants being: amygdalin (almonds); dhurrin (sorghum); linamarin (cassava, lima beans); lotaustralin (cassava, lima beans); prunasin (stone fruit); and taxiphyllin (bamboo shoots). The toxicity of a cyanogenic plant depends primarily on the potential concentration of hydrogen cyanide that may be released upon consumption. If the cyanogenic plant is inadequately detoxified during processing or preparation of the food, the potential hydrogen cyanide concentration which may be released can still be high. Upon consumption of a cyanogenic plant, β-glycosidase will be released during digestion and remain active until deactivated by the low pH of the stomach. This enzyme will hydrolyse the cyanogenic glycoside and release at least part of the potential hydrogen cyanide content of the plant. GLYCOSIDE CONTENT OF CASSAVA The actual level of cyanogenic glycosides of a cyanogenic plant is influenced by various factors, both developmental (endogenous) and ecological (exogenous). The development cycle of cyanogenic plants shows characteristic changes in cyanogenic glycoside (and HCN) content. Cassava In cassava, the major cyanogenic glycoside is linamarin, while a small amount of lotaustralin (methyl linamarin) is also present, as well as an enzyme linamarinase. Catalyzed by linamarinase, linamarin is rapidly hydrolysed to glucose and acetone cyanohydrin and lotaustralin hydrolysed to a related cyanohydrin and glucose. Under neutral conditions, acetone cyanohydrin decomposes to acetone and hydrogen cyanide. This reaction for linamarin is shown below. If the cassava plant is not adequately detoxified during the processing or preparation of the food, it is potentially toxic because of the release of this preformed hydrogen cyanide. The hydrogen cyanide is readily removed during processing of cassava, however, the presence of residual linamarin and its acetone cyanohydrin in cassava-based food products has the potential to cause adverse health effects. There are many varieties of cassava and the cyanide content differs as well as the suitability for different growing and consumption conditions. Usually higher cyanide content is correlated with higher yields. During periods of drought the cyanide content of both sweet and bitter cassava varieties increases. Bitter cassava varieties are more drought resistant and thus more readily available and cheaper. However, owing to food shortage in times of drought, less time is available for the additional processing required. Values from 15 to 400 mg/kg of hydrocyanic acid in cassava roots on a fresh weight basis have been mentioned in the literature. Sweet varieties of cassava will typically contain approximately 15 to 50 mg/kg of hydrogen cyanide on fresh weight basis. Cassava leaves contain approximately 10% more linamarin than cassava roots. Aminoácidos São numerosos os casos conhecidos em que os aminoácidos não proteicos interferem com o crescimento e/ou o metabolismo em plantas, animais e microrganismos. Está bem documentada a toxicidade de vários aminoácidos não-proteicos. De entre os aminoácidos não proteicos que exibem toxicidade, muitos possuem estruturas muito parecidas das de aminoácidos proteicos, isto é, são análogos estruturais de aminoácidos proteicos. A canavanina, por exemplo, tem uma configuração molecular que pouco difere da da arginina. Outro exemplo, a mimosina, tem um carácter aromático e uma estrutura semelhante às da fenilalanina e tirosina. Também o ácido azetidina-2-carboxílico é um iminoácido análogo do iminoácido proteico prolina, enquanto a albizina é um análogo bda glutamina. O facto de uma molécula análoga possuir uma forma e uma polaridade muito similar ao de um aminoácido proteico sugere que o antagonismo metabólico resulta do análogo imitar o comportamento do composto normal nos processoa metabólicos. A toxicidade dos aminoácidos não-proteicos que são análogos de aminoácidos proteicos pode resultar de três mecanismos disitntos: Inibição da absorção de aminoácidos. A molécula análoga compete com o substrato normal na ligação à permease responsável pela absorção do aminoácido. Ex. o ácido azetidina-2-carboxílico afecta (e acaba por conduzir à morte de) plântulas de Phaseolus aureus por inibir a absorção de prolina, ao competir com o iminoácido proteico para a permease responsável pela sua entrada nas células. Inibição a nível da biossíntese de aminoácidos. O análogo de aminoácido pode agir com inibidor da síntese do aminoácido proteico, quer competindo directamente com o substrato normal em relação ao centro activo de uma enzima ou por imitar o papel do produto final de uma via de síntese de aminoácidos na sua inibição por “feedback” sobre um dos primeiros passos da via. Um exemplo do primeiro caso é fornecido pela albizina, um análogo da glutamina, produzida por Acacia farnesiana e por Albizzia lophantha, sobre a enzima asparagina sintetase. Um exemplo do segundo caso é dado pela S-aminoetilcisteína, um análogo da lisina que contém um átomo de enxofre em vez do grupo metilénico do átomo 4 da lisina. Inibe o crescimento de, por exemplo, cevada, porque imita o papel do produto final que conduz à formação do aminoácido proteico, neste caso a lisina. Limita assim a quantidade de lisina sintetizada numa situação em que esta não se encontra em excesso. Incorporação de aminoácidos não proteicos em proteínas. Um análogo estrutural de um aminoácido proteico pode competir com o aminoácido proteico no processo de activação catalisado pelas aminoaciltRNA sintetases, a reacção inicial da sequência responsável pela incorporação dos aminoácidos em moléculas de proteína. A molécula análoga pode comportar-se como um inbidor competitivo mas, mas frequentemente, é aceite pela sintetase como um substrato alternativo e é incorporado numa forma anómala da proteína. Incorporação de aminoácidos não proteicos em proteínas As proteínas são construídas a partir dos 20 aminoácidos proteicos, os quais são incialmente activados por uma reacção com o ATP catalisada por 20 aminoacil-tRNA sintetases. Cada uma destas enzimas é fortemente específica para cada um dos aminoácidos proteicos e catalisa duas reacções: Reacção de activação: Aminoácido + ATP aminoacil-AMP + PPi Reacção de transferência para o tRNA: Aminoacilo-AMP + tRNA aminoacil-tRNA + AMP Os resíduos de aminoacilo são reguladamente transferidos dos complexos activados formados na 1ª reacção para moléculas específicas de tRNA (2ª reacção). É nestes dois passos, catalisados pela mesma enzima, que ocorre fase crítica de selecção dos aminoácidos, pois, aparentemente, pouca discriminação tem lugar nos passos posteriores associados à incorporação dos resíduos de aminoácidos nos polipéptidos em alongamento. A grande especificidade das aminoacil-tRNA sintetases assegura uma selecção quase perfeita dos substratos, dentro dos aminoácidos proteicos. Contudo, certos aminoácidos não proteicos podem actuar como substratos alternativos com certas enzimas e, então, podem ser anormalmente inroduzidos em molécuilas de proteína. A azetidina-2-carboxilato é um bom exemplo deste tipo de comportamento. A inibição do crescimento de plântulas ou de culturas de bactérias causada pela azetidina-2-.carboxilato resulta, em larga medida, da sua introdução em proteínas celulares, em substituição da prolina. Uma vez que a presença de prolina num polipéptido conduz a uma interrupção da estrutura em hélice α e a uma alteração na orientação do eixo da cadeia, tais resíduos desempenham um papel importante na determinação da estrutura de nível terciário final da proteína. Os rizomas da liliácea Polygonatum muiltiflorum conêm cerca de 6% de azetidina-2-carboxilato. A substituição de um resíduo de prolina por um resíduo de azetidina-2-carboxilato produz, inevitavelmente, diferentes ângulos de ligação nestas importantes regiões intramoleculares. Uma substituição extensiva de prolina numa mesma molécula de proteína produzirá uma marcada alteração na sua conformação final e, em consequência, uma modificação na reactividade das proteínas enzimaticamente activas. Foram estudadas as propriedades cinéticas de prolil-tRNA sintetases isoladas de espécies formadores (Polygonatum multiflorum, uma liliácea) e de espécies não-formadoras (Phaseolus aureus, uma leguminosa) do análogo. Nas espécies não formadoras de azetidina-2-carboxilato, a prolil-tRNA sintetase activava o análogo a uma taxa que era de 38% da taxa a que a prolina era activada. Nas espécies produtoras, a enzima não exibia afinidade para o análogo Esta capacidade da espécie produtora em fazer uma discriminação enzimática contra o seu próprio produto tóxico, assegura que o análogo não seja incorporado nas suas proteínas, evitando a síntese de enzimas ineficazes e estruturalmente anómalas. Outros estudos demonstraram que este fenómeno é de ocorrência frequente. Espécies como a beterraba sacarina, que contêm apenas quantidades vestigiais de azetidina-2-carboxilato, comportam-se enzimaticamente como não-produtoras. As observações feitas permitem inferir que nas espécies produtoras de azetidina-2-.carboxilato, o centro de ligação para o substrato da prolil-tRNA sintetase pode acumular uma molécula ligeiramente mais volumosa do que a maioria das espécies não-produtoras. A azetidina-2-carboxilato, sendo menos volumosa que a prolina, encaixa muito frouxamente no centro de ligação e, por tal razão, não é activada. Estudos similares foram feitos com as glutamil-tRNA sintetases relativamente aos análogos do glutamato, γhidroxi-L-glutamato e γ-metil-L-glutamato e com as fenilalanil-tRNA sintetases em relação aos análogos da fenilalanina. O latirismo Há dois tipos de latirismo: Lathyrism or neurolathyrism is a neurological disease of humans and domestic animals, caused by eating certain legumes of the genus Lathyrus. This problem is mainly associated with Lathyrus sativus (grass pea) and to a lesser degree with L. cicera, L. ochrus and L climenum containing the toxin β-oxalyl-L-α,βdiaminopropionic acid (ODAP). L-Glutamic acid β-Oxalyl-L-α,β-diaminopropionic acid (ODAP). is the neurotoxin responsible for lathyrism β-Oxalyl-L-α,β-diaminopropionic acid (ODAP), also known as β-N-oxalyl-amino-L-alanine (BOAA), is a nonprotein amino acid neurotoxin, that is a structural analogue of L-glutamic acid. The consumption of large quantities of Lathyrus grain containing high concentrations of the ODAP, causes paralysis, characterized by lack of strength in or inability to move the lower limbs. A unique symptom of lathyrism is the emaciation of gluteal muscles (buttocks). ODAP is a poison of mitochondria leading to excess cell death, especially in motor neuros. The first mentioned intoxication goes back to ancient India and also Hippocrates mentiones a neurological disorder 46 B.C. in Greece caused by Lathyrus seed where lathyrism was occurring on a regular basis. The lathyrism resulting from the ingestion of Lathyrus odoratus seeds (sweet peas) is often referred to as odoratism or osteolathyrism, which is caused by a different toxin (β-aminopropionitrile) that affects the cross-linking of collagen, a protein of connective tissues. The importance of cross-linking to the normal functioning of collagen is demonstrated by the disease lathyrism, which occurs in humans and other animais as a result of the regular ingestion of seeds from the sweet pea Lathyrus odoratus. The symptoms of this condition are serious abnormalities of the bones, joints, and large blood vessels, which are caused by an increased fragility of the collagen fibers. Since lathyris peas form part of the diet of some peoples, the condition is well-known in humans and often causes curvature of the spine and rupture of the aorta. The biochemical problem/causative agent of lathyrism has been traced to the presence in the seeds of βcyanoalanine (a non-protein amino acid) and of its decarboxylation product, β-aminopropionitrile: β-Aminopropionitrile, inactivates lysyl oxidase by covalently binding to its active site. This results in markedly reduced cross-linking in the collagen of lathrytic animais. Péptidos Péptidos com actividade anti-fúngica Ver textos de apoio Referência: De Lucca, A.J. and Walsh, T.J. (1999) Antifungal peptides: novel therapeutic compounds against emerging pathogens. Antimicrobial Agents and Chemotherapy 43, 1–11. Faloidinas e Amanitinas The Death Cap, Amanita phalloides This species causes most of the fatal poisoning cases. First of all, there are breathing problems and dizziness. Then comes severe vomiting, diarrhoea and dehydration. After three days, you begin to feel better, but actually your liver is being destroyed. Death usually happens at least 6 days after consumption. The Death Cap is not uncommon under oak. Faloidinas e Amanitinas As amanitinas, também designadas por amatoxinas, formam um grupo de actapéptidos bicíclicos, constituídos por dois resíduos de leucina, um de isoleucina, um de di-hidroxi-isoleucina, um de asparagina, um de hidroxiprolina, um de triptofano e um de cisteína. Incluem a α-amanitina, a β-amanitina, a δ-amanitina, a amanina e a amanulina. São responsáveis, conjuntamente com as falotaxinas, pela toxicidade de certas espécies de cogumelos do género Amanita, designadamente de Amanita phalloides. A sua toxicidade deriva de inibirem a enzima RNA polimerase II (EC 2.7.7.6) das células eucariotas, o que conduz ao desenvolvimento de necroses nas células da fígado e rins dos animais. Mais de 90% das mortes por envenenamento causadas por cogumelos são devidas à ingestão de fungos do género Amanita. As falotoxinas são heptapéptidos cíclicos que, conjuntamente com as amanitinas, são responsáveis pela toxicidade de certas espécies de cogumelos do género Amanita, designadamente de Amanita phalloides. As principais falotoxinas são a faloidina, a faloína e a falacidina. A falacidina apresenta uma estrutura semelhante à faloidina, mas em que o grupo D-treonina-alanina se encontra substituído por ácido valil-D-eritro-β-hidroxiaspártico. As falotoxinas não são tão tóxicas como as amanitinas, mas actuam mais rapidamente. Do ponto de vista estrutural, a sua toxicidade depende da estrutura cíclica formada pelo heptapéptído e da ligação tioéter característica que se estabelece entre o grupo indole do resíduo de triptofano e o grupo mercapto da cisteína. Os valores de LD50 para ratinhos são, expressos em mg por kg de peso, de 1,35 para a faloína, de 1,85 para a faloidina e de 2,5 para a falacidina. O seu efeito tóxico é contrariado pela antamanida, um decapéptido cíclico que ocorre com as falotoxinas em A. phalloides. Contudo, a antamanida não anula totalmente o efeito tóxico global produzido por envenenamento faloídico, o qual pode ser eficazmente contrariado com ácido α-lipóico. As falotoxinas têm sido utilizadas nos estudos dos microfilamentos do citosqueleto pela utilização de alguns seus análogos fluorescentes. Proteínas As proteínas per si Os polipéptidos são sintetizados nos polissomas numa forma desenrolada, adquirindo posteriormente a sua conformação biologicamente activa num processo que é regido pelas leis da termodinâmica. Assim, qualquer proteína se enrola para a conformação biologicamente activa “movida” por um factor de natureza entrópica (i.e. a destrução das “gaiolas de água”, formadas num meio aquoso em torno das cadeias laterais hidrofóbicas dos resíduos de aminoácidos, conduz a um aumento da entropia do sistema), de tal modo que esta conformação tem um conteúdo de energia inferior (i.e. é mais estável) que as outras conformações – e é por este motivo que as cadeias polipeptídicas das proteínas se enrolam para a sua conformação biologicamente activa. No meio aquoso em que se encontra a grande maioria das proteínas, este processo faz com que o polipéptido se enrole, levando as cadeias laterais hidrofóbicas dos resíduos de aminoácidos para o interior da sua estrutura, longe do contacto (termodinamicamente instável) com a água, mas deixando à sua superfície inúmeras cadeias laterais hidrofílicas, que podem interagir livremente com as moléculas de água do meio circundante. Dada a mobilidade térmica das moléculas (tal como ocorre a temperaturas superiores a -273,15 OC) e o facto de a energia de estabilização das proteínas na sua conformação nativa ser muito baixa, acontece muito frequentemente, à escala molecular, o desenrolamento parcial e ocasional das cadeias polipeptídicas, expondo grupos não polares ao contacto com a água. Esta instabilidade pode ser resolvida de duas maneiras: o polipéptido volta a adquirir a conformação biologicamente activa ou encontra uma parte hidrofóbica de outra molécula proteica parcialmente desenrolada e associa-se a ela, num processo também de natureza entrópica. E isto pode acontecer sucessivamente até à formação de agregados proteicos enormes, pela adição sempre sucessiva de novas moléculas parcialmente desenroladas. As células têm, por isso, sistemas cuja complexidade está ainda muito longe de ser compreendida e que detectam e degradam rapidamente as proteínas parcialmente desenroladas, evitando a formação dos grandes agregados proteicos. É o caso, por exemplo, da via proteolítica da ubiquitina/proteassoma. O meio celular está, por isso, permanentemente sob o escrutínio de sistemas proteolíticos, no sentido de evitar a formação de agregados que podem ocorrer espontaneamente em condições de temperaturas elevadas ou em consequência da formação de proteínas estruturalmente anómalas, portadoras de erros resultantes de mutações ou de erros a nível da transcrição e/ou tradução. Quando ocorre formação de agregados proteicos, torna-se impossível para as células e ou enzimas proteolíticas degradar as proteínas presentes nos agregados. Estes agregados podem envolver a formação de diversos tipos de ligações entre as proteínas que os compõem: - Ligações covalentes entre as proteínas constituintes – é o caso dos corpos de Lewy, característicos das células cerebrais dos pacientes com doença de Parkinson, compostos por moléculas de ubiquitina e de α-sinucleína. Notar que as doenças neurodegenerativas que afectam o homem se caracterizam pela formação de agregados proteicos que as enzimas proteolíticas dos neurónios são incapazes de degradar. - Ligações electrostáticas, como as que caracterizam a acumulação das proteínas de reserva das leguminosas (globulinas) nos PSVs (do Inglês Protein Storage Vacuoles) das suas sementes. Nestas partículas, as proteínas são empacotadas sob a forma de grandes agregados proteicos, com os metais alcalino-terrosos (neste caso o cálcio e, em menor extensão, o magnésio) a servirem de ponte electrostática entre duas cargas negativas de duas moléculas proteicas adjacentes. O mesmo mecanismo explica a formação do Tofu a partir das proteínas de reserva da soja e do Nigari™ (carbonato de cálcio e de magnésio). - Interacções hidrofóbicas, que explicam a formação da coalhada, constituída por hiperagregados proteicos entre as micelas de caseína, após estas sofrerem proteólise limitada por acção da renina do estômago dos ruminantes ou das cardosinas da flor do cardo - ver texto de apoio da Enciclopedia Verbo sobre “As proteínas do leite”. - Os priões, o agente “infeccioso” da doença de Creutzfeldt-Jakob (CJD) no homem, do scrapie nos ovinos e da doença das vacas loucas nos bovinos, é uma proteína cerebral que pode assumir duas conformações principais: uma dita normal, a outra patogénica porque induz idêntica conformação em moléculas adjacentes, que se aglomeram, acabando por conduzir à formação dos agregados proteicos que caracterizam estas doenças - ver texto de apoio da Enciclopedia Verbo sobre “Priões”. A patogénese: uma interacção entre um agente patogénico e um hospedeiro, seja ele o homem, um animal ou uma planta, pode ser considerada como uma guerra aberta, composta por inúmeras batalhas, cujas armas são proteínas e compostos de baixa massa molecular, sintetizados por ambos os organismos. O resultado final desta guerra dita o estabelecimento de resistência ou de patogénese. Os organismos superiores, quer plantas quer animais, encontram-se permanentemente em contacto com uma enorme variedade de microrganismos patogénicos e não patogénicos. Contudo, sabendo que o estado normal de uma planta ou animal é o saudável, o desenvolvimento de uma doença requer a ocorrência simultânea de um estado susceptível do hospedeiro, de um estado virulento do agente patogénico e de um meio ambiente favorável. Por outras palavras, nem todos os agentes patogénicos podem atacar todos os organismos, nem um só organismo é susceptível à panóplia total de agentes patogénicos. Na realidade, apenas uma fracção diminuta destes agentes é capaz de invadir, com sucesso, e provocar doença, em cada hospedeiro. Se, por um lado, a virulência dos agentes patogénicos e a susceptibilidade dos hospedeiros variam ao longo dos seus ciclos de vida, por outro, o desenvolvimento de uma doença depende fortemente das condições ambientais, como a disponibilidade em água, a temperatura, etc. Por todos estes motivos, o estabelecimento de uma doença é normalmente muito menos frequente do que o que seria de esperar. A presença de agentes patogénicos ao longo de centenas de milhões de anos permitiu às plantas e animais o desenvolvimento de uma ampla gama de ferramentas de defesa, intricadas e elaboradas. Este padrão surgiu a partir do que se pode considerar um processo de co-evolução do tipo ping-pong, em que hospedeiro e agente patogénico foram sucessivamente adicionando armas químicas ao longo de uma guerra perpétua. Sempre que uma inovação defensiva era estabelecida no hospedeiro, novas maneiras de a ultrapassar eram desenvolvidas pelo agente patogénico. Este processo co-evolutivo complexo explica, provavelmente, não só casos de extrema especificidade, que se estabeleceram entre muitos agentes patogénicos e os seus hospedeiros, como a ineficácia e/ou redundância de alguns genes defensivos, que frequentemente codificam enzimas com actividades sobrepostas. Nota: ver artigo dos textos de apoio intitulado “A Batalha Química para a Patogénese”. O sistema imunológico - Anticorpos policlonais - Anticorpos monoclonais - Abezimas As noções de anticorpos policlonais, anticorpos monoclonais, antigénio, epítopo e hapteno. Aplicações de anticorpos em Medicina no diagnóstico de doenças e outras condições fisiológicas. Aplicações de anticorpos como ferramenta Bioquímica: as técnicas de ELISA e de immunoblotting. Via proteolítica da ubiquitina/proteassoma proteassoma 26 S Ub Ub Ub Ub Ub E3 E2 Ub Proteína substrato Péptidos e aminoácidos Proteina substrato E1 E3 E2 E1 E1 Ub Ub E2 Ub Ub Ub Ub Blot anti-Ub Ub Proteína total Lemna minor L. Lectinas Lectinas são proteínas de origem não-imunológica (o que exclui os anticorpos que reconhecem e se ligam a hidratos de carbono), que se ligam de modo estável (exclui as enzimas que utilizam hidratos de carbono como substratos) a hidratos de carbono. Binding of lectins with opsonin activity to foreign substances such as bacteria promote phagocytosis (A). After binding to the carbohydrate chains on erythrocyte surface, hemolytic lectins induce membrane damage (e.g., by forming pores), leading to hemolysis (B). Microbes and lectins bind to carbohydrate receptors on cells Cell surface lectin– carbohydrate interactions. Lectins serve as means of attachment of different kinds of cell as well as viruses to other cells via the surface carbohydrates of the latter. In some cases, cellsurface lectins bind particular glycoproteins (e.g., asialoglycoproteins), whereas in other cases the carbohydrates of cell surface glycoproteins or glycolipids serve as sites of attachment for biologically active molecules that themselves are lectins (e.g. carbohydrate-specific bacterial and plant toxins, or galectins). Venenos de aranhas, cobras e escorpiões Muitos animais produzem venenos cujos princípios activos são polipéptidos ou proteínas. São os casos, por exemplo, de aranhas, cobras e escorpiões. veneno de aranha Muitas aranhas têm glândulas de veneno, que é utilizado para paralisar e matar as suas presas, mas que raramente é perigoso para o homem. É, porém, o caso das toxinas produzidas pela Latrodectus tredecimguttatus, da Europa Setentrional, e pela viúva negra-da-américa (L. nactans). Os príncípios activos do veneno são de natureza proteica e relacionados com os venenos de cobra e de escorpião. Contém, ainda, enzimas hidrolíticas, como a hialuronidase e proteases, mas é desprovido de fosfolipases e de agentes hemolíticos ou coagulantes. veneno de cobra É constituído por uma mistura de toxinas produzidas nas glândulas das cobras venenosas. Incluem um conjunto de polipéptidos e proteínas muito tóxicas, que provocam a paralisia e morte da presa, e enzimas, que facilitam a difusão das toxinas no corpo intacto da presa engolida e iniciam a sua digestão. As proteínas tóxicas são classificadas em três grupos com base no seu modo de acção: a) as cardiotoxinas são veneno do músculo cardíaco que originam a despolarização irreversível das membranas celulares do músculo do coração e das células nervosas; b) as neurotoxinas são venenos dos nervos que apresentam uma actividade idêntica à do curare - inibem a transmissâo de impulsos nervosos; c) os inibidores de proteases inibem a actividade da quimotripsina, da tripsina e da acetilcolinesterase e de outras enzimas envolvidas na transmissão de impulsos nervosos. Constituem exemplos destas toxinas a cobramina A, a cobramina B, a crotactina, a crotamina, a crotaxina e a taipoxina. As enzimas incluem a hialuronidase, que promove a dífusão das toxinas, a ATPase e a acetilcolinesterase, envolvidas na paralisia da presa, fosfolipases, responsáveis pela hemólise, e proteinases e L-aminoácido oxidases, de cuja acção resulta a necrose de tecidos e a coagulação do sangue. Estima-se que morrem 30.000 a 40.000 pessoas por ano devido a mordeduras de cobras venenosas, das quais cerca de 50 ocorrem na Europa. Muitos animais, como o ouriço cacheiro e o mangusto, possuem imunidade natural contra os vevenos de cobra. São utilizadas grandes quantidades destes venenos na preparação de anti-soros específicos em cavalos. Estes podem ser posteriormente utilizados na imunização contra as mordeduras das cobras. Alguns venenos de cobra têm aplicação terapêutica no tratamento de dores, de doenças reumáticas e de epilepsia. Por estes motivos, as cobras venenosas são criadas em cativeiro. O veneno é recolhido ou por mordedura numa membrana, com o veneno a ser injectado num reservatório de vidro, ou exercendo pressão nas glândulas que o contêm. Estas técnicas permitem a extracção de uma quantidade de veneno por cobra que varia, dependendo da espécie, entre umas dezenas e umas centenas de miligramas. veneno de escorpião Escorpiões pertencentes a vários géneros taxonómicos (Androctonus, Buthus, Centruroides, Leiurus, Tityus) excretam veneno pelo aparelho “picador” da cauda, o qual contém diversos péptidos neurotóxicos (com actividade no sistema nervoso, tanto periférico como central). Alguns destes péptidos, designados por escorpaminas, assemelham-se em estrutura e acção com neurotoxinas de venenos de cobra (nomeadamente da cobra capelo). Verifica-se que, do ponto de vista celular, as neurotoxinas do escorpião exercem os seus efeitos nefastos sobre o organismo animal, em consequência de interferirem com o funcionamento de canais iónicos, quer de Na+, K+ ou Cl-. Escorpião (Lychas marmoreus) Os péptidos que actuam sobre os canais de Na+ são os de maiores dimensões (contêm de 45 a 72 resíduos de aminoácidos) e é entre eles que se contam as escorpaminas. Recebem as designações mais específicas de toxinas α (toxina I, toxina M7, toxina V, etc.), toxinas β, toxinas γ ou, ainda, toxinas AaHIT4, AaIT, LqqIT, etc. Os péptidos que actuam sobre os canais de K+ são bastante mais pequenos (de 31 a 39 resíduos de aminoácidos), recebendo designações como: toxinas de Tityus, leiurotoxina I, iberiotoxina, margatoxina, noxiustoxina, etc. Os péptidos que actuam sobre canais de Cl- são também pequenos (cerca de 36 resíduos de aminoácidos), sendo exemplo a clorotoxina. As manifestações macroscópicas do efeito destas várias toxinas são bastante variáveis com a toxina e com os organismos sobre que actuam, os quais podem ser insectos (como baratas), caranguejos, ratos, coelhos, mamíferos de maiores dimensões ou mesmo o homem. As α-toxinas (toxina I) do escorpião do Norte de África (Androctonus australis) são péptidos com cerca de 64 resíduos de aminoácidos, que se contam entre os mais potentes venenos neurotóxicos. Produzem hiperexcitabilidade muscular, aceleração da respiração, convulsões, parálise espástica e, eventualmente, paragem respiratória. Proteinas com actividade anti-fúngica e proteinas PR (do Inglês Pathogenesis related) Referência: Ferreira, R.B., Monteiro, S., Freitas, R., Santos, C.N., Chen, Z., Batista, L.M., Duarte, J., Borges, A. e Teixeira, A.R. (2007) The role of plant defence proteins in fungal pathogenesis. Molecular Plant Pathology, 8 : 677-700. Ricina Trata-se de uma lectina fortemente tóxica, presente nas sementes do rícino (Ricinus communis). É uma toxalbumina. É uma glicoproteína composta por 493 resíduos de aminoácidos (66 kDa), constituída por uma cadeia polipeptídica A (32 kDa) e uma cadeia polipeptídica B (34 kDa), unidas por uma ligação de persulfureto. Após separação redutiva das duas cadeias por tratamento com 2-mercaptoetanol, ambas as cadeias apresentam uma actividade inibitória aumentada, mas uma toxicidade marcadamente reduzida. A actividade tóxica é conferida pela cadeia A (efectómero), servindo a cadeia B (haptómero) para ligar a toxina à superfície celular. A ricina inibe a biossíntese das proteínas (provoca a dissociação dos polissomas) e exibe propriedades antitumor. A dose letal, determinada em ratinhos, é de 1 ng de azoto de ricina por g de peso corporal. A alta toxicidade da ricina para as células eucariotas resulta da seguinte sequência de acontecimentos: a) A ricina liga-se às células por interacção entre a sua cadeia polipeptídica B e resíduos de galactose de receptores presentes na superfície da célula. b) A ligação de persulfurero da ricina é subsequentemente cortada, permitindo a entrada da sua cadeia polípeptídíca A para o interior da célula por endocitose. c) A cadeia A liga-se então às proteínas da subunidade 60S do ribossoma, aparentemente na região dos centros de ligação dos factores de alongamento eEF-1 e eEF-2, bloqueando a tradução de proteínas. Aminoácidos, péptidos e proteínas como mecanismos de defesa Questões: 1 – Alguns aminoácidos não proteicos são análogos estruturais de aminoácidos proteicos, podendo, em determinadas condições, ser mesmo incorporados em polipéptidos durante o mecanismo de síntese proteica. Como conjuga esta informação com a definição de aminoácido não-proteico? 2 - A toxicidade manifestada por muitos aminoácidos, péptidos e proteínas leva a que sejam utilizados como mecanismos de defesa por uma grande variedade de organismos. Esta adaptação coloca, inevitavelmente, um problema para o organismo que acumula o composto tóxico: como evitar intoxicar-se com o seu próprio produto tóxico? a) Dê um exemplo de um aminoácido, de um péptido e de uma proteína que sejam utilizados como mecanismos de defesa. b) Descreva um estratégia utilizada por um organismo para não ser intoxicado pelo seu próprio produto tóxico. FIM